--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:56:00 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2647/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -726.73 -730.19
2 -726.68 -730.08
--------------------------------------
TOTAL -726.71 -730.13
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899747 0.090317 0.392475 1.517546 0.861391 1282.51 1341.41 1.001
r(A<->C){all} 0.160955 0.018051 0.000083 0.428588 0.126316 132.42 147.09 1.003
r(A<->G){all} 0.163183 0.019701 0.000086 0.443836 0.124188 214.46 235.65 1.000
r(A<->T){all} 0.166883 0.021443 0.000004 0.464081 0.126221 202.79 258.30 1.001
r(C<->G){all} 0.162435 0.018894 0.000014 0.440804 0.125714 197.40 254.35 1.000
r(C<->T){all} 0.178287 0.022267 0.000071 0.486684 0.138337 189.31 223.48 1.001
r(G<->T){all} 0.168258 0.019626 0.000047 0.444443 0.135467 174.31 238.73 1.001
pi(A){all} 0.258226 0.000357 0.223111 0.295666 0.258065 1349.94 1425.47 1.000
pi(C){all} 0.313763 0.000404 0.274232 0.352924 0.313669 1178.23 1280.02 1.001
pi(G){all} 0.254291 0.000352 0.218823 0.290992 0.254276 1274.67 1291.50 1.000
pi(T){all} 0.173720 0.000269 0.141415 0.205350 0.173365 1249.28 1318.88 1.001
alpha{1,2} 0.409389 0.214384 0.000181 1.345662 0.245786 1344.13 1376.10 1.000
alpha{3} 0.461981 0.238951 0.000299 1.425750 0.301348 1377.66 1422.40 1.000
pinvar{all} 0.997005 0.000013 0.990138 0.999995 0.998185 1110.31 1237.92 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -704.364555
Model 2: PositiveSelection -704.364555
Model 0: one-ratio -704.36461
Model 7: beta -704.364555
Model 8: beta&w>1 -704.364597
Model 0 vs 1 1.0999999994965037E-4
Model 2 vs 1 0.0
Model 8 vs 7 8.400000001529406E-5
>C1
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
>C2
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
>C3
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
>C4
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
>C5
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
>C6
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=177
C1 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
C2 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
C3 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
C4 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
C5 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
C6 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
**************************************************
C1 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
C2 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
C3 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
C4 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
C5 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
C6 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
**************************************************
C1 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
C2 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
C3 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
C4 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
C5 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
C6 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
**************************************************
C1 PNGYTCHFVRPNWKLPRRAPADAKADS
C2 PNGYTCHFVRPNWKLPRRAPADAKADS
C3 PNGYTCHFVRPNWKLPRRAPADAKADS
C4 PNGYTCHFVRPNWKLPRRAPADAKADS
C5 PNGYTCHFVRPNWKLPRRAPADAKADS
C6 PNGYTCHFVRPNWKLPRRAPADAKADS
***************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 177 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 177 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5310]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5310]--->[5310]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.474 Mb, Max= 30.716 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
C2 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
C3 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
C4 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
C5 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
C6 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
**************************************************
C1 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
C2 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
C3 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
C4 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
C5 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
C6 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
**************************************************
C1 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
C2 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
C3 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
C4 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
C5 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
C6 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
**************************************************
C1 PNGYTCHFVRPNWKLPRRAPADAKADS
C2 PNGYTCHFVRPNWKLPRRAPADAKADS
C3 PNGYTCHFVRPNWKLPRRAPADAKADS
C4 PNGYTCHFVRPNWKLPRRAPADAKADS
C5 PNGYTCHFVRPNWKLPRRAPADAKADS
C6 PNGYTCHFVRPNWKLPRRAPADAKADS
***************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
C2 ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
C3 ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
C4 ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
C5 ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
C6 ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
**************************************************
C1 GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
C2 GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
C3 GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
C4 GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
C5 GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
C6 GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
**************************************************
C1 TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
C2 TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
C3 TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
C4 TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
C5 TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
C6 TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
**************************************************
C1 ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
C2 ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
C3 ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
C4 ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
C5 ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
C6 ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
**************************************************
C1 TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
C2 TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
C3 TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
C4 TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
C5 TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
C6 TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
**************************************************
C1 ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
C2 ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
C3 ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
C4 ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
C5 ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
C6 ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
**************************************************
C1 CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
C2 CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
C3 CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
C4 CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
C5 CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
C6 CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
**************************************************
C1 GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
C2 GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
C3 GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
C4 GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
C5 GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
C6 GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
**************************************************
C1 AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
C2 AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
C3 AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
C4 AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
C5 AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
C6 AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
**************************************************
C1 CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
C2 CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
C3 CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
C4 CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
C5 CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
C6 CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
**************************************************
C1 ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
C2 ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
C3 ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
C4 ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
C5 ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
C6 ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
*******************************
>C1
ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
>C2
ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
>C3
ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
>C4
ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
>C5
ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
>C6
ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG
GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG
TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC
ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA
TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA
ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC
CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA
GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG
AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT
CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG
ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
>C1
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
>C2
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
>C3
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
>C4
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
>C5
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
>C6
MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
PNGYTCHFVRPNWKLPRRAPADAKADS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 531 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859678
Setting output file names to "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2061897746
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5607162996
Seed = 321026463
Swapseed = 1579859678
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1188.403462 -- -24.965149
Chain 2 -- -1188.403462 -- -24.965149
Chain 3 -- -1188.403395 -- -24.965149
Chain 4 -- -1188.403395 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1188.403395 -- -24.965149
Chain 2 -- -1188.403462 -- -24.965149
Chain 3 -- -1188.403462 -- -24.965149
Chain 4 -- -1188.403281 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1188.403] (-1188.403) (-1188.403) (-1188.403) * [-1188.403] (-1188.403) (-1188.403) (-1188.403)
500 -- (-734.740) (-735.536) (-743.903) [-733.843] * [-739.316] (-739.209) (-738.585) (-730.403) -- 0:00:00
1000 -- (-736.653) (-733.310) [-733.446] (-736.762) * (-734.890) (-738.653) [-732.581] (-742.351) -- 0:00:00
1500 -- (-737.248) [-735.546] (-747.583) (-736.502) * [-735.765] (-733.653) (-739.026) (-747.498) -- 0:00:00
2000 -- (-738.467) [-732.164] (-733.938) (-738.240) * (-745.883) (-735.656) (-734.442) [-737.933] -- 0:00:00
2500 -- [-733.899] (-731.781) (-737.330) (-737.164) * (-738.777) [-735.827] (-734.688) (-737.279) -- 0:00:00
3000 -- (-734.289) [-735.064] (-746.276) (-734.147) * (-739.624) (-733.090) [-732.237] (-743.310) -- 0:00:00
3500 -- (-741.366) [-734.853] (-741.524) (-739.455) * (-740.039) (-736.904) (-743.485) [-740.340] -- 0:00:00
4000 -- (-733.172) (-739.410) (-743.222) [-736.029] * (-745.792) [-738.194] (-734.422) (-741.956) -- 0:00:00
4500 -- [-740.264] (-739.461) (-736.474) (-738.744) * [-732.024] (-730.822) (-733.391) (-733.092) -- 0:00:00
5000 -- (-737.433) (-733.893) (-738.391) [-738.396] * (-734.421) [-739.297] (-744.131) (-734.572) -- 0:03:19
Average standard deviation of split frequencies: 0.082309
5500 -- (-734.600) (-744.838) (-737.790) [-734.440] * (-742.952) (-743.004) (-736.192) [-738.336] -- 0:03:00
6000 -- [-733.746] (-740.890) (-732.216) (-734.206) * (-738.125) (-730.701) [-732.634] (-740.164) -- 0:02:45
6500 -- (-732.639) (-748.932) (-733.271) [-731.999] * (-734.044) (-745.044) (-737.575) [-747.042] -- 0:02:32
7000 -- [-734.611] (-737.664) (-741.169) (-740.428) * (-735.073) (-734.524) (-738.253) [-727.313] -- 0:02:21
7500 -- [-732.442] (-734.771) (-741.771) (-739.528) * (-739.271) (-730.190) (-738.293) [-726.834] -- 0:02:12
8000 -- [-738.155] (-738.068) (-739.345) (-732.753) * (-734.871) (-735.559) (-742.289) [-727.261] -- 0:02:04
8500 -- [-729.441] (-736.206) (-742.018) (-739.565) * (-728.832) (-738.982) [-735.877] (-726.774) -- 0:01:56
9000 -- [-733.462] (-749.063) (-730.095) (-735.104) * (-736.379) (-732.218) [-736.760] (-727.049) -- 0:01:50
9500 -- (-738.115) (-735.010) [-737.270] (-735.283) * (-741.897) (-738.786) [-743.488] (-726.377) -- 0:01:44
10000 -- [-734.839] (-736.173) (-734.699) (-737.044) * (-742.371) (-731.310) (-733.188) [-725.841] -- 0:01:39
Average standard deviation of split frequencies: 0.065128
10500 -- [-733.323] (-753.211) (-741.489) (-734.877) * (-732.288) (-739.807) [-734.350] (-725.717) -- 0:01:34
11000 -- (-739.434) (-733.260) (-738.368) [-733.111] * (-740.257) (-734.973) (-736.336) [-726.359] -- 0:01:29
11500 -- [-736.811] (-726.953) (-739.635) (-731.041) * (-742.119) [-733.398] (-734.341) (-726.264) -- 0:01:25
12000 -- (-739.232) [-727.450] (-732.526) (-738.588) * [-729.717] (-738.289) (-736.454) (-728.119) -- 0:01:22
12500 -- (-736.957) [-726.323] (-740.808) (-743.513) * (-739.778) (-741.358) (-734.720) [-726.570] -- 0:01:19
13000 -- (-738.610) (-726.137) [-733.286] (-742.065) * [-737.334] (-733.121) (-737.603) (-728.780) -- 0:01:15
13500 -- (-733.891) (-726.725) (-736.115) [-732.989] * (-735.046) (-729.519) [-731.088] (-727.726) -- 0:01:13
14000 -- (-742.820) [-730.922] (-743.421) (-738.070) * (-732.672) (-731.578) [-736.564] (-726.787) -- 0:01:10
14500 -- (-742.298) (-727.618) (-737.808) [-737.882] * (-738.456) (-729.762) [-733.997] (-730.008) -- 0:01:07
15000 -- (-738.396) [-725.997] (-735.266) (-737.438) * [-734.334] (-729.234) (-735.786) (-729.991) -- 0:01:05
Average standard deviation of split frequencies: 0.052723
15500 -- (-743.742) [-727.687] (-735.880) (-737.886) * (-746.884) (-732.210) (-736.128) [-729.269] -- 0:01:03
16000 -- (-734.246) (-727.098) [-738.428] (-741.713) * (-735.303) (-727.518) [-739.724] (-726.650) -- 0:01:01
16500 -- (-729.310) (-728.239) (-739.616) [-738.525] * (-732.753) (-727.627) [-736.351] (-728.188) -- 0:00:59
17000 -- (-736.414) (-727.126) [-737.698] (-735.747) * (-744.252) (-729.800) (-741.766) [-726.539] -- 0:00:57
17500 -- [-744.026] (-727.807) (-740.306) (-738.171) * (-738.482) (-727.568) [-735.932] (-725.797) -- 0:01:52
18000 -- (-735.745) (-727.415) [-733.054] (-743.947) * (-744.818) (-726.171) [-734.115] (-727.149) -- 0:01:49
18500 -- [-732.726] (-729.655) (-732.071) (-744.614) * [-733.832] (-728.627) (-740.873) (-727.128) -- 0:01:46
19000 -- (-731.424) (-725.990) (-737.097) [-731.485] * [-735.778] (-725.396) (-733.771) (-728.097) -- 0:01:43
19500 -- [-736.416] (-729.272) (-736.857) (-743.678) * (-744.328) [-725.474] (-732.246) (-729.536) -- 0:01:40
20000 -- (-736.664) [-726.870] (-732.524) (-762.276) * [-737.387] (-728.040) (-735.712) (-727.777) -- 0:01:38
Average standard deviation of split frequencies: 0.031583
20500 -- (-731.365) (-726.351) [-737.273] (-733.342) * (-741.467) (-728.170) (-734.613) [-728.322] -- 0:01:35
21000 -- (-748.031) [-726.898] (-738.006) (-726.519) * (-736.584) (-730.782) [-734.757] (-727.881) -- 0:01:33
21500 -- (-745.579) [-727.581] (-736.046) (-729.414) * [-732.745] (-727.688) (-738.708) (-732.162) -- 0:01:31
22000 -- (-732.527) [-729.009] (-751.524) (-726.587) * (-732.589) (-725.795) (-738.855) [-726.326] -- 0:02:13
22500 -- [-734.433] (-730.398) (-737.332) (-726.272) * (-740.527) (-727.427) [-738.417] (-728.057) -- 0:02:10
23000 -- (-738.492) (-727.824) [-744.281] (-726.395) * (-736.919) (-728.150) (-740.549) [-731.210] -- 0:02:07
23500 -- [-735.862] (-726.861) (-739.400) (-726.698) * (-730.396) (-730.477) (-737.276) [-730.203] -- 0:02:04
24000 -- (-736.796) (-728.038) (-733.480) [-730.263] * (-734.875) [-728.689] (-735.876) (-729.471) -- 0:02:02
24500 -- (-743.540) (-730.958) (-733.524) [-725.980] * [-733.678] (-727.367) (-736.925) (-728.591) -- 0:01:59
25000 -- (-736.198) [-728.274] (-745.163) (-727.804) * (-739.129) (-727.045) [-738.213] (-728.805) -- 0:01:57
Average standard deviation of split frequencies: 0.027591
25500 -- (-735.890) (-728.323) [-741.278] (-726.839) * [-737.170] (-727.628) (-731.101) (-728.779) -- 0:01:54
26000 -- [-732.898] (-726.184) (-741.689) (-726.578) * [-741.253] (-726.264) (-735.692) (-728.581) -- 0:01:52
26500 -- (-740.381) [-728.075] (-743.636) (-726.031) * (-743.536) (-728.274) (-736.829) [-727.106] -- 0:01:50
27000 -- (-739.774) (-725.885) [-736.030] (-727.140) * [-738.077] (-726.802) (-736.009) (-727.991) -- 0:01:48
27500 -- [-737.255] (-725.840) (-735.621) (-726.360) * (-734.877) (-725.690) [-734.007] (-728.322) -- 0:01:46
28000 -- (-738.344) [-727.325] (-737.117) (-729.261) * (-736.883) (-725.511) (-730.778) [-725.642] -- 0:01:44
28500 -- (-744.044) (-726.060) [-737.408] (-728.771) * (-741.750) (-727.757) [-727.034] (-726.019) -- 0:01:42
29000 -- (-737.248) (-730.052) (-739.940) [-728.270] * (-732.054) [-728.893] (-730.578) (-726.499) -- 0:01:40
29500 -- [-730.063] (-730.024) (-741.322) (-729.827) * (-739.479) (-729.288) (-733.640) [-727.491] -- 0:01:38
30000 -- [-734.845] (-726.711) (-745.067) (-725.948) * (-740.710) (-726.816) (-728.391) [-726.082] -- 0:01:37
Average standard deviation of split frequencies: 0.032665
30500 -- (-737.293) (-726.677) (-736.201) [-727.033] * [-737.230] (-729.548) (-727.960) (-725.846) -- 0:01:35
31000 -- (-742.740) (-729.584) [-726.752] (-728.629) * [-735.107] (-729.491) (-726.129) (-726.105) -- 0:01:33
31500 -- (-739.221) (-730.054) (-726.435) [-728.133] * (-739.975) (-727.839) [-725.607] (-727.044) -- 0:01:32
32000 -- [-736.609] (-728.830) (-725.617) (-728.965) * (-734.883) (-728.025) [-726.332] (-728.058) -- 0:01:30
32500 -- [-729.718] (-728.240) (-733.916) (-727.713) * (-735.004) (-728.317) [-725.710] (-729.533) -- 0:01:29
33000 -- (-742.099) [-726.438] (-727.516) (-727.258) * (-738.946) (-729.619) [-725.200] (-726.021) -- 0:01:27
33500 -- [-736.783] (-728.929) (-728.566) (-728.108) * (-729.910) [-725.963] (-727.834) (-725.900) -- 0:01:55
34000 -- (-737.585) (-732.606) [-728.373] (-727.449) * (-741.191) (-726.602) (-727.436) [-727.546] -- 0:01:53
34500 -- (-738.327) (-726.627) [-726.620] (-726.417) * (-739.985) (-726.876) (-730.566) [-727.080] -- 0:01:51
35000 -- (-736.958) [-728.315] (-728.971) (-725.931) * [-737.608] (-728.447) (-731.921) (-729.199) -- 0:01:50
Average standard deviation of split frequencies: 0.034191
35500 -- (-747.224) (-728.569) (-726.124) [-725.979] * (-743.051) [-726.077] (-732.040) (-727.669) -- 0:01:48
36000 -- [-732.543] (-729.318) (-727.893) (-728.448) * (-734.889) [-727.658] (-729.296) (-726.578) -- 0:01:47
36500 -- (-738.618) [-732.190] (-726.541) (-726.707) * (-745.727) [-727.923] (-730.294) (-728.204) -- 0:01:45
37000 -- (-737.818) [-727.327] (-727.964) (-728.323) * (-734.713) (-726.133) (-730.799) [-727.280] -- 0:01:44
37500 -- [-736.735] (-727.367) (-728.581) (-728.157) * [-732.104] (-725.676) (-735.422) (-726.038) -- 0:01:42
38000 -- (-735.261) (-726.077) [-727.996] (-729.155) * (-743.157) [-725.940] (-726.922) (-726.998) -- 0:01:41
38500 -- (-732.546) (-726.001) [-727.660] (-729.678) * [-739.929] (-726.532) (-726.253) (-728.050) -- 0:01:39
39000 -- [-725.621] (-726.600) (-726.610) (-726.399) * (-736.462) [-728.397] (-725.829) (-725.359) -- 0:01:38
39500 -- [-728.250] (-729.403) (-726.327) (-726.850) * [-737.583] (-725.343) (-726.161) (-727.726) -- 0:01:37
40000 -- [-726.198] (-727.119) (-726.301) (-730.774) * [-743.470] (-725.799) (-727.418) (-725.870) -- 0:01:36
Average standard deviation of split frequencies: 0.036139
40500 -- (-725.635) (-730.347) [-728.206] (-728.453) * (-741.883) [-727.434] (-728.485) (-726.502) -- 0:01:34
41000 -- (-725.492) (-729.547) [-726.412] (-727.479) * [-739.045] (-726.897) (-726.489) (-730.061) -- 0:01:33
41500 -- (-729.754) (-727.494) (-728.909) [-727.154] * (-736.964) (-727.152) [-730.469] (-729.773) -- 0:01:32
42000 -- [-730.939] (-728.267) (-727.729) (-726.254) * (-741.312) (-726.634) [-728.012] (-729.026) -- 0:01:31
42500 -- (-726.460) (-727.633) [-730.282] (-729.226) * (-739.184) (-727.991) (-728.394) [-727.187] -- 0:01:30
43000 -- (-726.215) (-727.902) (-733.397) [-728.806] * (-740.267) (-728.460) [-728.855] (-726.426) -- 0:01:29
43500 -- (-726.791) (-726.027) [-727.240] (-728.940) * (-733.653) (-734.233) [-726.700] (-726.418) -- 0:01:27
44000 -- (-726.337) [-725.594] (-728.708) (-726.999) * (-727.863) (-725.821) [-726.017] (-729.015) -- 0:01:26
44500 -- (-726.157) [-725.499] (-728.573) (-727.097) * (-729.653) (-727.819) [-726.668] (-727.328) -- 0:01:25
45000 -- (-725.712) (-726.910) (-730.189) [-727.170] * (-727.311) (-726.538) [-731.099] (-727.253) -- 0:01:24
Average standard deviation of split frequencies: 0.027017
45500 -- (-726.333) [-727.048] (-733.154) (-728.467) * [-725.791] (-726.402) (-728.236) (-726.163) -- 0:01:23
46000 -- (-727.237) (-730.784) [-727.227] (-726.766) * [-726.649] (-728.730) (-726.759) (-727.554) -- 0:01:22
46500 -- (-727.544) [-737.775] (-726.955) (-729.978) * (-728.094) (-727.812) [-726.230] (-731.867) -- 0:01:22
47000 -- (-726.854) (-727.037) [-729.220] (-727.061) * (-727.900) (-731.642) [-728.996] (-727.292) -- 0:01:41
47500 -- (-727.728) (-728.633) [-728.011] (-725.482) * (-728.783) (-731.009) [-726.503] (-726.154) -- 0:01:40
48000 -- (-726.696) (-728.740) [-729.202] (-725.359) * (-726.288) (-727.645) (-726.419) [-726.188] -- 0:01:39
48500 -- (-725.410) (-731.914) (-725.485) [-725.561] * (-729.060) (-727.454) (-726.286) [-727.060] -- 0:01:38
49000 -- [-725.883] (-729.496) (-727.174) (-726.236) * (-728.883) [-725.842] (-726.111) (-733.494) -- 0:01:37
49500 -- (-729.321) [-732.721] (-727.114) (-727.113) * (-728.638) [-726.637] (-726.135) (-730.594) -- 0:01:36
50000 -- (-729.177) (-727.046) (-729.859) [-729.644] * (-730.158) [-725.683] (-727.066) (-727.111) -- 0:01:35
Average standard deviation of split frequencies: 0.024974
50500 -- [-727.424] (-726.777) (-729.450) (-727.276) * (-732.553) (-725.947) (-729.440) [-732.022] -- 0:01:34
51000 -- [-727.077] (-729.109) (-728.721) (-727.527) * [-726.852] (-726.210) (-730.063) (-732.250) -- 0:01:33
51500 -- (-726.474) [-729.888] (-726.921) (-727.375) * (-726.853) [-727.231] (-729.076) (-728.304) -- 0:01:32
52000 -- (-728.783) (-732.933) (-727.130) [-726.061] * (-726.052) (-726.537) [-728.765] (-726.701) -- 0:01:31
52500 -- [-728.256] (-733.017) (-725.882) (-727.875) * (-733.773) [-726.127] (-726.630) (-725.625) -- 0:01:30
53000 -- (-727.636) (-730.220) [-728.300] (-727.338) * (-730.114) [-727.207] (-726.498) (-728.707) -- 0:01:29
53500 -- (-726.488) (-729.316) (-729.683) [-726.899] * (-733.306) (-727.813) (-727.492) [-726.701] -- 0:01:28
54000 -- (-729.586) (-730.877) (-727.818) [-729.226] * (-727.741) (-726.075) [-726.202] (-729.083) -- 0:01:27
54500 -- (-728.916) [-729.753] (-727.742) (-729.426) * (-728.544) [-726.017] (-727.241) (-726.256) -- 0:01:26
55000 -- [-725.979] (-726.592) (-727.117) (-728.589) * (-725.551) (-727.365) [-725.937] (-729.302) -- 0:01:25
Average standard deviation of split frequencies: 0.021266
55500 -- (-726.182) (-728.039) (-726.983) [-728.762] * (-727.178) [-726.376] (-727.453) (-730.267) -- 0:01:25
56000 -- [-728.400] (-727.250) (-725.769) (-729.311) * (-727.631) (-727.338) [-728.590] (-727.462) -- 0:01:24
56500 -- (-726.029) (-728.098) (-725.262) [-726.500] * [-728.419] (-728.136) (-726.491) (-726.825) -- 0:01:23
57000 -- (-726.028) (-728.503) (-726.051) [-726.302] * [-728.102] (-728.111) (-727.660) (-727.327) -- 0:01:22
57500 -- (-726.223) (-725.616) (-727.192) [-726.494] * (-727.298) (-728.917) (-727.548) [-729.738] -- 0:01:21
58000 -- (-727.104) (-728.205) (-732.243) [-725.707] * (-731.498) (-727.704) (-726.155) [-725.945] -- 0:01:21
58500 -- (-733.529) (-727.998) (-731.200) [-726.122] * (-732.196) (-726.203) (-728.361) [-729.872] -- 0:01:20
59000 -- (-729.606) (-726.448) (-728.403) [-726.885] * (-726.452) [-726.759] (-726.341) (-728.468) -- 0:01:19
59500 -- (-727.350) [-726.540] (-726.593) (-732.927) * (-726.316) (-725.830) (-726.549) [-727.933] -- 0:01:19
60000 -- [-727.272] (-726.184) (-726.299) (-732.732) * [-727.225] (-726.199) (-727.999) (-727.916) -- 0:01:18
Average standard deviation of split frequencies: 0.028060
60500 -- (-730.036) (-726.290) [-727.408] (-727.134) * (-726.448) (-726.545) [-726.798] (-726.388) -- 0:01:33
61000 -- (-731.014) [-727.010] (-726.742) (-726.051) * (-728.649) (-726.102) (-729.087) [-727.895] -- 0:01:32
61500 -- (-728.903) (-727.157) (-730.837) [-726.290] * (-725.699) [-725.707] (-728.774) (-729.121) -- 0:01:31
62000 -- (-727.675) [-728.586] (-726.276) (-728.744) * [-726.590] (-726.668) (-730.684) (-727.877) -- 0:01:30
62500 -- (-728.346) (-728.751) [-725.184] (-725.541) * (-727.926) (-725.759) (-732.400) [-728.953] -- 0:01:30
63000 -- (-728.293) (-729.791) [-725.668] (-726.220) * (-728.686) [-725.734] (-726.425) (-728.297) -- 0:01:29
63500 -- (-730.309) (-728.384) (-726.156) [-726.057] * [-728.040] (-726.267) (-727.765) (-726.547) -- 0:01:28
64000 -- [-729.174] (-727.636) (-727.730) (-725.979) * (-727.310) (-726.542) [-727.584] (-726.785) -- 0:01:27
64500 -- (-727.669) (-726.777) [-727.979] (-728.068) * (-728.025) [-731.597] (-728.821) (-726.436) -- 0:01:27
65000 -- (-726.013) [-726.200] (-726.562) (-726.538) * (-727.363) (-726.380) (-727.843) [-728.624] -- 0:01:26
Average standard deviation of split frequencies: 0.023808
65500 -- [-725.788] (-726.344) (-726.802) (-726.204) * (-728.033) [-726.898] (-726.380) (-727.242) -- 0:01:25
66000 -- [-725.891] (-725.439) (-726.719) (-725.820) * (-728.636) (-726.215) (-726.557) [-731.136] -- 0:01:24
66500 -- (-725.474) (-727.413) [-727.995] (-728.791) * [-727.003] (-731.344) (-727.187) (-726.567) -- 0:01:24
67000 -- [-727.320] (-727.015) (-727.847) (-726.082) * (-726.364) (-729.266) [-726.189] (-726.608) -- 0:01:23
67500 -- [-726.715] (-732.709) (-727.149) (-727.859) * (-727.330) (-728.546) [-726.816] (-728.229) -- 0:01:22
68000 -- [-726.126] (-727.478) (-728.811) (-728.065) * (-727.130) (-729.329) [-726.651] (-729.202) -- 0:01:22
68500 -- [-726.802] (-727.468) (-729.339) (-727.012) * (-729.731) (-727.684) (-726.920) [-728.824] -- 0:01:21
69000 -- (-729.768) (-729.120) (-728.231) [-727.289] * (-727.667) [-728.799] (-726.654) (-727.471) -- 0:01:20
69500 -- [-727.923] (-729.345) (-729.135) (-729.818) * (-726.488) [-726.004] (-727.349) (-726.248) -- 0:01:20
70000 -- (-727.081) [-727.230] (-729.441) (-726.757) * [-729.676] (-726.237) (-726.985) (-725.946) -- 0:01:19
Average standard deviation of split frequencies: 0.029492
70500 -- (-728.152) (-726.847) [-728.249] (-728.706) * [-728.021] (-727.471) (-728.262) (-732.120) -- 0:01:19
71000 -- (-733.115) [-728.582] (-730.294) (-729.141) * (-733.295) (-726.699) [-725.674] (-728.548) -- 0:01:18
71500 -- (-729.625) (-726.528) (-726.769) [-727.210] * (-732.051) (-727.106) (-726.750) [-725.659] -- 0:01:17
72000 -- (-727.424) [-727.991] (-730.082) (-728.494) * (-726.056) [-726.658] (-726.881) (-725.503) -- 0:01:17
72500 -- (-728.729) (-725.275) (-726.679) [-725.765] * (-728.563) [-726.011] (-728.057) (-727.069) -- 0:01:16
73000 -- (-728.047) (-727.899) [-729.317] (-726.169) * (-729.741) (-725.406) [-727.429] (-725.889) -- 0:01:16
73500 -- (-734.667) [-725.868] (-728.629) (-727.537) * [-729.105] (-725.904) (-730.317) (-729.857) -- 0:01:15
74000 -- [-729.121] (-725.630) (-728.373) (-727.643) * [-727.507] (-729.525) (-727.860) (-726.672) -- 0:01:15
74500 -- (-728.306) (-730.898) (-731.331) [-727.193] * (-733.044) (-730.447) [-730.017] (-726.676) -- 0:01:14
75000 -- (-725.438) [-726.587] (-725.668) (-726.455) * (-728.158) [-727.010] (-731.784) (-727.642) -- 0:01:26
Average standard deviation of split frequencies: 0.027602
75500 -- (-726.061) (-726.117) [-725.638] (-732.205) * [-725.911] (-727.360) (-735.783) (-729.090) -- 0:01:25
76000 -- (-725.585) (-728.957) [-727.812] (-731.824) * (-728.517) (-728.128) [-728.607] (-726.542) -- 0:01:25
76500 -- [-725.682] (-725.232) (-729.030) (-725.885) * [-727.562] (-725.410) (-729.938) (-726.164) -- 0:01:24
77000 -- (-726.901) [-725.593] (-725.982) (-727.876) * [-729.889] (-725.755) (-728.367) (-727.303) -- 0:01:23
77500 -- [-728.551] (-726.111) (-725.015) (-727.440) * (-730.387) (-725.436) (-728.648) [-727.887] -- 0:01:23
78000 -- [-728.321] (-728.175) (-726.412) (-725.595) * [-726.649] (-725.704) (-727.338) (-733.891) -- 0:01:22
78500 -- (-727.083) [-727.434] (-725.221) (-729.208) * (-726.610) (-725.466) [-727.618] (-728.775) -- 0:01:22
79000 -- (-728.427) (-726.592) (-726.352) [-735.328] * (-726.804) (-728.268) (-728.218) [-730.350] -- 0:01:21
79500 -- (-727.248) [-725.844] (-726.436) (-734.212) * (-732.991) [-725.853] (-727.723) (-734.330) -- 0:01:21
80000 -- (-731.263) (-730.395) (-726.270) [-725.895] * (-725.728) (-727.812) [-726.353] (-732.267) -- 0:01:20
Average standard deviation of split frequencies: 0.026590
80500 -- [-729.352] (-731.293) (-729.498) (-726.443) * (-725.605) [-728.732] (-725.881) (-734.453) -- 0:01:19
81000 -- (-726.946) (-727.400) (-732.159) [-726.102] * (-725.822) (-729.622) [-726.155] (-731.673) -- 0:01:19
81500 -- (-730.317) [-727.417] (-731.437) (-726.311) * (-726.397) (-728.402) [-726.280] (-726.705) -- 0:01:18
82000 -- (-726.634) (-725.803) (-726.913) [-727.700] * [-726.521] (-728.280) (-726.177) (-726.318) -- 0:01:18
82500 -- (-729.806) [-727.588] (-727.294) (-727.477) * [-726.694] (-725.724) (-726.494) (-730.048) -- 0:01:17
83000 -- (-725.521) [-725.565] (-726.236) (-727.226) * (-726.571) (-725.650) [-729.732] (-730.038) -- 0:01:17
83500 -- (-727.006) (-730.158) [-726.817] (-728.833) * (-727.745) (-729.671) [-726.891] (-730.616) -- 0:01:16
84000 -- (-727.131) [-725.858] (-726.487) (-729.112) * [-726.835] (-728.092) (-726.098) (-726.578) -- 0:01:16
84500 -- (-729.317) [-730.577] (-726.222) (-729.641) * (-727.230) (-725.817) [-726.352] (-733.981) -- 0:01:15
85000 -- (-728.154) (-726.895) [-726.347] (-728.106) * (-729.394) (-729.478) [-725.721] (-736.555) -- 0:01:15
Average standard deviation of split frequencies: 0.022748
85500 -- (-727.391) (-725.764) [-726.497] (-727.899) * (-730.039) (-728.168) [-727.378] (-726.867) -- 0:01:14
86000 -- (-726.097) (-726.302) [-724.985] (-730.404) * (-727.379) (-731.508) [-728.791] (-725.450) -- 0:01:14
86500 -- (-727.792) [-728.009] (-725.658) (-727.109) * (-725.661) [-730.996] (-728.322) (-726.237) -- 0:01:13
87000 -- [-728.847] (-727.493) (-727.599) (-727.023) * (-725.463) (-726.935) [-728.898] (-729.964) -- 0:01:13
87500 -- (-726.289) [-726.229] (-727.159) (-727.148) * (-725.703) (-726.187) [-727.684] (-727.676) -- 0:01:13
88000 -- [-726.845] (-727.579) (-726.789) (-727.882) * (-726.235) (-728.442) [-726.107] (-728.569) -- 0:01:12
88500 -- (-726.518) [-728.140] (-726.205) (-728.604) * (-730.815) (-727.842) [-727.177] (-729.331) -- 0:01:12
89000 -- [-726.166] (-732.155) (-728.434) (-727.724) * (-728.130) [-726.700] (-728.542) (-727.702) -- 0:01:11
89500 -- (-727.168) (-729.163) [-727.760] (-726.973) * (-735.074) (-725.505) (-726.753) [-727.666] -- 0:01:11
90000 -- (-729.150) (-725.176) (-729.323) [-727.330] * [-728.530] (-728.655) (-725.875) (-728.643) -- 0:01:20
Average standard deviation of split frequencies: 0.023137
90500 -- (-733.714) (-727.739) (-727.521) [-729.126] * (-728.470) (-725.207) (-728.289) [-726.874] -- 0:01:20
91000 -- (-731.634) (-727.814) (-727.181) [-726.267] * (-726.061) (-730.548) [-728.563] (-728.756) -- 0:01:19
91500 -- (-731.790) (-726.943) [-726.866] (-726.766) * (-728.833) (-734.097) [-726.170] (-727.713) -- 0:01:19
92000 -- [-727.529] (-726.998) (-726.324) (-727.082) * (-727.929) (-725.372) (-729.142) [-727.465] -- 0:01:18
92500 -- (-735.624) (-727.665) [-726.060] (-727.436) * (-729.330) (-726.709) [-725.510] (-726.392) -- 0:01:18
93000 -- [-728.214] (-727.088) (-726.619) (-726.924) * (-731.346) (-725.320) [-726.490] (-727.927) -- 0:01:18
93500 -- (-726.358) (-727.419) (-726.149) [-727.236] * [-726.366] (-725.413) (-726.519) (-726.151) -- 0:01:17
94000 -- (-728.497) (-727.494) (-729.650) [-727.436] * [-726.874] (-728.521) (-728.504) (-731.107) -- 0:01:17
94500 -- (-726.525) (-725.802) (-730.147) [-727.784] * (-732.369) (-729.789) (-728.664) [-725.209] -- 0:01:16
95000 -- (-726.061) (-725.747) (-730.655) [-728.506] * (-727.075) (-727.564) (-728.776) [-725.757] -- 0:01:16
Average standard deviation of split frequencies: 0.022242
95500 -- (-727.338) [-725.907] (-731.828) (-726.296) * [-726.395] (-729.318) (-727.754) (-725.355) -- 0:01:15
96000 -- (-728.318) (-726.472) (-730.804) [-726.641] * (-726.342) (-726.995) (-727.094) [-728.416] -- 0:01:15
96500 -- (-733.099) (-727.198) [-734.202] (-726.868) * [-727.616] (-726.224) (-725.876) (-729.256) -- 0:01:14
97000 -- [-727.018] (-727.376) (-728.976) (-725.815) * (-725.604) (-727.308) (-725.922) [-727.420] -- 0:01:14
97500 -- (-726.339) (-728.320) (-731.548) [-727.818] * (-726.081) [-726.972] (-727.534) (-728.294) -- 0:01:14
98000 -- (-726.494) (-731.024) (-729.124) [-726.439] * (-727.988) [-726.620] (-727.309) (-727.375) -- 0:01:13
98500 -- [-728.189] (-729.575) (-726.140) (-726.399) * (-729.598) (-728.434) (-727.499) [-726.158] -- 0:01:13
99000 -- (-726.741) [-728.500] (-726.050) (-726.644) * [-726.153] (-726.046) (-729.135) (-731.614) -- 0:01:12
99500 -- (-728.552) (-728.081) [-726.443] (-728.617) * [-726.035] (-729.189) (-730.029) (-727.673) -- 0:01:12
100000 -- (-728.442) (-734.054) (-726.313) [-726.295] * (-726.523) (-731.225) [-726.641] (-726.732) -- 0:01:12
Average standard deviation of split frequencies: 0.021442
100500 -- (-730.568) (-727.258) (-728.830) [-727.737] * (-726.396) (-726.731) [-727.381] (-728.500) -- 0:01:11
101000 -- (-731.454) (-727.867) [-728.112] (-730.465) * (-726.480) [-725.404] (-726.417) (-726.683) -- 0:01:11
101500 -- (-728.051) (-727.982) (-726.867) [-727.140] * (-727.479) [-729.244] (-726.391) (-727.198) -- 0:01:10
102000 -- [-726.894] (-728.985) (-729.332) (-728.854) * [-727.417] (-725.497) (-729.138) (-726.644) -- 0:01:10
102500 -- (-726.301) (-731.678) (-726.364) [-726.795] * (-728.799) (-725.441) (-731.116) [-726.635] -- 0:01:10
103000 -- [-728.471] (-730.210) (-727.445) (-726.887) * (-729.708) (-725.958) [-726.236] (-726.228) -- 0:01:09
103500 -- (-729.312) (-726.578) (-729.799) [-728.851] * (-727.673) (-725.375) (-728.211) [-726.417] -- 0:01:09
104000 -- [-726.471] (-727.286) (-727.675) (-728.173) * [-726.016] (-727.475) (-728.372) (-726.670) -- 0:01:08
104500 -- (-727.419) (-727.369) [-726.594] (-727.129) * (-727.994) (-725.866) [-728.530] (-727.658) -- 0:01:08
105000 -- [-726.433] (-726.645) (-725.868) (-731.483) * [-725.524] (-725.814) (-727.007) (-726.365) -- 0:01:16
Average standard deviation of split frequencies: 0.020754
105500 -- (-726.773) (-737.698) [-728.087] (-725.784) * (-727.832) [-725.209] (-727.247) (-726.374) -- 0:01:16
106000 -- (-727.938) (-738.388) (-730.337) [-726.223] * (-728.370) (-725.578) [-728.160] (-727.034) -- 0:01:15
106500 -- (-728.097) (-728.676) [-730.221] (-725.565) * (-729.919) [-726.230] (-726.646) (-726.288) -- 0:01:15
107000 -- (-726.673) [-729.597] (-727.181) (-727.186) * (-725.895) [-725.952] (-728.513) (-726.324) -- 0:01:15
107500 -- (-725.611) (-730.263) [-725.624] (-726.540) * (-726.597) (-729.266) (-728.918) [-725.798] -- 0:01:14
108000 -- (-729.863) (-729.141) (-725.933) [-727.733] * (-729.881) (-726.782) (-727.012) [-727.464] -- 0:01:14
108500 -- (-730.433) (-729.050) (-725.379) [-726.681] * (-727.685) [-729.007] (-726.760) (-728.014) -- 0:01:13
109000 -- (-725.963) (-731.940) (-726.322) [-725.774] * [-727.418] (-730.156) (-727.131) (-728.486) -- 0:01:13
109500 -- (-726.591) [-727.892] (-727.249) (-726.538) * (-729.289) (-730.744) [-728.071] (-727.356) -- 0:01:13
110000 -- [-728.967] (-726.558) (-727.664) (-727.323) * (-729.429) (-730.260) (-726.959) [-726.924] -- 0:01:12
Average standard deviation of split frequencies: 0.019169
110500 -- (-728.389) [-727.771] (-726.604) (-731.658) * (-728.063) [-726.445] (-726.948) (-728.593) -- 0:01:12
111000 -- [-727.033] (-726.328) (-727.059) (-727.661) * (-728.057) [-725.400] (-728.240) (-727.343) -- 0:01:12
111500 -- (-727.011) (-726.048) (-726.773) [-725.624] * [-725.360] (-728.131) (-727.322) (-726.981) -- 0:01:11
112000 -- [-727.801] (-729.471) (-729.466) (-730.311) * (-726.699) (-726.566) (-728.676) [-731.222] -- 0:01:11
112500 -- [-726.783] (-727.010) (-725.953) (-727.169) * (-727.914) (-727.122) (-727.218) [-725.807] -- 0:01:11
113000 -- (-725.502) [-728.329] (-727.481) (-729.209) * (-726.703) [-727.322] (-729.024) (-728.777) -- 0:01:10
113500 -- (-728.228) (-727.553) (-727.515) [-725.813] * (-727.943) (-728.051) [-729.007] (-728.356) -- 0:01:10
114000 -- (-725.547) (-729.639) (-729.692) [-725.748] * (-728.730) [-727.858] (-726.046) (-730.521) -- 0:01:09
114500 -- [-727.620] (-733.545) (-729.090) (-725.801) * (-727.182) (-725.624) (-729.338) [-726.257] -- 0:01:09
115000 -- (-726.519) (-727.533) (-728.097) [-726.148] * (-726.758) (-728.294) (-727.900) [-731.043] -- 0:01:09
Average standard deviation of split frequencies: 0.018384
115500 -- [-729.162] (-730.186) (-731.779) (-729.028) * [-726.046] (-730.323) (-725.761) (-726.822) -- 0:01:08
116000 -- (-726.661) [-727.603] (-729.783) (-726.328) * (-733.470) (-728.371) (-725.675) [-727.756] -- 0:01:08
116500 -- (-726.464) (-727.914) [-729.513] (-731.226) * (-729.572) (-732.611) [-728.612] (-727.372) -- 0:01:08
117000 -- (-725.600) [-728.295] (-725.836) (-726.372) * (-729.851) [-729.767] (-726.762) (-728.235) -- 0:01:07
117500 -- (-725.953) (-726.621) [-725.365] (-727.806) * (-731.144) (-727.194) [-725.979] (-725.897) -- 0:01:07
118000 -- (-725.953) (-727.668) (-727.270) [-728.398] * (-730.445) (-728.395) (-725.715) [-727.121] -- 0:01:07
118500 -- (-729.259) (-729.534) (-726.633) [-730.571] * [-726.487] (-727.112) (-726.949) (-726.698) -- 0:01:06
119000 -- (-728.889) (-727.058) [-725.771] (-727.383) * [-726.114] (-725.737) (-726.092) (-727.176) -- 0:01:06
119500 -- (-727.366) (-730.642) [-725.701] (-727.680) * (-725.227) (-725.752) [-728.243] (-725.504) -- 0:01:06
120000 -- (-727.055) (-730.206) (-725.993) [-728.854] * (-726.223) (-727.551) (-727.711) [-728.438] -- 0:01:06
Average standard deviation of split frequencies: 0.015871
120500 -- (-726.964) [-728.523] (-726.254) (-728.026) * (-725.180) (-727.513) (-729.908) [-733.856] -- 0:01:12
121000 -- (-725.354) (-727.771) (-725.873) [-728.860] * [-726.232] (-734.499) (-726.773) (-733.176) -- 0:01:12
121500 -- (-726.127) [-726.964] (-726.964) (-727.021) * (-728.129) (-731.381) [-726.711] (-729.883) -- 0:01:12
122000 -- (-726.528) [-728.076] (-726.243) (-727.637) * (-727.984) (-730.511) [-728.085] (-731.781) -- 0:01:11
122500 -- (-726.187) [-727.590] (-726.378) (-733.951) * (-727.984) (-728.349) [-727.165] (-727.929) -- 0:01:11
123000 -- [-726.113] (-729.113) (-727.738) (-727.611) * (-727.710) [-728.589] (-726.201) (-727.573) -- 0:01:11
123500 -- [-727.303] (-726.114) (-727.530) (-725.995) * [-726.021] (-726.332) (-726.621) (-727.743) -- 0:01:10
124000 -- (-729.605) (-732.207) [-727.708] (-725.802) * (-729.366) [-726.397] (-725.668) (-732.622) -- 0:01:10
124500 -- (-729.072) (-730.703) (-728.836) [-725.641] * (-728.050) [-728.349] (-726.968) (-730.359) -- 0:01:10
125000 -- [-727.101] (-728.939) (-731.225) (-727.216) * (-727.756) [-727.130] (-725.661) (-726.505) -- 0:01:10
Average standard deviation of split frequencies: 0.014374
125500 -- (-726.623) (-726.303) [-732.622] (-727.746) * (-730.923) (-727.296) [-725.775] (-729.701) -- 0:01:09
126000 -- (-728.169) (-727.637) [-725.273] (-728.237) * (-730.864) [-725.647] (-725.698) (-732.304) -- 0:01:09
126500 -- (-728.845) [-726.446] (-725.619) (-728.567) * (-725.736) [-725.331] (-725.450) (-728.485) -- 0:01:09
127000 -- (-728.622) (-726.322) [-728.785] (-729.363) * (-726.123) (-731.614) (-726.307) [-729.001] -- 0:01:08
127500 -- (-726.990) [-727.367] (-725.723) (-729.462) * (-725.894) (-728.285) [-728.079] (-725.872) -- 0:01:08
128000 -- [-727.507] (-726.360) (-727.565) (-728.752) * (-725.777) [-725.971] (-726.395) (-726.755) -- 0:01:08
128500 -- (-729.273) (-725.422) (-733.143) [-729.667] * (-725.689) [-727.253] (-728.895) (-726.321) -- 0:01:07
129000 -- (-727.387) (-729.338) (-728.669) [-727.961] * (-727.611) (-727.390) [-726.917] (-728.697) -- 0:01:07
129500 -- (-729.732) (-729.468) [-730.624] (-727.305) * (-728.212) (-729.920) [-726.679] (-726.080) -- 0:01:07
130000 -- [-728.886] (-729.201) (-727.070) (-728.694) * (-728.338) (-726.581) [-726.082] (-728.416) -- 0:01:06
Average standard deviation of split frequencies: 0.015190
130500 -- (-727.511) [-728.603] (-726.716) (-726.385) * (-729.740) (-734.723) [-726.355] (-731.378) -- 0:01:06
131000 -- [-727.713] (-730.570) (-726.526) (-725.888) * (-727.399) [-729.584] (-727.180) (-726.935) -- 0:01:06
131500 -- (-729.443) (-730.270) (-729.512) [-726.968] * (-726.327) (-730.272) [-728.364] (-726.917) -- 0:01:06
132000 -- (-729.077) (-726.416) [-726.615] (-729.681) * (-727.879) [-728.788] (-728.364) (-728.622) -- 0:01:05
132500 -- (-727.503) (-730.560) [-727.417] (-727.360) * (-727.504) (-726.631) (-726.663) [-728.203] -- 0:01:05
133000 -- (-729.579) (-727.255) [-727.401] (-725.318) * [-725.598] (-726.455) (-726.645) (-725.294) -- 0:01:05
133500 -- (-729.142) (-726.808) [-727.401] (-732.577) * (-726.107) [-727.749] (-726.320) (-726.750) -- 0:01:04
134000 -- (-726.768) (-733.682) (-729.392) [-725.792] * [-725.981] (-726.528) (-725.853) (-726.865) -- 0:01:04
134500 -- (-730.004) (-734.315) (-726.957) [-725.761] * [-726.343] (-726.906) (-730.330) (-727.273) -- 0:01:04
135000 -- (-727.845) (-727.329) (-729.234) [-728.226] * (-726.294) [-729.925] (-729.544) (-729.534) -- 0:01:04
Average standard deviation of split frequencies: 0.013049
135500 -- (-726.649) [-728.175] (-730.456) (-729.828) * [-726.198] (-727.676) (-728.371) (-725.929) -- 0:01:03
136000 -- (-725.388) [-728.340] (-727.769) (-730.329) * (-727.972) (-728.398) (-725.322) [-728.037] -- 0:01:09
136500 -- [-728.849] (-725.596) (-727.789) (-726.157) * [-727.760] (-727.387) (-726.044) (-726.411) -- 0:01:09
137000 -- (-728.723) (-728.106) (-727.762) [-729.371] * (-728.895) (-729.296) (-728.373) [-727.060] -- 0:01:09
137500 -- (-728.601) (-729.184) [-727.731] (-725.734) * (-729.075) [-727.296] (-726.679) (-725.795) -- 0:01:09
138000 -- (-728.888) [-733.249] (-728.893) (-726.254) * (-726.323) (-728.123) [-727.053] (-726.576) -- 0:01:08
138500 -- (-728.730) (-729.479) (-727.038) [-725.083] * (-727.901) [-730.609] (-727.497) (-725.542) -- 0:01:08
139000 -- (-726.715) (-731.424) [-727.720] (-726.484) * (-728.878) [-728.308] (-725.851) (-726.242) -- 0:01:08
139500 -- (-725.333) [-728.971] (-727.194) (-726.566) * [-733.450] (-729.580) (-728.557) (-727.618) -- 0:01:07
140000 -- (-725.654) (-727.635) [-726.864] (-728.688) * (-727.825) (-727.726) [-727.824] (-728.855) -- 0:01:07
Average standard deviation of split frequencies: 0.012222
140500 -- (-726.253) (-729.675) [-728.728] (-730.267) * (-728.713) (-728.095) [-726.464] (-726.664) -- 0:01:07
141000 -- (-727.005) (-726.521) (-729.209) [-727.727] * (-728.491) (-727.457) [-725.712] (-727.361) -- 0:01:07
141500 -- (-726.059) (-726.046) (-728.898) [-726.186] * (-731.137) (-727.926) (-727.028) [-727.498] -- 0:01:06
142000 -- (-734.491) [-727.205] (-728.599) (-726.945) * (-728.759) [-727.056] (-728.057) (-729.064) -- 0:01:06
142500 -- (-732.279) (-729.747) (-727.250) [-726.781] * (-730.091) (-729.976) (-727.853) [-727.645] -- 0:01:06
143000 -- [-730.379] (-727.348) (-727.989) (-725.611) * (-729.939) (-727.985) (-728.007) [-727.592] -- 0:01:05
143500 -- (-727.407) (-727.465) (-727.385) [-727.036] * (-730.797) [-725.720] (-725.757) (-732.235) -- 0:01:05
144000 -- [-728.109] (-729.215) (-727.686) (-731.782) * (-727.786) (-726.357) (-725.772) [-729.082] -- 0:01:05
144500 -- (-728.313) [-729.335] (-730.467) (-727.359) * (-727.624) [-728.105] (-725.582) (-727.707) -- 0:01:05
145000 -- (-728.306) (-725.936) [-727.950] (-726.946) * (-728.515) (-727.532) (-726.102) [-731.379] -- 0:01:04
Average standard deviation of split frequencies: 0.011386
145500 -- [-727.671] (-726.268) (-726.978) (-727.802) * (-731.099) (-727.273) (-725.706) [-726.349] -- 0:01:04
146000 -- (-726.004) [-728.335] (-725.367) (-726.512) * (-727.563) [-727.091] (-726.877) (-726.595) -- 0:01:04
146500 -- [-725.933] (-729.029) (-725.568) (-729.034) * (-728.066) (-729.889) (-727.258) [-727.623] -- 0:01:04
147000 -- (-727.313) (-725.877) [-726.219] (-732.434) * [-733.024] (-733.840) (-727.246) (-727.878) -- 0:01:03
147500 -- (-730.062) (-727.378) [-726.569] (-728.265) * [-726.695] (-730.802) (-730.214) (-727.149) -- 0:01:03
148000 -- (-731.052) (-727.978) (-727.844) [-727.738] * (-727.860) [-727.011] (-731.683) (-726.718) -- 0:01:03
148500 -- (-725.909) [-728.247] (-726.591) (-728.614) * (-729.566) (-726.261) (-729.822) [-727.040] -- 0:01:03
149000 -- [-726.036] (-733.906) (-725.593) (-729.776) * (-730.662) (-730.851) [-727.461] (-727.659) -- 0:01:02
149500 -- [-726.651] (-729.478) (-731.657) (-730.587) * (-728.662) [-725.681] (-727.289) (-725.465) -- 0:01:02
150000 -- (-726.508) (-728.276) [-727.460] (-726.411) * [-728.027] (-725.608) (-732.192) (-726.426) -- 0:01:02
Average standard deviation of split frequencies: 0.010777
150500 -- (-726.959) (-730.967) [-725.781] (-727.292) * (-729.056) [-725.578] (-730.620) (-728.362) -- 0:01:02
151000 -- (-727.383) [-725.491] (-725.253) (-726.429) * (-728.874) [-726.405] (-728.939) (-725.828) -- 0:01:01
151500 -- (-726.385) (-729.099) [-726.474] (-729.799) * [-727.140] (-727.639) (-728.487) (-727.676) -- 0:01:01
152000 -- (-729.806) (-729.171) (-728.500) [-729.822] * (-727.081) (-727.262) [-732.740] (-727.276) -- 0:01:01
152500 -- [-728.323] (-726.638) (-727.662) (-730.946) * (-727.193) (-726.959) (-730.055) [-729.312] -- 0:01:06
153000 -- (-726.503) [-725.460] (-726.650) (-729.364) * (-730.842) [-728.299] (-729.817) (-727.168) -- 0:01:06
153500 -- (-727.402) (-727.053) (-727.935) [-726.716] * [-727.564] (-732.190) (-727.154) (-725.633) -- 0:01:06
154000 -- (-727.534) [-725.365] (-726.499) (-729.922) * (-727.302) [-727.137] (-726.919) (-726.568) -- 0:01:05
154500 -- (-726.959) [-727.623] (-726.642) (-731.188) * (-727.265) [-726.443] (-726.120) (-726.245) -- 0:01:05
155000 -- [-726.271] (-725.817) (-728.010) (-728.855) * (-729.219) (-729.134) (-730.192) [-726.144] -- 0:01:05
Average standard deviation of split frequencies: 0.011584
155500 -- [-725.885] (-727.588) (-726.874) (-728.080) * (-726.790) (-728.358) [-727.366] (-726.561) -- 0:01:05
156000 -- (-728.296) (-725.940) [-725.562] (-727.149) * (-730.785) (-727.492) (-730.315) [-728.718] -- 0:01:04
156500 -- [-728.931] (-728.852) (-725.390) (-727.895) * (-728.154) (-728.638) (-730.529) [-726.859] -- 0:01:04
157000 -- [-731.152] (-729.048) (-728.112) (-731.625) * [-729.951] (-730.198) (-730.981) (-728.669) -- 0:01:04
157500 -- [-729.496] (-728.200) (-728.101) (-726.655) * (-727.789) (-729.762) (-728.388) [-726.625] -- 0:01:04
158000 -- [-725.815] (-725.531) (-728.374) (-728.076) * (-726.554) (-725.713) [-730.478] (-725.770) -- 0:01:03
158500 -- (-731.755) (-729.232) [-725.999] (-726.495) * (-730.548) (-730.733) (-725.913) [-728.463] -- 0:01:03
159000 -- [-728.225] (-726.124) (-725.999) (-730.579) * [-725.559] (-727.152) (-731.012) (-730.602) -- 0:01:03
159500 -- [-727.816] (-726.389) (-726.965) (-726.570) * (-729.860) [-727.623] (-729.341) (-728.977) -- 0:01:03
160000 -- (-730.565) (-728.192) (-727.286) [-726.064] * (-732.498) [-727.930] (-730.665) (-728.167) -- 0:01:02
Average standard deviation of split frequencies: 0.014152
160500 -- (-730.269) [-726.357] (-729.535) (-725.841) * (-732.296) (-728.465) [-727.423] (-727.348) -- 0:01:02
161000 -- (-729.288) [-725.384] (-726.829) (-727.706) * [-731.793] (-729.483) (-727.402) (-726.153) -- 0:01:02
161500 -- (-731.338) [-728.317] (-728.441) (-726.561) * [-726.843] (-727.650) (-725.921) (-728.438) -- 0:01:02
162000 -- (-726.332) (-730.420) (-729.067) [-726.183] * [-726.115] (-728.939) (-725.960) (-726.772) -- 0:01:02
162500 -- [-725.254] (-726.322) (-729.443) (-726.128) * (-726.039) (-727.046) (-725.610) [-726.586] -- 0:01:01
163000 -- (-726.443) [-727.699] (-728.750) (-726.911) * (-727.133) (-726.269) [-725.585] (-729.795) -- 0:01:01
163500 -- (-727.205) (-727.120) [-727.681] (-726.276) * (-729.476) (-727.944) [-727.473] (-730.778) -- 0:01:01
164000 -- (-726.755) [-725.895] (-728.943) (-726.670) * (-728.910) [-725.150] (-726.334) (-729.579) -- 0:01:01
164500 -- [-728.946] (-726.008) (-727.987) (-727.106) * [-726.382] (-727.680) (-726.850) (-727.736) -- 0:01:00
165000 -- [-728.260] (-726.716) (-728.123) (-726.627) * (-726.409) [-725.935] (-726.634) (-727.919) -- 0:01:00
Average standard deviation of split frequencies: 0.014357
165500 -- (-726.790) (-728.836) (-727.119) [-727.089] * (-726.475) [-726.845] (-725.502) (-729.356) -- 0:01:00
166000 -- [-727.809] (-726.634) (-727.272) (-727.750) * [-727.754] (-728.923) (-725.685) (-730.627) -- 0:01:00
166500 -- [-730.735] (-725.747) (-726.943) (-732.063) * (-727.938) (-729.699) (-725.826) [-726.371] -- 0:01:00
167000 -- (-726.157) [-728.935] (-728.365) (-728.210) * (-728.967) (-729.521) [-728.020] (-727.037) -- 0:00:59
167500 -- [-726.771] (-725.502) (-728.049) (-732.321) * (-726.025) [-725.701] (-726.336) (-725.870) -- 0:00:59
168000 -- (-726.019) (-727.039) [-726.639] (-729.217) * (-726.507) (-730.495) (-726.065) [-727.795] -- 0:00:59
168500 -- [-726.394] (-726.892) (-726.398) (-726.313) * (-728.279) (-728.637) (-726.306) [-727.567] -- 0:00:59
169000 -- (-726.813) [-727.003] (-729.366) (-728.326) * (-730.199) (-727.887) [-727.366] (-727.310) -- 0:00:59
169500 -- (-729.591) [-726.403] (-728.079) (-726.631) * (-726.401) (-727.366) [-725.408] (-727.888) -- 0:01:03
170000 -- (-727.866) [-726.118] (-728.209) (-725.439) * (-730.033) (-730.008) (-729.007) [-728.030] -- 0:01:03
Average standard deviation of split frequencies: 0.013657
170500 -- (-726.771) [-727.063] (-727.406) (-726.163) * [-726.898] (-726.926) (-731.216) (-725.350) -- 0:01:03
171000 -- (-728.068) [-729.454] (-728.732) (-726.133) * (-727.102) (-725.593) [-730.562] (-726.073) -- 0:01:03
171500 -- [-727.332] (-726.138) (-726.954) (-727.704) * [-728.778] (-727.509) (-726.981) (-726.523) -- 0:01:02
172000 -- (-732.487) (-728.249) [-727.857] (-732.286) * (-732.018) [-726.035] (-730.559) (-730.770) -- 0:01:02
172500 -- (-728.580) (-727.988) (-729.464) [-728.768] * (-725.866) (-726.485) [-728.505] (-726.001) -- 0:01:02
173000 -- (-733.362) (-727.272) [-732.070] (-730.129) * (-727.108) (-726.285) [-725.588] (-725.982) -- 0:01:02
173500 -- (-727.268) (-727.417) [-726.818] (-728.562) * (-727.251) (-725.675) (-729.854) [-727.432] -- 0:01:01
174000 -- (-728.581) [-726.270] (-727.328) (-735.117) * (-726.748) [-727.291] (-726.469) (-727.036) -- 0:01:01
174500 -- (-728.177) (-727.129) (-725.571) [-727.394] * [-731.318] (-730.578) (-732.196) (-727.598) -- 0:01:01
175000 -- [-725.557] (-725.683) (-726.863) (-726.199) * [-731.514] (-727.020) (-729.162) (-729.221) -- 0:01:01
Average standard deviation of split frequencies: 0.014285
175500 -- (-726.320) (-726.327) [-727.690] (-726.949) * [-732.913] (-728.056) (-726.395) (-727.929) -- 0:01:01
176000 -- [-726.229] (-727.658) (-730.782) (-726.651) * (-731.162) (-727.019) (-727.594) [-729.331] -- 0:01:00
176500 -- (-727.568) (-728.459) (-728.760) [-726.437] * (-727.640) (-728.666) (-730.813) [-732.081] -- 0:01:00
177000 -- (-728.785) (-727.664) [-727.285] (-727.932) * (-729.899) [-731.463] (-727.230) (-732.735) -- 0:01:00
177500 -- (-727.646) (-729.797) [-726.473] (-728.016) * [-726.954] (-729.728) (-726.346) (-727.715) -- 0:01:00
178000 -- (-728.461) (-728.418) [-727.851] (-731.236) * [-729.067] (-726.669) (-727.770) (-727.417) -- 0:01:00
178500 -- (-729.144) (-726.458) (-727.887) [-725.759] * (-725.900) [-726.759] (-729.602) (-726.232) -- 0:00:59
179000 -- (-726.436) [-730.341] (-726.023) (-726.348) * (-725.487) [-726.674] (-728.622) (-725.736) -- 0:00:59
179500 -- [-727.069] (-729.368) (-727.611) (-725.689) * (-726.729) [-728.228] (-725.946) (-728.383) -- 0:00:59
180000 -- (-735.230) (-728.648) (-730.285) [-726.438] * (-728.883) (-725.417) (-725.992) [-730.028] -- 0:00:59
Average standard deviation of split frequencies: 0.016380
180500 -- (-727.848) (-732.274) (-728.411) [-726.601] * (-727.581) (-726.201) [-725.668] (-729.630) -- 0:00:59
181000 -- (-725.862) (-727.308) [-728.253] (-730.436) * (-729.417) [-726.498] (-727.905) (-728.031) -- 0:00:58
181500 -- (-728.219) (-727.584) (-727.508) [-727.008] * (-727.209) (-731.319) [-728.226] (-727.718) -- 0:00:58
182000 -- (-729.461) [-726.009] (-729.727) (-736.925) * (-727.642) (-726.444) [-726.049] (-727.889) -- 0:00:58
182500 -- [-726.790] (-726.915) (-726.674) (-729.909) * (-730.547) (-729.757) [-726.454] (-727.648) -- 0:00:58
183000 -- (-731.407) (-727.743) (-732.709) [-725.897] * (-726.216) (-728.608) (-726.375) [-728.927] -- 0:00:58
183500 -- [-726.085] (-728.196) (-728.440) (-728.418) * (-725.597) (-729.089) (-726.422) [-726.616] -- 0:00:57
184000 -- (-727.955) (-726.926) (-727.293) [-725.902] * [-726.193] (-725.759) (-728.399) (-725.498) -- 0:00:57
184500 -- [-728.255] (-728.201) (-725.911) (-726.224) * (-726.602) (-727.551) [-728.127] (-726.575) -- 0:00:57
185000 -- [-726.083] (-728.061) (-727.579) (-727.949) * (-726.298) [-727.555] (-729.491) (-727.260) -- 0:00:57
Average standard deviation of split frequencies: 0.017741
185500 -- [-727.334] (-731.581) (-727.772) (-726.265) * (-727.473) (-726.365) [-729.497] (-728.524) -- 0:00:57
186000 -- (-727.386) [-729.466] (-727.853) (-725.791) * [-725.990] (-726.825) (-728.029) (-731.013) -- 0:01:01
186500 -- [-729.547] (-727.621) (-726.218) (-726.225) * (-727.815) (-727.646) (-730.321) [-726.368] -- 0:01:01
187000 -- (-727.931) (-727.234) (-726.016) [-725.502] * (-727.552) (-727.388) [-725.751] (-727.363) -- 0:01:00
187500 -- (-728.420) (-726.724) [-728.132] (-728.150) * [-727.777] (-727.371) (-727.794) (-727.594) -- 0:01:00
188000 -- [-725.239] (-726.633) (-729.496) (-727.747) * (-727.036) (-731.844) (-726.982) [-727.057] -- 0:01:00
188500 -- (-725.359) (-727.480) (-729.710) [-725.836] * [-727.541] (-730.131) (-726.733) (-729.662) -- 0:01:00
189000 -- (-726.199) (-728.093) [-726.738] (-726.437) * (-727.187) (-727.666) (-728.372) [-726.699] -- 0:01:00
189500 -- (-726.686) (-727.311) [-726.320] (-726.057) * (-729.698) (-729.329) [-727.229] (-727.436) -- 0:00:59
190000 -- (-727.421) (-726.903) (-726.737) [-728.636] * (-729.866) [-729.899] (-726.285) (-728.210) -- 0:00:59
Average standard deviation of split frequencies: 0.014965
190500 -- (-730.637) (-727.350) [-727.541] (-729.407) * (-731.391) (-727.987) [-726.080] (-730.804) -- 0:00:59
191000 -- (-729.086) (-728.064) (-725.777) [-726.409] * (-725.659) (-726.969) (-726.904) [-727.532] -- 0:00:59
191500 -- (-727.563) (-728.704) [-728.320] (-730.001) * (-725.794) [-727.684] (-726.581) (-727.685) -- 0:00:59
192000 -- (-728.007) (-726.777) [-729.587] (-727.845) * (-727.970) (-727.237) (-725.959) [-727.617] -- 0:00:58
192500 -- [-729.015] (-726.492) (-727.826) (-729.558) * (-726.685) [-727.454] (-728.598) (-725.084) -- 0:00:58
193000 -- (-728.031) [-726.639] (-728.671) (-726.531) * (-727.415) (-726.407) [-726.766] (-732.546) -- 0:00:58
193500 -- (-727.214) (-727.910) [-727.851] (-726.764) * (-728.379) [-727.415] (-725.722) (-729.633) -- 0:00:58
194000 -- [-727.211] (-726.017) (-731.679) (-728.447) * [-729.421] (-727.249) (-728.619) (-731.065) -- 0:00:58
194500 -- [-725.580] (-726.427) (-725.864) (-725.336) * (-729.959) (-727.223) [-726.422] (-727.319) -- 0:00:57
195000 -- (-728.545) [-726.146] (-727.607) (-728.998) * (-729.895) (-726.469) (-728.793) [-726.203] -- 0:00:57
Average standard deviation of split frequencies: 0.014832
195500 -- (-726.317) (-726.307) [-727.196] (-728.113) * (-731.723) [-726.175] (-726.250) (-731.322) -- 0:00:57
196000 -- (-729.803) (-727.774) (-732.476) [-729.610] * [-729.342] (-727.778) (-727.008) (-731.374) -- 0:00:57
196500 -- [-727.394] (-730.955) (-729.868) (-728.841) * [-727.845] (-726.272) (-727.959) (-726.225) -- 0:00:57
197000 -- (-727.582) [-727.693] (-726.310) (-727.711) * (-728.402) [-725.216] (-728.157) (-725.827) -- 0:00:57
197500 -- [-725.850] (-725.159) (-726.067) (-727.698) * (-728.545) [-726.277] (-728.207) (-726.814) -- 0:00:56
198000 -- (-725.121) (-726.455) [-727.782] (-727.396) * (-726.554) (-727.102) [-728.429] (-726.994) -- 0:00:56
198500 -- (-726.812) (-726.551) [-726.837] (-726.428) * (-726.703) [-727.350] (-727.143) (-728.634) -- 0:00:56
199000 -- (-727.690) [-725.802] (-729.745) (-727.168) * [-727.054] (-731.754) (-732.578) (-731.086) -- 0:00:56
199500 -- (-726.886) (-726.717) [-728.846] (-727.345) * [-733.811] (-728.424) (-726.995) (-728.549) -- 0:00:56
200000 -- (-726.331) (-726.456) [-725.861] (-725.980) * [-729.507] (-728.307) (-725.834) (-726.874) -- 0:00:55
Average standard deviation of split frequencies: 0.014748
200500 -- (-728.614) (-728.110) (-727.618) [-727.124] * (-729.692) [-730.390] (-726.906) (-726.570) -- 0:00:55
201000 -- (-728.088) (-727.563) [-727.667] (-726.443) * (-728.259) [-729.833] (-727.640) (-727.596) -- 0:00:55
201500 -- (-727.071) [-727.604] (-730.714) (-725.454) * (-726.174) [-728.433] (-727.754) (-726.927) -- 0:00:55
202000 -- (-727.077) (-729.050) [-726.370] (-726.097) * (-732.187) (-727.228) [-726.048] (-729.397) -- 0:00:55
202500 -- (-727.301) [-728.987] (-727.169) (-734.586) * (-727.185) [-725.838] (-727.366) (-726.254) -- 0:00:55
203000 -- [-725.983] (-727.318) (-731.964) (-726.929) * (-732.403) (-729.706) (-728.203) [-726.429] -- 0:00:58
203500 -- (-731.044) (-731.202) (-730.031) [-728.201] * (-739.571) (-727.232) [-727.643] (-726.638) -- 0:00:58
204000 -- (-730.286) [-729.587] (-728.829) (-732.945) * (-731.763) (-726.749) (-727.641) [-725.830] -- 0:00:58
204500 -- (-727.113) (-726.250) (-725.406) [-726.328] * (-729.859) (-727.525) (-728.698) [-725.931] -- 0:00:58
205000 -- (-727.711) (-725.951) (-727.235) [-726.393] * [-729.901] (-727.936) (-733.015) (-730.480) -- 0:00:58
Average standard deviation of split frequencies: 0.012586
205500 -- (-726.511) (-725.172) (-729.984) [-726.522] * [-726.003] (-728.652) (-726.659) (-726.440) -- 0:00:57
206000 -- [-727.041] (-726.886) (-729.280) (-726.085) * [-727.855] (-728.506) (-729.559) (-728.240) -- 0:00:57
206500 -- [-729.181] (-727.599) (-728.010) (-727.751) * (-730.171) (-728.199) [-725.902] (-730.629) -- 0:00:57
207000 -- (-730.054) (-730.445) [-728.215] (-728.549) * (-731.826) (-727.728) (-726.530) [-725.874] -- 0:00:57
207500 -- [-726.308] (-729.897) (-726.816) (-731.415) * (-729.006) [-728.387] (-726.965) (-729.005) -- 0:00:57
208000 -- (-729.112) (-729.464) [-726.174] (-727.745) * (-725.648) [-727.193] (-725.396) (-727.096) -- 0:00:57
208500 -- (-725.775) [-728.747] (-725.766) (-726.132) * (-727.870) (-726.356) [-726.798] (-728.135) -- 0:00:56
209000 -- (-726.554) (-733.408) (-726.831) [-728.249] * (-729.042) (-727.596) (-727.575) [-725.943] -- 0:00:56
209500 -- (-728.122) (-727.962) [-728.784] (-728.081) * (-728.382) (-727.309) [-727.498] (-727.310) -- 0:00:56
210000 -- (-727.675) (-727.365) [-727.421] (-726.926) * (-733.133) (-727.060) (-725.831) [-727.754] -- 0:00:56
Average standard deviation of split frequencies: 0.013053
210500 -- (-726.679) (-731.343) (-729.069) [-725.097] * [-729.004] (-726.247) (-727.866) (-728.587) -- 0:00:56
211000 -- (-728.225) (-731.659) (-727.292) [-725.595] * (-728.983) [-727.203] (-726.237) (-728.650) -- 0:00:56
211500 -- (-727.465) (-729.495) (-729.460) [-734.453] * (-729.377) [-727.542] (-727.199) (-728.793) -- 0:00:55
212000 -- (-727.174) (-726.597) [-726.583] (-725.177) * (-728.689) (-727.510) (-731.502) [-731.687] -- 0:00:55
212500 -- (-728.228) (-726.879) [-726.853] (-725.398) * (-730.771) [-725.988] (-728.916) (-732.454) -- 0:00:55
213000 -- (-728.008) (-729.109) (-728.082) [-727.404] * (-727.490) [-725.810] (-726.945) (-726.749) -- 0:00:55
213500 -- (-728.044) (-726.468) [-725.865] (-727.231) * (-725.742) [-728.161] (-732.073) (-726.241) -- 0:00:55
214000 -- (-726.380) [-726.750] (-725.750) (-725.783) * [-727.644] (-726.435) (-727.132) (-728.662) -- 0:00:55
214500 -- (-725.521) (-732.757) (-728.823) [-728.272] * (-729.637) (-731.688) [-729.395] (-726.205) -- 0:00:54
215000 -- (-725.487) (-732.710) [-727.769] (-727.928) * (-726.915) [-727.087] (-728.246) (-727.993) -- 0:00:54
Average standard deviation of split frequencies: 0.015883
215500 -- [-726.685] (-729.927) (-728.212) (-732.976) * (-726.666) [-727.586] (-727.533) (-730.838) -- 0:00:54
216000 -- [-731.138] (-726.954) (-727.634) (-726.596) * (-725.390) [-725.622] (-727.553) (-730.302) -- 0:00:54
216500 -- [-726.219] (-731.195) (-730.208) (-726.168) * (-725.062) [-725.365] (-729.020) (-729.014) -- 0:00:54
217000 -- (-728.588) (-726.429) [-728.422] (-726.851) * (-725.911) (-726.177) [-731.289] (-727.506) -- 0:00:54
217500 -- [-725.668] (-727.853) (-726.774) (-726.715) * (-726.521) (-727.075) [-728.526] (-730.215) -- 0:00:53
218000 -- (-726.135) [-728.835] (-726.885) (-725.953) * (-725.161) (-726.136) [-730.382] (-733.643) -- 0:00:53
218500 -- (-725.637) (-727.338) (-727.238) [-726.698] * (-725.813) (-730.247) (-727.192) [-726.940] -- 0:00:53
219000 -- (-725.579) [-727.473] (-728.061) (-729.118) * (-726.426) (-727.896) [-727.808] (-734.115) -- 0:00:53
219500 -- (-727.234) (-727.503) [-726.057] (-727.466) * (-727.495) (-731.580) [-727.014] (-727.755) -- 0:00:53
220000 -- (-726.638) (-726.753) [-726.112] (-729.758) * [-725.433] (-725.628) (-727.178) (-727.265) -- 0:00:56
Average standard deviation of split frequencies: 0.016141
220500 -- (-726.600) [-725.777] (-727.408) (-727.550) * (-726.346) [-726.114] (-726.829) (-728.335) -- 0:00:56
221000 -- (-725.576) (-728.433) [-726.848] (-726.000) * [-727.985] (-730.824) (-725.910) (-730.566) -- 0:00:56
221500 -- (-735.226) (-727.974) (-727.761) [-727.446] * (-726.712) (-727.932) (-727.135) [-726.770] -- 0:00:56
222000 -- (-729.133) (-727.961) [-727.212] (-730.521) * (-726.055) (-727.385) (-726.246) [-730.098] -- 0:00:56
222500 -- (-732.416) (-728.358) (-727.046) [-727.124] * (-733.987) (-729.472) [-727.745] (-730.801) -- 0:00:55
223000 -- (-733.548) (-726.494) (-728.378) [-727.296] * (-731.523) (-727.883) (-725.313) [-728.211] -- 0:00:55
223500 -- [-726.390] (-727.535) (-728.676) (-727.988) * (-726.652) (-728.338) [-726.493] (-730.231) -- 0:00:55
224000 -- (-726.481) (-727.057) [-726.002] (-728.147) * (-728.659) (-728.224) [-725.453] (-732.360) -- 0:00:55
224500 -- (-726.481) [-729.242] (-726.020) (-728.011) * (-726.682) [-728.387] (-727.916) (-726.595) -- 0:00:55
225000 -- (-726.820) [-729.208] (-726.989) (-729.952) * [-727.280] (-728.530) (-726.138) (-725.856) -- 0:00:55
Average standard deviation of split frequencies: 0.016248
225500 -- (-727.136) (-727.008) (-728.442) [-729.888] * (-731.364) [-732.211] (-732.319) (-729.068) -- 0:00:54
226000 -- (-726.353) (-727.474) (-727.934) [-726.548] * [-727.789] (-730.087) (-728.581) (-726.086) -- 0:00:54
226500 -- (-726.479) (-726.732) [-727.100] (-726.456) * (-726.155) [-731.297] (-725.796) (-726.232) -- 0:00:54
227000 -- (-727.535) (-726.753) (-730.465) [-728.761] * (-725.633) (-727.744) (-726.603) [-727.091] -- 0:00:54
227500 -- (-735.191) (-727.186) (-728.074) [-732.758] * (-729.351) (-726.016) [-726.090] (-727.709) -- 0:00:54
228000 -- (-725.145) (-728.111) [-728.268] (-730.058) * (-726.757) [-727.145] (-729.052) (-726.968) -- 0:00:54
228500 -- [-725.573] (-729.479) (-725.627) (-729.879) * (-726.467) [-727.679] (-731.871) (-727.534) -- 0:00:54
229000 -- (-726.883) (-727.138) (-730.532) [-729.395] * (-731.405) (-726.645) [-730.728] (-726.473) -- 0:00:53
229500 -- (-726.746) (-726.468) (-726.868) [-727.490] * (-728.601) [-728.991] (-734.226) (-728.525) -- 0:00:53
230000 -- (-725.888) (-726.994) [-731.831] (-731.254) * (-729.721) [-728.745] (-733.285) (-728.114) -- 0:00:53
Average standard deviation of split frequencies: 0.016803
230500 -- (-726.405) (-728.223) (-728.595) [-730.208] * [-729.239] (-728.107) (-727.955) (-729.453) -- 0:00:53
231000 -- (-727.644) (-727.607) (-726.245) [-727.169] * (-728.553) (-727.865) (-730.745) [-726.153] -- 0:00:53
231500 -- [-728.579] (-732.499) (-727.249) (-727.052) * (-727.285) (-727.224) (-729.163) [-726.891] -- 0:00:53
232000 -- [-730.570] (-727.102) (-726.566) (-725.896) * (-732.478) (-725.450) [-728.887] (-726.479) -- 0:00:52
232500 -- (-730.558) (-732.275) [-731.479] (-725.606) * (-727.588) (-728.694) [-727.002] (-730.084) -- 0:00:52
233000 -- [-729.174] (-728.289) (-733.986) (-727.195) * (-727.525) (-727.939) [-727.635] (-729.531) -- 0:00:52
233500 -- [-727.748] (-727.603) (-730.809) (-727.299) * (-726.680) (-730.726) [-732.022] (-729.837) -- 0:00:52
234000 -- (-729.649) (-731.174) (-730.210) [-727.623] * [-725.918] (-727.729) (-726.021) (-733.033) -- 0:00:52
234500 -- (-732.053) (-728.382) (-730.357) [-725.920] * (-726.574) [-726.854] (-727.408) (-727.893) -- 0:00:52
235000 -- (-727.727) (-728.663) [-729.012] (-733.195) * (-730.538) (-728.670) (-729.005) [-727.742] -- 0:00:52
Average standard deviation of split frequencies: 0.016535
235500 -- (-726.086) (-732.123) [-728.018] (-727.693) * (-726.884) [-726.257] (-730.127) (-730.759) -- 0:00:51
236000 -- [-728.290] (-729.920) (-729.430) (-727.090) * [-729.584] (-727.837) (-728.014) (-730.337) -- 0:00:51
236500 -- (-729.313) (-729.045) (-725.924) [-725.742] * (-732.941) [-727.016] (-728.724) (-730.800) -- 0:00:54
237000 -- (-733.585) (-725.952) (-729.841) [-725.771] * (-732.663) (-732.217) (-726.602) [-727.852] -- 0:00:54
237500 -- (-729.579) (-726.656) [-729.542] (-725.661) * (-729.853) [-728.822] (-725.613) (-726.279) -- 0:00:54
238000 -- [-727.313] (-727.826) (-727.828) (-725.867) * (-729.423) (-726.502) [-725.570] (-725.502) -- 0:00:54
238500 -- (-725.413) (-727.603) (-731.561) [-727.500] * (-727.947) (-727.386) (-727.422) [-727.237] -- 0:00:54
239000 -- (-725.864) (-730.729) (-730.597) [-727.793] * (-729.154) (-728.938) [-728.722] (-730.697) -- 0:00:54
239500 -- (-728.168) [-727.701] (-726.961) (-727.690) * [-728.912] (-729.597) (-733.899) (-728.934) -- 0:00:53
240000 -- (-727.706) [-725.453] (-727.509) (-728.259) * [-728.318] (-727.411) (-730.694) (-728.633) -- 0:00:53
Average standard deviation of split frequencies: 0.016707
240500 -- (-726.022) (-726.561) [-732.112] (-728.014) * (-731.921) [-728.878] (-730.886) (-728.096) -- 0:00:53
241000 -- [-726.022] (-727.388) (-727.774) (-733.878) * (-730.571) (-728.317) (-726.250) [-728.120] -- 0:00:53
241500 -- [-725.462] (-726.705) (-732.027) (-727.749) * [-726.326] (-727.578) (-727.250) (-729.664) -- 0:00:53
242000 -- (-729.169) [-728.104] (-727.528) (-727.149) * (-728.700) (-728.078) (-727.632) [-726.486] -- 0:00:53
242500 -- (-728.492) (-731.221) (-728.189) [-725.310] * (-729.766) (-726.251) [-730.044] (-728.845) -- 0:00:53
243000 -- [-730.193] (-726.179) (-729.637) (-725.408) * (-726.551) [-728.556] (-727.130) (-727.852) -- 0:00:52
243500 -- [-727.267] (-727.240) (-734.828) (-725.312) * (-725.236) (-725.685) (-727.631) [-726.680] -- 0:00:52
244000 -- (-726.019) (-729.511) (-730.608) [-726.812] * [-726.548] (-725.532) (-727.932) (-730.107) -- 0:00:52
244500 -- [-730.251] (-726.237) (-727.484) (-727.198) * (-727.476) (-725.822) [-725.766] (-729.225) -- 0:00:52
245000 -- (-731.116) [-727.727] (-727.098) (-727.834) * [-726.427] (-727.997) (-726.001) (-732.562) -- 0:00:52
Average standard deviation of split frequencies: 0.017923
245500 -- (-727.577) [-725.687] (-727.882) (-725.943) * (-729.804) (-726.872) (-725.401) [-725.991] -- 0:00:52
246000 -- (-727.764) (-727.900) (-730.967) [-726.788] * [-726.871] (-727.463) (-726.156) (-727.432) -- 0:00:52
246500 -- (-727.467) [-727.333] (-727.712) (-726.264) * (-726.245) (-729.104) [-725.787] (-727.613) -- 0:00:51
247000 -- (-735.590) (-727.383) (-729.058) [-726.293] * [-727.351] (-729.997) (-725.787) (-726.619) -- 0:00:51
247500 -- (-725.802) (-727.647) [-726.655] (-726.328) * [-729.847] (-726.493) (-728.624) (-729.965) -- 0:00:51
248000 -- [-729.288] (-731.632) (-727.224) (-725.468) * (-727.781) (-728.649) [-727.759] (-729.158) -- 0:00:51
248500 -- (-727.034) [-727.587] (-732.118) (-725.675) * (-727.280) [-727.677] (-726.482) (-726.566) -- 0:00:51
249000 -- (-726.075) (-729.723) [-730.738] (-727.327) * (-726.882) (-730.279) (-726.575) [-731.232] -- 0:00:51
249500 -- (-726.418) [-726.864] (-725.832) (-731.861) * (-729.099) [-725.992] (-726.850) (-725.718) -- 0:00:51
250000 -- [-727.510] (-726.163) (-728.435) (-732.035) * (-726.403) (-728.223) (-726.843) [-725.379] -- 0:00:51
Average standard deviation of split frequencies: 0.017810
250500 -- [-730.093] (-726.723) (-725.494) (-730.140) * (-727.914) (-725.737) [-726.789] (-728.282) -- 0:00:50
251000 -- (-727.874) (-727.025) (-725.266) [-726.971] * [-727.958] (-727.420) (-726.379) (-726.853) -- 0:00:50
251500 -- [-727.196] (-731.238) (-725.266) (-730.485) * [-725.883] (-730.627) (-725.943) (-725.769) -- 0:00:50
252000 -- (-730.835) [-730.463] (-728.928) (-726.354) * [-726.607] (-726.882) (-726.380) (-726.107) -- 0:00:50
252500 -- (-729.895) (-728.029) (-726.834) [-725.749] * [-725.531] (-727.008) (-726.023) (-726.568) -- 0:00:50
253000 -- [-727.311] (-731.152) (-727.813) (-727.389) * (-727.511) (-729.274) [-727.681] (-725.838) -- 0:00:50
253500 -- [-728.321] (-731.102) (-728.755) (-726.820) * (-726.793) (-727.044) [-727.626] (-725.573) -- 0:00:53
254000 -- [-726.055] (-725.972) (-735.820) (-725.850) * (-726.904) (-730.758) (-727.436) [-727.491] -- 0:00:52
254500 -- (-726.877) (-725.500) [-726.913] (-727.935) * (-727.502) (-725.652) [-728.571] (-725.568) -- 0:00:52
255000 -- (-725.710) [-726.387] (-726.575) (-727.557) * (-728.296) (-725.486) [-728.245] (-730.343) -- 0:00:52
Average standard deviation of split frequencies: 0.016681
255500 -- (-726.479) [-727.086] (-727.098) (-729.574) * (-726.084) (-733.874) (-727.853) [-726.708] -- 0:00:52
256000 -- [-725.870] (-725.438) (-728.217) (-731.792) * (-726.493) (-727.041) (-728.750) [-725.723] -- 0:00:52
256500 -- (-727.230) (-728.163) [-728.034] (-725.827) * (-731.256) (-726.656) [-726.283] (-727.429) -- 0:00:52
257000 -- (-727.211) (-728.835) [-726.411] (-725.726) * [-725.900] (-726.617) (-727.384) (-727.762) -- 0:00:52
257500 -- [-727.903] (-728.533) (-730.383) (-726.556) * (-725.934) (-730.066) [-726.075] (-726.341) -- 0:00:51
258000 -- [-726.732] (-726.737) (-731.457) (-726.603) * [-731.527] (-730.577) (-727.016) (-727.842) -- 0:00:51
258500 -- (-725.998) (-727.611) [-726.942] (-727.394) * (-728.686) (-732.368) [-726.522] (-728.652) -- 0:00:51
259000 -- (-728.545) (-726.448) (-725.630) [-728.266] * [-728.877] (-729.584) (-730.024) (-729.580) -- 0:00:51
259500 -- (-730.183) (-726.134) (-728.724) [-725.556] * (-728.673) (-730.103) [-726.725] (-731.714) -- 0:00:51
260000 -- [-727.387] (-729.039) (-728.783) (-727.135) * (-726.638) (-728.879) [-726.642] (-733.143) -- 0:00:51
Average standard deviation of split frequencies: 0.015851
260500 -- [-726.883] (-726.698) (-728.147) (-727.266) * (-728.666) (-727.782) [-728.539] (-739.030) -- 0:00:51
261000 -- [-727.563] (-726.108) (-726.942) (-726.003) * (-729.600) (-726.901) (-728.183) [-727.131] -- 0:00:50
261500 -- (-725.998) (-727.600) [-726.408] (-726.522) * (-726.116) (-725.511) (-727.062) [-727.013] -- 0:00:50
262000 -- (-726.210) [-728.247] (-725.243) (-726.670) * [-729.915] (-730.282) (-726.498) (-727.077) -- 0:00:50
262500 -- (-725.363) (-727.397) [-726.468] (-727.474) * (-728.358) (-726.410) (-726.738) [-725.948] -- 0:00:50
263000 -- [-725.239] (-727.643) (-730.709) (-726.360) * [-729.345] (-725.493) (-726.763) (-728.723) -- 0:00:50
263500 -- (-726.835) (-727.456) (-731.697) [-726.132] * [-727.907] (-725.218) (-730.940) (-727.659) -- 0:00:50
264000 -- [-726.422] (-726.947) (-728.455) (-728.788) * (-727.553) [-727.141] (-728.720) (-726.729) -- 0:00:50
264500 -- [-727.572] (-726.926) (-727.971) (-728.188) * [-726.746] (-726.743) (-728.426) (-727.119) -- 0:00:50
265000 -- (-734.045) [-726.274] (-729.483) (-727.432) * [-726.354] (-726.940) (-730.980) (-729.853) -- 0:00:49
Average standard deviation of split frequencies: 0.017033
265500 -- [-729.372] (-729.573) (-727.249) (-726.705) * (-727.419) [-729.096] (-730.017) (-726.613) -- 0:00:49
266000 -- (-729.043) (-729.588) (-725.720) [-727.886] * [-726.127] (-728.864) (-727.037) (-727.234) -- 0:00:49
266500 -- (-728.871) (-730.104) [-726.189] (-726.360) * (-728.351) (-726.641) [-727.787] (-727.079) -- 0:00:49
267000 -- (-728.582) (-737.860) (-725.472) [-725.523] * (-727.320) (-729.131) (-729.691) [-726.939] -- 0:00:49
267500 -- [-725.399] (-732.628) (-726.412) (-731.701) * (-729.147) (-726.407) [-726.485] (-729.207) -- 0:00:49
268000 -- (-725.434) [-730.225] (-728.891) (-730.111) * (-725.661) [-728.331] (-729.630) (-728.256) -- 0:00:49
268500 -- (-725.391) [-727.175] (-728.494) (-725.451) * (-728.589) (-735.725) (-726.025) [-725.917] -- 0:00:49
269000 -- [-726.426] (-726.499) (-728.335) (-725.853) * (-726.357) (-727.959) (-727.020) [-726.891] -- 0:00:48
269500 -- [-728.306] (-726.271) (-729.211) (-725.209) * (-727.595) (-725.411) [-731.160] (-726.351) -- 0:00:48
270000 -- [-726.656] (-727.643) (-727.005) (-726.624) * (-726.197) [-728.546] (-728.800) (-726.606) -- 0:00:48
Average standard deviation of split frequencies: 0.016836
270500 -- (-727.859) (-727.382) [-726.195] (-728.105) * [-726.208] (-727.578) (-726.249) (-733.403) -- 0:00:51
271000 -- (-726.969) (-733.382) (-726.868) [-726.716] * (-726.052) (-726.468) (-729.785) [-726.978] -- 0:00:51
271500 -- (-729.292) [-726.407] (-728.672) (-727.129) * [-727.686] (-725.481) (-726.550) (-728.134) -- 0:00:50
272000 -- (-726.599) (-725.868) (-729.244) [-728.181] * [-727.728] (-725.329) (-731.582) (-725.834) -- 0:00:50
272500 -- [-728.263] (-725.922) (-727.807) (-728.623) * [-727.791] (-725.463) (-729.511) (-727.075) -- 0:00:50
273000 -- (-727.157) (-726.089) (-726.940) [-728.397] * [-725.073] (-729.180) (-729.676) (-728.665) -- 0:00:50
273500 -- (-727.325) [-726.355] (-727.250) (-730.801) * (-726.420) [-730.800] (-737.742) (-727.594) -- 0:00:50
274000 -- (-727.199) [-726.330] (-727.172) (-734.263) * (-727.828) (-729.110) (-729.108) [-726.580] -- 0:00:50
274500 -- (-727.010) (-728.273) (-730.835) [-727.419] * (-732.244) (-728.356) (-727.040) [-726.135] -- 0:00:50
275000 -- (-726.493) [-726.714] (-726.328) (-728.030) * (-725.392) [-727.544] (-728.363) (-725.943) -- 0:00:50
Average standard deviation of split frequencies: 0.015673
275500 -- [-727.171] (-726.378) (-726.912) (-727.186) * (-727.078) (-727.599) (-730.746) [-727.350] -- 0:00:49
276000 -- [-726.054] (-728.367) (-729.462) (-726.887) * [-728.848] (-727.110) (-726.098) (-728.599) -- 0:00:49
276500 -- (-726.024) (-726.043) [-730.389] (-725.640) * (-731.487) [-727.331] (-727.786) (-730.169) -- 0:00:49
277000 -- (-727.449) (-727.106) (-726.744) [-725.757] * (-727.323) [-727.789] (-727.736) (-730.663) -- 0:00:49
277500 -- (-729.643) [-725.469] (-728.972) (-727.406) * (-726.755) (-731.167) [-726.333] (-728.462) -- 0:00:49
278000 -- [-728.256] (-727.071) (-729.435) (-726.871) * [-729.701] (-731.182) (-728.961) (-732.278) -- 0:00:49
278500 -- (-730.723) (-727.412) (-727.491) [-727.113] * (-727.853) (-729.512) [-726.233] (-727.947) -- 0:00:49
279000 -- [-730.527] (-727.301) (-729.841) (-728.328) * (-726.567) (-727.370) [-727.786] (-728.863) -- 0:00:49
279500 -- (-731.455) [-727.135] (-727.726) (-726.967) * [-726.480] (-726.832) (-727.118) (-726.339) -- 0:00:48
280000 -- (-726.928) [-727.056] (-726.599) (-725.447) * (-727.420) (-727.876) [-727.162] (-726.915) -- 0:00:48
Average standard deviation of split frequencies: 0.014721
280500 -- [-728.437] (-728.121) (-726.149) (-725.575) * (-730.627) (-728.096) (-728.057) [-727.560] -- 0:00:48
281000 -- (-726.498) (-730.953) [-726.985] (-726.032) * (-727.960) (-728.393) (-727.211) [-731.749] -- 0:00:48
281500 -- (-725.369) (-732.036) (-728.251) [-729.424] * (-729.070) [-728.248] (-729.082) (-725.563) -- 0:00:48
282000 -- (-728.009) [-732.047] (-729.177) (-726.959) * (-727.765) [-729.052] (-725.782) (-726.574) -- 0:00:48
282500 -- (-728.936) [-728.701] (-730.792) (-728.256) * (-729.839) (-729.125) (-727.198) [-726.592] -- 0:00:48
283000 -- (-727.619) (-725.614) [-728.804] (-727.551) * [-727.344] (-732.990) (-729.164) (-728.191) -- 0:00:48
283500 -- (-726.170) (-726.825) [-728.182] (-726.391) * [-725.564] (-726.370) (-727.262) (-726.778) -- 0:00:48
284000 -- [-728.381] (-727.613) (-726.258) (-726.183) * [-730.681] (-727.467) (-725.072) (-727.315) -- 0:00:47
284500 -- [-728.435] (-726.953) (-730.555) (-728.193) * [-726.968] (-728.023) (-730.777) (-727.603) -- 0:00:47
285000 -- (-728.933) (-725.812) [-727.789] (-726.943) * (-725.645) [-726.143] (-730.040) (-727.368) -- 0:00:47
Average standard deviation of split frequencies: 0.015028
285500 -- [-727.690] (-728.118) (-729.688) (-726.878) * [-727.057] (-727.517) (-727.979) (-728.213) -- 0:00:47
286000 -- (-725.621) (-725.776) [-726.977] (-727.586) * (-727.298) (-728.071) (-727.443) [-728.132] -- 0:00:47
286500 -- (-731.442) [-727.091] (-728.999) (-726.613) * (-725.605) (-727.232) [-728.166] (-729.512) -- 0:00:47
287000 -- (-726.409) (-728.755) (-728.354) [-726.028] * [-727.105] (-727.843) (-732.178) (-725.749) -- 0:00:49
287500 -- (-728.859) (-725.372) [-728.209] (-725.650) * (-726.723) [-727.314] (-726.716) (-731.026) -- 0:00:49
288000 -- (-728.409) (-725.407) (-727.061) [-729.257] * (-726.733) [-727.856] (-728.397) (-732.766) -- 0:00:49
288500 -- (-726.647) (-727.636) [-727.812] (-727.793) * (-727.020) (-732.187) (-728.856) [-733.278] -- 0:00:49
289000 -- (-725.359) [-728.179] (-727.440) (-732.038) * (-726.896) (-728.494) [-727.665] (-729.125) -- 0:00:49
289500 -- (-726.532) (-726.266) [-727.839] (-731.631) * [-726.833] (-728.358) (-729.815) (-732.515) -- 0:00:49
290000 -- [-727.286] (-731.765) (-727.804) (-729.785) * (-728.085) (-726.671) [-725.861] (-732.404) -- 0:00:48
Average standard deviation of split frequencies: 0.015227
290500 -- (-726.634) [-726.645] (-728.535) (-730.167) * (-726.283) (-725.460) [-727.512] (-730.486) -- 0:00:48
291000 -- (-726.217) [-728.846] (-727.189) (-728.325) * (-727.860) (-727.142) [-726.390] (-728.768) -- 0:00:48
291500 -- (-729.317) (-727.578) (-727.830) [-726.266] * (-726.531) (-728.255) (-726.958) [-729.602] -- 0:00:48
292000 -- [-727.521] (-732.365) (-725.944) (-725.874) * [-725.769] (-726.705) (-729.087) (-733.268) -- 0:00:48
292500 -- [-727.993] (-726.959) (-731.517) (-728.120) * (-728.595) (-725.540) [-725.654] (-728.500) -- 0:00:48
293000 -- [-726.899] (-726.929) (-731.982) (-727.914) * (-729.195) (-728.585) [-729.980] (-729.110) -- 0:00:48
293500 -- [-728.235] (-727.051) (-725.541) (-728.443) * (-727.982) (-728.986) [-727.622] (-727.382) -- 0:00:48
294000 -- (-727.034) (-725.580) (-726.847) [-726.699] * (-729.806) (-727.222) [-726.178] (-730.528) -- 0:00:48
294500 -- [-727.436] (-728.152) (-729.675) (-730.802) * (-728.521) [-728.371] (-725.757) (-727.483) -- 0:00:47
295000 -- (-727.961) [-726.259] (-732.395) (-727.671) * (-729.203) (-733.764) [-727.532] (-726.330) -- 0:00:47
Average standard deviation of split frequencies: 0.014510
295500 -- (-727.468) (-729.217) [-727.297] (-726.741) * (-730.397) [-726.593] (-726.900) (-726.593) -- 0:00:47
296000 -- (-729.220) (-730.535) (-728.154) [-726.055] * (-728.346) (-728.230) (-727.823) [-727.299] -- 0:00:47
296500 -- (-732.055) (-728.131) (-725.609) [-729.926] * (-725.912) [-726.778] (-726.802) (-726.767) -- 0:00:47
297000 -- (-731.533) (-726.849) [-725.751] (-727.150) * (-729.894) (-727.096) [-727.042] (-729.040) -- 0:00:47
297500 -- (-729.810) (-726.393) [-725.992] (-727.728) * [-727.966] (-725.664) (-727.152) (-730.133) -- 0:00:47
298000 -- [-730.201] (-725.643) (-727.201) (-727.484) * (-727.174) (-730.189) (-734.142) [-731.442] -- 0:00:47
298500 -- (-730.002) [-726.016] (-727.821) (-727.678) * (-726.189) (-727.490) (-733.240) [-732.773] -- 0:00:47
299000 -- (-727.703) [-725.526] (-725.390) (-726.782) * (-728.470) [-727.634] (-727.798) (-729.021) -- 0:00:46
299500 -- (-727.203) (-726.913) (-726.751) [-725.250] * (-730.909) [-727.210] (-730.153) (-726.678) -- 0:00:46
300000 -- (-727.414) (-725.932) (-729.313) [-725.312] * (-728.013) (-729.607) (-726.188) [-732.493] -- 0:00:46
Average standard deviation of split frequencies: 0.015771
300500 -- (-726.591) (-734.040) (-729.096) [-727.789] * (-727.643) [-727.043] (-725.489) (-727.171) -- 0:00:46
301000 -- [-727.742] (-727.477) (-729.269) (-729.523) * (-728.840) (-729.671) [-726.363] (-727.951) -- 0:00:46
301500 -- [-728.897] (-726.861) (-726.995) (-727.844) * (-726.343) (-734.774) (-726.155) [-725.523] -- 0:00:46
302000 -- [-726.182] (-727.367) (-728.359) (-725.789) * [-727.560] (-728.729) (-725.498) (-726.521) -- 0:00:46
302500 -- (-728.774) [-725.252] (-727.139) (-730.887) * (-735.922) (-728.505) [-727.660] (-728.826) -- 0:00:46
303000 -- (-725.833) (-725.016) [-730.706] (-725.382) * (-727.839) [-728.411] (-729.278) (-734.729) -- 0:00:46
303500 -- (-729.882) (-726.631) (-732.386) [-725.662] * [-726.926] (-726.850) (-725.445) (-732.128) -- 0:00:45
304000 -- [-727.922] (-726.891) (-728.227) (-727.029) * (-729.586) (-727.854) [-727.356] (-726.969) -- 0:00:48
304500 -- (-731.224) [-727.306] (-729.267) (-728.151) * (-728.034) [-726.521] (-725.613) (-729.089) -- 0:00:47
305000 -- (-731.366) (-728.468) [-728.283] (-729.837) * (-728.529) [-728.073] (-725.273) (-730.435) -- 0:00:47
Average standard deviation of split frequencies: 0.015748
305500 -- (-730.675) (-728.364) (-725.517) [-725.405] * [-726.216] (-729.453) (-727.062) (-732.033) -- 0:00:47
306000 -- [-730.769] (-730.137) (-732.314) (-725.379) * (-727.469) [-726.455] (-726.656) (-727.578) -- 0:00:47
306500 -- (-726.731) [-727.264] (-727.321) (-727.707) * [-726.007] (-727.109) (-728.126) (-726.765) -- 0:00:47
307000 -- (-727.515) (-725.231) (-728.691) [-728.152] * (-728.371) [-726.412] (-728.178) (-728.964) -- 0:00:47
307500 -- [-726.452] (-726.796) (-728.816) (-729.131) * (-735.513) (-728.102) (-727.608) [-726.855] -- 0:00:47
308000 -- (-727.815) (-728.379) (-727.661) [-728.502] * (-731.842) (-729.702) [-727.595] (-726.726) -- 0:00:47
308500 -- (-727.821) [-726.532] (-729.255) (-728.002) * [-729.359] (-728.322) (-728.044) (-726.940) -- 0:00:47
309000 -- (-725.791) (-726.585) [-726.372] (-726.207) * (-726.885) [-726.453] (-725.482) (-728.101) -- 0:00:46
309500 -- (-727.968) (-725.806) (-726.536) [-727.325] * (-727.177) (-728.369) [-725.533] (-731.880) -- 0:00:46
310000 -- (-725.628) (-727.742) (-726.104) [-728.302] * (-733.527) (-727.793) (-725.652) [-729.046] -- 0:00:46
Average standard deviation of split frequencies: 0.016245
310500 -- (-727.913) (-729.599) (-727.140) [-727.891] * (-727.198) (-726.292) [-725.426] (-727.719) -- 0:00:46
311000 -- [-728.127] (-729.336) (-725.628) (-729.206) * [-725.131] (-726.796) (-726.235) (-728.653) -- 0:00:46
311500 -- (-729.694) [-727.670] (-730.685) (-733.874) * [-725.784] (-725.448) (-732.673) (-726.882) -- 0:00:46
312000 -- (-728.799) (-726.311) [-732.094] (-727.739) * (-729.211) [-725.520] (-739.594) (-730.120) -- 0:00:46
312500 -- (-727.709) (-726.502) (-727.701) [-729.062] * (-732.475) (-725.872) (-727.299) [-726.794] -- 0:00:46
313000 -- [-727.091] (-725.799) (-727.668) (-725.900) * (-728.183) [-728.547] (-728.564) (-728.888) -- 0:00:46
313500 -- (-725.464) [-725.800] (-728.862) (-727.498) * (-725.484) (-727.591) [-728.202] (-727.052) -- 0:00:45
314000 -- [-733.844] (-725.455) (-729.028) (-726.648) * (-725.528) (-726.709) [-726.130] (-728.877) -- 0:00:45
314500 -- (-727.171) [-725.563] (-728.979) (-727.891) * (-729.424) (-728.421) [-729.641] (-731.299) -- 0:00:45
315000 -- (-730.687) (-725.511) [-728.264] (-730.170) * (-727.496) (-730.352) (-728.830) [-730.593] -- 0:00:45
Average standard deviation of split frequencies: 0.016223
315500 -- (-727.829) (-725.773) [-728.555] (-729.891) * (-727.362) (-726.207) [-725.794] (-729.197) -- 0:00:45
316000 -- (-729.865) (-726.596) (-727.442) [-729.660] * (-726.062) (-727.188) [-727.136] (-727.184) -- 0:00:45
316500 -- (-731.852) (-726.184) (-729.265) [-728.858] * (-728.674) (-726.912) (-727.438) [-725.521] -- 0:00:45
317000 -- (-727.763) [-726.707] (-733.915) (-732.323) * (-729.237) [-727.091] (-727.967) (-725.521) -- 0:00:45
317500 -- (-727.911) (-727.092) [-728.645] (-727.941) * [-726.458] (-727.843) (-726.689) (-730.295) -- 0:00:45
318000 -- (-732.623) (-730.542) [-726.431] (-726.230) * [-727.393] (-726.684) (-727.241) (-726.979) -- 0:00:45
318500 -- (-726.630) [-728.610] (-728.036) (-725.690) * [-726.121] (-726.505) (-727.030) (-727.223) -- 0:00:44
319000 -- (-726.369) [-726.868] (-727.776) (-727.424) * (-726.536) [-726.231] (-728.737) (-726.669) -- 0:00:44
319500 -- (-732.580) (-726.246) [-728.402] (-728.252) * [-725.549] (-728.758) (-726.173) (-729.420) -- 0:00:44
320000 -- (-728.103) (-725.935) [-727.166] (-727.799) * (-728.946) [-726.673] (-728.199) (-729.838) -- 0:00:44
Average standard deviation of split frequencies: 0.014182
320500 -- [-727.008] (-730.036) (-732.309) (-725.946) * (-728.457) [-726.360] (-727.409) (-730.304) -- 0:00:46
321000 -- (-726.991) (-726.826) (-726.175) [-725.832] * [-725.338] (-729.354) (-729.648) (-729.118) -- 0:00:46
321500 -- [-726.107] (-729.499) (-727.406) (-728.328) * [-725.593] (-726.930) (-727.387) (-731.884) -- 0:00:46
322000 -- (-729.049) (-727.735) [-725.822] (-730.271) * (-727.120) (-727.809) [-727.583] (-729.019) -- 0:00:46
322500 -- (-728.197) (-728.399) [-727.153] (-729.406) * (-729.474) (-725.552) [-727.599] (-727.747) -- 0:00:46
323000 -- (-726.764) [-729.084] (-727.954) (-732.141) * (-727.461) (-726.617) (-725.703) [-727.841] -- 0:00:46
323500 -- [-725.593] (-727.799) (-728.460) (-727.442) * (-727.681) (-729.633) (-726.001) [-726.509] -- 0:00:46
324000 -- (-727.556) (-728.987) [-727.524] (-727.169) * [-727.502] (-726.843) (-726.523) (-730.971) -- 0:00:45
324500 -- [-726.069] (-730.689) (-730.791) (-727.658) * (-731.330) (-727.039) (-727.547) [-727.726] -- 0:00:45
325000 -- [-727.127] (-728.022) (-726.992) (-727.313) * (-726.177) (-727.860) (-729.174) [-726.077] -- 0:00:45
Average standard deviation of split frequencies: 0.013780
325500 -- (-728.859) (-725.814) [-726.862] (-726.709) * [-730.450] (-727.007) (-727.680) (-728.424) -- 0:00:45
326000 -- (-726.576) [-728.506] (-727.492) (-726.944) * (-733.081) [-725.078] (-727.843) (-726.484) -- 0:00:45
326500 -- (-727.392) [-726.184] (-726.932) (-728.250) * (-727.751) (-731.673) [-727.411] (-726.104) -- 0:00:45
327000 -- (-725.767) (-725.971) (-726.021) [-729.737] * (-727.016) [-725.387] (-726.544) (-728.092) -- 0:00:45
327500 -- [-726.565] (-727.924) (-725.735) (-731.225) * (-727.344) (-733.298) (-727.020) [-727.986] -- 0:00:45
328000 -- (-728.270) (-729.458) [-727.808] (-729.436) * (-725.729) (-728.431) (-729.708) [-727.006] -- 0:00:45
328500 -- (-727.030) (-727.087) [-725.556] (-728.873) * [-725.777] (-729.491) (-730.013) (-726.199) -- 0:00:44
329000 -- (-730.378) (-729.047) [-730.878] (-727.225) * [-726.042] (-725.798) (-726.856) (-725.603) -- 0:00:44
329500 -- (-728.737) [-730.481] (-729.294) (-727.695) * (-728.351) (-726.055) [-729.230] (-727.746) -- 0:00:44
330000 -- (-731.820) (-726.500) (-727.214) [-729.018] * (-725.651) (-726.596) (-729.326) [-727.356] -- 0:00:44
Average standard deviation of split frequencies: 0.013669
330500 -- (-730.000) [-728.330] (-725.978) (-727.542) * [-727.794] (-731.313) (-729.873) (-730.126) -- 0:00:44
331000 -- (-728.207) [-726.796] (-727.621) (-729.023) * (-725.891) (-732.415) [-727.485] (-728.124) -- 0:00:44
331500 -- (-728.295) (-728.468) [-727.964] (-727.942) * (-726.902) (-727.949) [-726.523] (-726.524) -- 0:00:44
332000 -- (-729.061) (-727.486) (-725.388) [-729.856] * (-726.257) (-727.758) [-725.463] (-728.208) -- 0:00:44
332500 -- (-728.036) [-725.475] (-732.738) (-727.026) * (-729.057) [-727.671] (-726.381) (-726.338) -- 0:00:44
333000 -- (-728.451) (-727.368) (-729.363) [-727.470] * (-726.537) (-727.512) (-729.951) [-726.411] -- 0:00:44
333500 -- (-727.339) (-727.593) (-725.695) [-728.675] * [-726.923] (-726.739) (-727.644) (-726.020) -- 0:00:43
334000 -- [-727.324] (-727.059) (-725.836) (-732.029) * [-726.545] (-727.712) (-725.525) (-730.229) -- 0:00:43
334500 -- [-727.213] (-727.325) (-726.514) (-727.237) * [-727.983] (-725.665) (-727.087) (-728.522) -- 0:00:43
335000 -- [-727.683] (-725.861) (-726.205) (-731.860) * [-729.934] (-725.770) (-726.962) (-725.267) -- 0:00:43
Average standard deviation of split frequencies: 0.012792
335500 -- (-727.567) [-727.126] (-727.665) (-730.691) * (-726.581) (-726.744) [-728.526] (-726.899) -- 0:00:43
336000 -- (-731.959) [-726.961] (-729.679) (-727.816) * (-731.319) [-726.362] (-729.233) (-727.701) -- 0:00:43
336500 -- (-726.578) (-729.479) (-728.348) [-727.033] * (-730.004) (-725.513) [-730.881] (-729.871) -- 0:00:43
337000 -- (-725.911) (-726.809) [-728.190] (-727.339) * (-729.673) [-726.173] (-727.959) (-726.818) -- 0:00:45
337500 -- [-726.795] (-729.774) (-729.106) (-735.178) * (-727.180) [-728.398] (-727.910) (-726.583) -- 0:00:45
338000 -- (-725.564) (-730.008) (-729.590) [-730.137] * (-726.705) (-725.366) (-732.160) [-726.364] -- 0:00:45
338500 -- [-726.399] (-726.236) (-726.341) (-728.341) * (-727.287) (-726.736) [-728.869] (-726.844) -- 0:00:44
339000 -- (-727.531) [-726.277] (-728.962) (-725.907) * [-727.099] (-728.084) (-730.233) (-731.194) -- 0:00:44
339500 -- (-729.515) (-731.128) (-727.307) [-727.395] * (-729.549) (-726.798) [-728.332] (-729.716) -- 0:00:44
340000 -- (-733.216) (-729.576) (-727.849) [-727.435] * (-728.161) (-729.930) (-730.353) [-726.305] -- 0:00:44
Average standard deviation of split frequencies: 0.012210
340500 -- (-730.117) (-727.922) [-729.225] (-728.718) * (-725.963) (-728.323) (-725.979) [-732.565] -- 0:00:44
341000 -- (-727.316) (-730.644) (-732.843) [-728.380] * (-729.322) (-727.058) [-727.822] (-731.360) -- 0:00:44
341500 -- (-732.232) (-729.496) (-727.057) [-726.221] * (-727.820) [-727.222] (-727.480) (-731.239) -- 0:00:44
342000 -- (-725.741) (-731.060) (-726.154) [-729.363] * (-728.182) (-729.371) [-731.212] (-727.609) -- 0:00:44
342500 -- [-726.036] (-730.031) (-728.385) (-729.089) * [-728.558] (-729.103) (-729.637) (-727.168) -- 0:00:44
343000 -- (-725.527) (-725.640) (-731.047) [-726.824] * [-725.283] (-726.442) (-730.509) (-734.671) -- 0:00:44
343500 -- (-726.484) [-727.815] (-729.316) (-729.875) * (-726.424) (-726.289) (-727.927) [-727.307] -- 0:00:43
344000 -- [-727.311] (-726.977) (-729.916) (-727.764) * (-728.242) (-730.839) [-729.654] (-729.325) -- 0:00:43
344500 -- (-727.073) (-727.438) (-726.898) [-726.809] * (-727.304) (-731.794) (-731.011) [-727.755] -- 0:00:43
345000 -- (-731.522) (-727.544) (-727.508) [-726.801] * (-725.802) [-730.183] (-727.076) (-725.894) -- 0:00:43
Average standard deviation of split frequencies: 0.013322
345500 -- [-731.934] (-726.686) (-727.501) (-727.364) * (-727.596) (-726.670) [-725.769] (-727.730) -- 0:00:43
346000 -- (-729.976) (-730.385) (-725.542) [-726.091] * (-728.533) (-726.695) (-727.004) [-727.283] -- 0:00:43
346500 -- (-726.310) (-725.321) (-726.899) [-726.848] * (-727.031) [-726.684] (-727.034) (-727.928) -- 0:00:43
347000 -- [-725.090] (-727.657) (-729.154) (-727.929) * (-728.836) (-731.086) [-726.155] (-728.191) -- 0:00:43
347500 -- (-725.852) (-729.893) (-727.287) [-730.211] * (-735.693) [-728.710] (-725.989) (-727.638) -- 0:00:43
348000 -- (-729.016) (-728.242) [-730.675] (-730.110) * (-732.702) (-727.925) (-725.521) [-725.990] -- 0:00:43
348500 -- (-728.639) [-728.848] (-726.810) (-725.198) * (-725.414) [-725.901] (-728.571) (-728.149) -- 0:00:42
349000 -- (-726.716) [-726.657] (-726.959) (-727.478) * [-727.103] (-729.204) (-731.346) (-727.656) -- 0:00:42
349500 -- (-726.623) (-727.299) (-728.420) [-729.323] * (-726.474) [-726.708] (-725.912) (-725.929) -- 0:00:42
350000 -- (-727.532) (-730.313) [-725.432] (-726.114) * [-729.852] (-730.074) (-725.863) (-725.457) -- 0:00:42
Average standard deviation of split frequencies: 0.013742
350500 -- (-725.548) [-725.825] (-725.628) (-726.821) * (-726.323) (-727.869) (-725.855) [-725.366] -- 0:00:42
351000 -- (-726.278) [-728.035] (-729.974) (-729.415) * [-727.693] (-726.057) (-726.330) (-726.215) -- 0:00:42
351500 -- (-726.760) [-726.851] (-732.398) (-733.596) * [-726.470] (-730.868) (-726.021) (-727.508) -- 0:00:42
352000 -- (-728.689) (-726.843) [-728.580] (-726.920) * (-725.775) (-725.681) [-726.274] (-728.490) -- 0:00:42
352500 -- (-728.095) (-730.589) [-727.175] (-734.196) * (-726.067) [-726.247] (-728.087) (-727.828) -- 0:00:42
353000 -- [-726.170] (-728.466) (-727.676) (-730.106) * [-726.117] (-727.752) (-726.389) (-728.387) -- 0:00:42
353500 -- (-726.246) (-728.158) [-728.632] (-729.257) * (-731.210) [-727.187] (-727.080) (-726.534) -- 0:00:43
354000 -- (-726.010) (-729.964) [-727.224] (-728.569) * (-731.566) (-728.301) (-726.787) [-728.624] -- 0:00:43
354500 -- [-726.909] (-728.253) (-725.463) (-725.748) * (-728.119) (-726.399) [-726.413] (-727.206) -- 0:00:43
355000 -- (-728.627) (-726.048) [-725.619] (-726.238) * (-729.986) [-725.895] (-726.588) (-726.914) -- 0:00:43
Average standard deviation of split frequencies: 0.014566
355500 -- (-730.340) (-728.331) [-726.191] (-728.207) * (-730.463) [-726.132] (-730.403) (-726.524) -- 0:00:43
356000 -- (-726.165) (-727.810) [-726.547] (-728.129) * (-730.530) [-731.457] (-728.610) (-726.939) -- 0:00:43
356500 -- (-727.714) (-731.852) (-726.580) [-726.795] * [-725.837] (-735.957) (-729.301) (-726.435) -- 0:00:43
357000 -- (-728.572) (-725.855) (-728.727) [-726.914] * (-727.361) [-728.036] (-725.899) (-725.691) -- 0:00:43
357500 -- (-731.067) [-727.787] (-726.786) (-726.905) * (-728.831) (-727.731) [-726.351] (-730.111) -- 0:00:43
358000 -- (-733.347) (-729.119) [-727.515] (-725.990) * (-726.896) (-727.328) [-727.378] (-725.381) -- 0:00:43
358500 -- (-726.416) (-728.542) [-725.865] (-729.762) * (-731.523) (-725.559) (-728.891) [-725.775] -- 0:00:42
359000 -- (-726.419) [-726.905] (-726.978) (-727.510) * [-726.822] (-727.158) (-727.787) (-726.495) -- 0:00:42
359500 -- (-725.716) (-728.597) [-726.342] (-731.188) * (-729.254) (-726.481) (-728.245) [-733.249] -- 0:00:42
360000 -- (-729.745) (-728.959) (-725.008) [-726.036] * (-727.208) [-727.302] (-727.556) (-725.588) -- 0:00:42
Average standard deviation of split frequencies: 0.015249
360500 -- (-727.536) (-727.177) (-729.315) [-726.310] * (-727.226) (-727.842) (-726.918) [-725.799] -- 0:00:42
361000 -- [-726.938] (-726.681) (-725.492) (-733.289) * (-727.918) (-725.913) [-727.201] (-728.113) -- 0:00:42
361500 -- (-726.942) (-729.744) (-725.390) [-729.899] * (-727.288) [-726.830] (-728.064) (-728.359) -- 0:00:42
362000 -- (-735.349) (-728.363) (-725.647) [-726.413] * (-727.655) [-726.143] (-726.968) (-727.673) -- 0:00:42
362500 -- (-727.338) [-728.093] (-726.415) (-729.036) * (-725.602) [-728.656] (-727.281) (-726.556) -- 0:00:42
363000 -- (-728.519) (-727.234) (-726.923) [-725.569] * (-725.716) [-729.083] (-726.785) (-726.502) -- 0:00:42
363500 -- (-727.536) (-727.647) [-728.729] (-728.678) * (-726.673) (-728.143) (-726.789) [-727.578] -- 0:00:42
364000 -- (-730.201) [-726.350] (-728.539) (-731.931) * (-729.416) (-727.152) [-726.982] (-726.682) -- 0:00:41
364500 -- (-731.650) (-728.944) [-727.555] (-730.129) * (-728.208) (-726.984) [-728.905] (-726.861) -- 0:00:41
365000 -- [-730.654] (-727.194) (-726.079) (-726.572) * (-725.838) (-727.017) (-727.379) [-725.311] -- 0:00:41
Average standard deviation of split frequencies: 0.014168
365500 -- (-727.697) (-726.241) [-725.513] (-726.204) * (-727.369) [-726.289] (-727.222) (-727.187) -- 0:00:41
366000 -- [-730.085] (-727.865) (-729.199) (-726.270) * (-730.577) (-726.831) [-727.768] (-725.992) -- 0:00:41
366500 -- [-728.294] (-726.903) (-728.701) (-727.799) * (-728.955) [-726.071] (-725.593) (-725.886) -- 0:00:41
367000 -- (-727.090) (-726.940) [-727.263] (-727.938) * (-727.034) [-728.042] (-732.436) (-728.341) -- 0:00:41
367500 -- [-725.690] (-727.744) (-726.062) (-729.459) * (-727.512) (-731.764) (-727.615) [-728.372] -- 0:00:41
368000 -- [-726.499] (-730.150) (-729.820) (-725.796) * (-726.614) [-727.668] (-726.080) (-726.925) -- 0:00:41
368500 -- (-727.889) (-728.561) (-725.769) [-726.586] * (-732.435) (-726.846) (-726.393) [-726.144] -- 0:00:41
369000 -- (-727.226) [-728.811] (-728.814) (-726.134) * (-726.505) [-726.163] (-727.277) (-728.889) -- 0:00:41
369500 -- (-728.988) [-728.652] (-728.032) (-728.790) * (-728.854) [-727.998] (-726.839) (-731.418) -- 0:00:40
370000 -- (-730.606) (-728.526) (-727.434) [-725.742] * (-728.462) (-728.862) [-728.357] (-731.281) -- 0:00:40
Average standard deviation of split frequencies: 0.013316
370500 -- (-726.556) (-725.195) [-726.070] (-729.384) * (-729.311) [-725.600] (-726.652) (-729.051) -- 0:00:42
371000 -- (-727.115) (-726.436) (-726.483) [-727.345] * (-726.585) (-727.779) [-728.000] (-728.748) -- 0:00:42
371500 -- (-727.491) (-725.661) [-728.276] (-726.672) * (-727.958) (-728.048) (-729.404) [-725.694] -- 0:00:42
372000 -- (-731.260) (-726.650) [-727.319] (-725.612) * (-729.598) (-727.171) [-726.739] (-726.598) -- 0:00:42
372500 -- (-727.515) [-726.049] (-730.906) (-725.885) * [-726.794] (-725.169) (-725.932) (-726.403) -- 0:00:42
373000 -- [-726.289] (-727.826) (-730.323) (-729.610) * (-726.895) (-729.184) [-727.372] (-727.590) -- 0:00:42
373500 -- (-730.568) [-726.634] (-728.125) (-725.536) * (-728.987) (-729.295) [-726.979] (-727.331) -- 0:00:41
374000 -- (-726.144) [-726.027] (-729.441) (-725.910) * (-726.832) [-728.260] (-728.081) (-728.592) -- 0:00:41
374500 -- (-726.304) (-725.743) [-725.472] (-727.872) * (-736.964) (-729.732) [-729.520] (-727.498) -- 0:00:41
375000 -- (-726.417) [-726.515] (-726.681) (-728.309) * (-730.422) [-726.808] (-727.973) (-728.369) -- 0:00:41
Average standard deviation of split frequencies: 0.012316
375500 -- (-727.096) [-729.368] (-727.194) (-729.067) * (-732.991) (-727.109) (-727.188) [-726.372] -- 0:00:41
376000 -- (-727.389) (-728.176) (-725.620) [-727.552] * [-725.683] (-730.237) (-728.158) (-727.524) -- 0:00:41
376500 -- (-727.043) [-728.540] (-728.152) (-728.523) * (-727.289) (-730.393) (-731.078) [-729.673] -- 0:00:41
377000 -- (-727.099) [-726.826] (-732.751) (-728.780) * (-729.471) (-729.375) [-727.475] (-726.250) -- 0:00:41
377500 -- (-725.690) [-725.851] (-728.139) (-727.632) * [-727.245] (-727.478) (-726.355) (-727.491) -- 0:00:41
378000 -- [-725.650] (-727.641) (-731.009) (-729.739) * (-727.462) (-729.303) (-727.622) [-726.408] -- 0:00:41
378500 -- (-729.773) [-726.699] (-725.440) (-726.224) * (-726.602) [-727.613] (-731.688) (-728.207) -- 0:00:41
379000 -- (-726.262) (-727.776) [-725.512] (-726.962) * [-726.173] (-730.270) (-729.951) (-726.748) -- 0:00:40
379500 -- (-725.564) (-727.503) (-726.103) [-727.785] * (-725.694) (-727.179) [-727.118] (-729.327) -- 0:00:40
380000 -- [-727.301] (-730.535) (-726.382) (-726.702) * [-726.051] (-727.844) (-728.288) (-727.257) -- 0:00:40
Average standard deviation of split frequencies: 0.012092
380500 -- [-727.254] (-728.824) (-726.512) (-727.772) * [-727.718] (-727.412) (-730.298) (-730.972) -- 0:00:40
381000 -- (-726.730) (-727.443) [-727.593] (-727.055) * (-727.806) (-727.687) [-727.695] (-727.663) -- 0:00:40
381500 -- (-726.086) [-728.747] (-728.135) (-728.330) * (-726.776) (-726.321) (-728.240) [-725.395] -- 0:00:40
382000 -- (-727.529) (-727.430) (-730.109) [-726.016] * (-729.310) (-725.708) (-727.531) [-725.989] -- 0:00:40
382500 -- (-731.273) (-727.953) (-729.407) [-726.756] * (-729.092) (-730.417) (-727.022) [-728.929] -- 0:00:40
383000 -- (-731.428) (-726.948) [-726.871] (-731.237) * (-729.174) (-725.289) (-732.885) [-727.523] -- 0:00:40
383500 -- (-728.506) (-727.815) (-728.025) [-727.268] * (-726.238) (-726.355) (-727.153) [-730.417] -- 0:00:40
384000 -- (-728.916) [-728.674] (-727.131) (-728.989) * (-726.460) (-730.854) (-727.378) [-730.007] -- 0:00:40
384500 -- (-728.326) [-728.612] (-726.705) (-727.483) * (-729.385) [-726.328] (-726.815) (-729.587) -- 0:00:40
385000 -- (-727.468) (-728.245) [-732.152] (-727.219) * (-728.318) [-725.547] (-727.070) (-728.948) -- 0:00:39
Average standard deviation of split frequencies: 0.011710
385500 -- (-725.738) (-727.155) [-731.985] (-726.838) * (-729.867) (-726.388) [-727.350] (-730.338) -- 0:00:39
386000 -- (-727.854) [-727.396] (-727.184) (-727.061) * (-727.963) [-726.318] (-727.896) (-730.887) -- 0:00:39
386500 -- (-725.870) [-728.797] (-727.651) (-727.693) * [-728.765] (-725.772) (-726.551) (-725.990) -- 0:00:39
387000 -- [-729.292] (-725.352) (-726.306) (-726.264) * (-726.764) (-725.697) [-727.798] (-726.230) -- 0:00:39
387500 -- (-728.365) (-726.900) (-726.358) [-728.341] * (-728.621) (-728.677) (-732.217) [-730.427] -- 0:00:41
388000 -- (-725.965) (-725.580) [-729.457] (-725.649) * (-726.543) [-726.926] (-729.838) (-725.800) -- 0:00:41
388500 -- (-726.044) (-726.244) [-730.857] (-725.757) * [-726.865] (-727.815) (-727.267) (-725.231) -- 0:00:40
389000 -- [-725.788] (-732.589) (-727.206) (-725.400) * (-727.618) (-726.753) (-727.874) [-728.256] -- 0:00:40
389500 -- (-726.320) [-727.742] (-727.320) (-728.495) * (-728.921) (-729.260) (-725.509) [-728.257] -- 0:00:40
390000 -- (-732.010) [-731.544] (-726.299) (-725.581) * (-728.327) (-730.560) [-726.020] (-728.060) -- 0:00:40
Average standard deviation of split frequencies: 0.011925
390500 -- (-726.757) (-729.730) [-726.141] (-730.693) * (-726.845) (-733.094) (-728.387) [-729.161] -- 0:00:40
391000 -- [-726.775] (-725.579) (-727.924) (-726.956) * [-726.590] (-732.338) (-727.924) (-726.385) -- 0:00:40
391500 -- (-725.701) (-725.930) (-726.029) [-727.199] * (-728.316) (-728.227) (-727.333) [-726.094] -- 0:00:40
392000 -- [-725.645] (-725.552) (-727.814) (-725.850) * (-726.217) [-727.025] (-725.314) (-728.371) -- 0:00:40
392500 -- (-727.120) [-728.476] (-730.542) (-729.308) * (-728.715) (-728.122) [-725.447] (-727.719) -- 0:00:40
393000 -- [-728.178] (-730.301) (-733.310) (-726.327) * (-727.517) (-728.308) (-725.550) [-725.315] -- 0:00:40
393500 -- [-726.584] (-731.799) (-732.622) (-731.369) * (-728.486) [-728.710] (-726.838) (-725.848) -- 0:00:40
394000 -- (-726.634) [-726.329] (-729.575) (-732.330) * (-726.168) (-731.750) (-727.830) [-725.839] -- 0:00:39
394500 -- (-730.486) [-725.551] (-726.024) (-731.281) * (-727.446) (-728.223) [-726.863] (-725.296) -- 0:00:39
395000 -- [-727.228] (-729.731) (-730.303) (-728.078) * [-728.000] (-733.134) (-726.632) (-728.795) -- 0:00:39
Average standard deviation of split frequencies: 0.011624
395500 -- [-726.036] (-730.567) (-731.133) (-727.205) * (-726.372) (-727.927) [-726.248] (-726.167) -- 0:00:39
396000 -- [-725.801] (-727.896) (-728.561) (-727.817) * [-728.840] (-726.722) (-726.750) (-726.363) -- 0:00:39
396500 -- [-729.677] (-728.887) (-735.586) (-729.207) * (-730.913) [-725.736] (-728.810) (-729.203) -- 0:00:39
397000 -- (-729.582) [-725.998] (-729.721) (-727.647) * [-728.471] (-725.400) (-727.148) (-726.012) -- 0:00:39
397500 -- (-725.247) (-726.128) [-725.256] (-727.054) * [-728.745] (-727.301) (-728.549) (-727.445) -- 0:00:39
398000 -- (-727.083) [-725.985] (-726.930) (-726.349) * (-728.066) (-728.076) [-726.422] (-729.996) -- 0:00:39
398500 -- (-725.492) (-726.494) [-728.301] (-731.236) * (-727.987) [-735.608] (-727.195) (-729.119) -- 0:00:39
399000 -- (-726.465) (-726.844) [-727.089] (-726.101) * (-726.430) (-727.444) [-728.758] (-727.077) -- 0:00:39
399500 -- [-726.409] (-730.145) (-727.389) (-725.807) * (-726.165) (-726.638) (-730.766) [-726.704] -- 0:00:39
400000 -- (-727.872) (-730.854) [-727.068] (-728.870) * [-725.383] (-726.824) (-728.605) (-726.716) -- 0:00:39
Average standard deviation of split frequencies: 0.011835
400500 -- (-726.416) [-725.626] (-727.292) (-731.240) * (-725.822) [-726.635] (-733.968) (-728.128) -- 0:00:38
401000 -- (-730.649) (-725.739) (-729.666) [-729.026] * [-734.961] (-726.159) (-731.967) (-731.221) -- 0:00:38
401500 -- (-728.333) (-725.950) [-726.743] (-729.288) * (-733.053) [-726.920] (-730.426) (-734.361) -- 0:00:38
402000 -- (-730.278) (-728.596) [-726.395] (-731.383) * (-727.227) (-729.145) [-728.573] (-729.491) -- 0:00:38
402500 -- [-726.457] (-728.051) (-725.814) (-730.984) * (-727.214) (-727.399) (-726.346) [-725.926] -- 0:00:38
403000 -- (-726.228) (-726.330) [-725.923] (-726.911) * (-726.695) [-727.111] (-726.402) (-727.044) -- 0:00:38
403500 -- (-726.984) (-726.446) [-726.264] (-727.130) * (-727.199) (-726.895) (-731.693) [-730.107] -- 0:00:38
404000 -- (-726.473) [-727.590] (-726.954) (-727.038) * (-728.775) [-726.322] (-726.366) (-730.335) -- 0:00:39
404500 -- (-727.317) (-729.030) (-726.973) [-730.975] * (-731.082) [-727.571] (-725.470) (-728.675) -- 0:00:39
405000 -- (-730.407) (-725.700) (-728.393) [-728.127] * (-726.141) (-730.070) (-725.862) [-726.475] -- 0:00:39
Average standard deviation of split frequencies: 0.011543
405500 -- (-728.900) (-725.646) (-730.687) [-725.320] * (-729.945) (-726.747) (-726.059) [-730.104] -- 0:00:39
406000 -- (-726.189) (-725.955) (-730.193) [-725.799] * [-725.488] (-734.981) (-728.158) (-729.705) -- 0:00:39
406500 -- (-727.440) (-728.835) (-729.140) [-728.536] * [-726.249] (-730.175) (-727.340) (-730.656) -- 0:00:39
407000 -- (-725.805) [-729.465] (-730.073) (-728.438) * (-728.736) [-727.028] (-727.190) (-728.515) -- 0:00:39
407500 -- (-728.742) [-727.914] (-729.946) (-728.653) * (-727.533) (-726.073) [-727.121] (-728.092) -- 0:00:39
408000 -- (-729.015) (-727.079) (-727.203) [-730.938] * (-726.316) [-725.571] (-727.501) (-726.720) -- 0:00:39
408500 -- (-729.278) (-728.790) (-729.095) [-726.111] * (-725.728) (-726.117) (-728.091) [-725.735] -- 0:00:39
409000 -- [-726.312] (-728.882) (-728.592) (-727.263) * (-725.578) (-726.255) [-731.293] (-726.608) -- 0:00:39
409500 -- (-726.429) [-726.183] (-726.325) (-727.722) * (-730.488) (-727.548) (-731.697) [-727.485] -- 0:00:38
410000 -- (-727.848) [-725.950] (-727.033) (-730.991) * (-730.452) [-726.071] (-728.302) (-726.191) -- 0:00:38
Average standard deviation of split frequencies: 0.010601
410500 -- (-726.273) [-728.649] (-727.085) (-726.293) * (-726.694) [-726.821] (-727.666) (-730.085) -- 0:00:38
411000 -- [-727.435] (-725.802) (-726.994) (-726.024) * (-725.581) (-732.750) [-726.849] (-727.436) -- 0:00:38
411500 -- [-726.554] (-726.043) (-730.575) (-725.475) * [-726.662] (-727.347) (-730.695) (-729.358) -- 0:00:38
412000 -- (-726.769) [-725.682] (-729.376) (-725.412) * (-726.307) [-725.929] (-726.412) (-727.084) -- 0:00:38
412500 -- (-725.960) [-727.042] (-727.488) (-726.335) * (-727.215) (-728.390) (-726.181) [-726.860] -- 0:00:38
413000 -- [-727.313] (-725.563) (-726.082) (-725.492) * (-728.069) (-728.654) [-727.474] (-728.450) -- 0:00:38
413500 -- (-731.471) (-725.849) (-726.898) [-727.571] * (-728.828) (-725.767) (-727.796) [-727.480] -- 0:00:38
414000 -- [-727.590] (-730.621) (-726.060) (-725.812) * (-727.254) (-725.560) (-727.570) [-727.825] -- 0:00:38
414500 -- (-727.970) [-727.437] (-726.006) (-733.813) * (-728.765) (-725.360) (-725.391) [-726.931] -- 0:00:38
415000 -- [-725.842] (-728.037) (-727.475) (-728.376) * (-729.116) [-726.424] (-727.492) (-730.370) -- 0:00:38
Average standard deviation of split frequencies: 0.010665
415500 -- (-727.176) (-729.836) [-728.402] (-727.779) * (-732.009) (-729.545) (-727.867) [-733.160] -- 0:00:37
416000 -- (-729.057) (-727.159) [-732.830] (-728.403) * (-728.877) (-731.273) [-726.435] (-730.980) -- 0:00:37
416500 -- (-729.678) [-727.108] (-729.339) (-725.758) * [-726.453] (-726.873) (-727.217) (-728.584) -- 0:00:37
417000 -- [-727.043] (-726.029) (-729.244) (-727.959) * (-727.576) (-728.981) (-732.422) [-726.947] -- 0:00:37
417500 -- (-727.016) [-726.274] (-730.657) (-727.392) * (-728.868) (-727.354) (-726.802) [-727.131] -- 0:00:37
418000 -- (-730.082) [-726.430] (-728.212) (-726.419) * (-727.304) (-725.604) [-726.965] (-725.825) -- 0:00:37
418500 -- (-728.021) (-730.267) [-726.041] (-726.502) * (-728.260) (-725.896) [-726.303] (-725.421) -- 0:00:37
419000 -- (-726.917) (-729.710) [-725.467] (-727.825) * (-728.277) (-731.433) (-726.420) [-728.919] -- 0:00:37
419500 -- (-725.744) (-729.688) (-727.011) [-725.978] * (-727.391) [-726.353] (-726.939) (-729.230) -- 0:00:37
420000 -- (-727.177) (-728.064) [-727.037] (-726.195) * (-727.426) (-726.535) [-727.456] (-730.510) -- 0:00:37
Average standard deviation of split frequencies: 0.010716
420500 -- (-725.383) (-729.284) [-727.242] (-725.975) * (-726.248) (-725.873) [-725.735] (-728.066) -- 0:00:37
421000 -- (-726.782) [-728.942] (-727.387) (-727.415) * (-727.304) (-728.733) (-726.804) [-727.577] -- 0:00:38
421500 -- (-728.407) (-729.313) (-727.692) [-727.235] * (-728.533) (-729.844) (-729.632) [-726.789] -- 0:00:38
422000 -- (-729.618) (-728.846) [-727.340] (-730.711) * [-726.711] (-727.044) (-730.045) (-731.420) -- 0:00:38
422500 -- [-726.938] (-727.524) (-731.988) (-727.708) * [-728.881] (-728.000) (-725.553) (-733.838) -- 0:00:38
423000 -- (-726.486) (-730.344) (-726.071) [-726.271] * (-730.592) [-726.197] (-725.518) (-731.586) -- 0:00:38
423500 -- [-726.424] (-728.216) (-726.114) (-727.657) * (-727.339) [-725.630] (-727.120) (-726.236) -- 0:00:38
424000 -- (-726.446) (-727.517) (-727.763) [-726.596] * [-727.327] (-725.639) (-733.307) (-728.326) -- 0:00:38
424500 -- (-726.699) (-728.746) (-727.065) [-727.915] * [-726.848] (-726.766) (-730.569) (-726.212) -- 0:00:37
425000 -- [-725.950] (-726.449) (-727.372) (-727.187) * (-730.540) (-726.284) (-726.724) [-726.566] -- 0:00:37
Average standard deviation of split frequencies: 0.010443
425500 -- (-726.922) [-727.869] (-726.679) (-726.224) * (-727.384) [-728.738] (-728.587) (-728.000) -- 0:00:37
426000 -- (-729.289) (-726.553) (-729.170) [-727.568] * (-726.804) (-729.367) [-728.373] (-730.369) -- 0:00:37
426500 -- [-728.518] (-726.189) (-726.334) (-726.573) * [-727.143] (-725.440) (-726.607) (-727.307) -- 0:00:37
427000 -- (-726.580) [-725.970] (-732.727) (-728.958) * [-726.230] (-726.713) (-726.394) (-727.411) -- 0:00:37
427500 -- (-725.863) (-727.181) [-727.869] (-727.217) * [-727.873] (-726.733) (-726.603) (-728.984) -- 0:00:37
428000 -- (-725.610) (-728.036) (-729.918) [-726.140] * [-726.069] (-725.642) (-735.961) (-725.670) -- 0:00:37
428500 -- (-725.562) (-726.760) [-728.007] (-725.707) * (-726.680) [-727.188] (-729.461) (-729.619) -- 0:00:37
429000 -- [-728.313] (-725.349) (-728.865) (-728.984) * [-729.272] (-728.471) (-727.909) (-728.448) -- 0:00:37
429500 -- (-729.736) (-725.087) [-729.716] (-727.631) * (-732.492) (-727.358) [-728.734] (-725.367) -- 0:00:37
430000 -- (-728.636) (-726.350) (-729.583) [-727.145] * [-726.894] (-726.901) (-726.641) (-725.332) -- 0:00:37
Average standard deviation of split frequencies: 0.010330
430500 -- (-729.623) (-726.852) [-726.771] (-726.637) * [-725.390] (-728.142) (-727.569) (-728.436) -- 0:00:37
431000 -- (-727.207) [-725.830] (-726.759) (-736.483) * (-726.552) [-730.000] (-729.356) (-729.572) -- 0:00:36
431500 -- (-727.014) [-730.483] (-728.331) (-728.923) * (-728.175) [-732.790] (-731.734) (-727.118) -- 0:00:36
432000 -- (-726.698) (-726.833) (-729.836) [-727.501] * (-727.861) [-726.356] (-727.034) (-726.785) -- 0:00:36
432500 -- (-726.197) (-727.472) [-726.641] (-728.705) * [-727.934] (-725.209) (-729.036) (-727.461) -- 0:00:36
433000 -- (-725.702) (-729.395) [-726.008] (-727.549) * (-726.726) (-725.454) (-730.703) [-727.558] -- 0:00:36
433500 -- [-727.375] (-726.822) (-727.993) (-730.323) * [-727.810] (-726.207) (-728.797) (-731.588) -- 0:00:36
434000 -- [-727.592] (-729.933) (-726.967) (-729.389) * (-727.021) (-729.413) [-730.950] (-729.390) -- 0:00:36
434500 -- (-728.567) [-725.499] (-725.530) (-730.614) * (-726.499) [-725.922] (-730.727) (-726.443) -- 0:00:36
435000 -- [-727.219] (-726.167) (-729.788) (-729.292) * (-726.457) [-725.823] (-728.482) (-726.812) -- 0:00:36
Average standard deviation of split frequencies: 0.010204
435500 -- (-727.831) (-727.136) [-729.543] (-727.402) * [-727.115] (-728.293) (-726.310) (-728.408) -- 0:00:36
436000 -- [-730.688] (-727.220) (-726.674) (-729.371) * (-726.821) (-729.122) (-728.822) [-727.121] -- 0:00:36
436500 -- [-728.039] (-729.404) (-727.722) (-726.570) * (-726.469) (-729.124) [-730.513] (-727.748) -- 0:00:36
437000 -- (-730.000) [-725.591] (-727.271) (-727.606) * (-726.915) [-729.780] (-731.366) (-726.862) -- 0:00:36
437500 -- (-725.357) (-730.566) (-730.985) [-726.670] * [-725.936] (-728.402) (-728.467) (-727.230) -- 0:00:36
438000 -- (-725.357) [-726.894] (-728.179) (-728.666) * (-727.549) [-727.327] (-726.762) (-728.204) -- 0:00:37
438500 -- (-726.382) (-728.821) (-727.591) [-726.784] * [-727.407] (-728.560) (-727.048) (-726.387) -- 0:00:37
439000 -- [-725.963] (-731.079) (-725.297) (-726.387) * (-728.195) (-727.239) [-727.197] (-728.030) -- 0:00:37
439500 -- [-727.553] (-726.523) (-728.563) (-726.877) * (-730.609) [-726.794] (-727.576) (-726.907) -- 0:00:36
440000 -- [-729.930] (-726.119) (-729.851) (-726.157) * (-726.956) (-726.200) [-728.430] (-726.809) -- 0:00:36
Average standard deviation of split frequencies: 0.010029
440500 -- (-730.366) (-729.363) [-726.633] (-732.016) * [-725.237] (-727.548) (-728.705) (-725.393) -- 0:00:36
441000 -- (-725.767) (-725.814) [-726.447] (-729.646) * (-725.695) [-726.779] (-727.981) (-726.590) -- 0:00:36
441500 -- (-727.266) (-727.146) [-728.554] (-726.185) * [-727.227] (-728.971) (-728.233) (-726.484) -- 0:00:36
442000 -- [-727.860] (-728.680) (-728.263) (-727.343) * (-729.447) [-729.260] (-726.673) (-730.572) -- 0:00:36
442500 -- [-726.716] (-728.141) (-728.177) (-725.646) * (-727.622) [-726.220] (-729.448) (-733.379) -- 0:00:36
443000 -- (-727.902) (-726.856) [-725.398] (-733.095) * (-730.714) [-727.494] (-729.346) (-729.267) -- 0:00:36
443500 -- (-729.617) (-727.004) [-725.522] (-729.250) * (-728.837) (-726.990) [-729.465] (-731.687) -- 0:00:36
444000 -- (-726.551) (-729.086) [-728.014] (-728.748) * (-730.655) [-726.479] (-727.738) (-731.328) -- 0:00:36
444500 -- [-725.691] (-726.334) (-726.347) (-727.387) * (-731.626) [-730.305] (-727.221) (-730.242) -- 0:00:36
445000 -- [-727.198] (-727.823) (-726.539) (-728.468) * (-727.829) (-727.389) [-727.435] (-729.015) -- 0:00:36
Average standard deviation of split frequencies: 0.010041
445500 -- [-727.505] (-730.407) (-726.261) (-726.165) * [-725.757] (-725.973) (-727.556) (-728.345) -- 0:00:36
446000 -- [-727.080] (-729.747) (-728.116) (-728.072) * (-727.214) (-729.272) [-727.399] (-727.344) -- 0:00:36
446500 -- (-728.045) (-730.294) [-728.113] (-725.672) * (-727.281) [-725.449] (-725.228) (-728.175) -- 0:00:35
447000 -- (-726.695) [-728.002] (-725.637) (-725.992) * [-726.133] (-725.926) (-725.650) (-725.796) -- 0:00:35
447500 -- (-726.036) (-727.396) [-726.558] (-731.987) * (-727.757) (-726.573) (-725.661) [-725.601] -- 0:00:35
448000 -- (-726.839) (-728.204) (-730.041) [-730.859] * (-726.877) (-729.617) (-725.864) [-730.760] -- 0:00:35
448500 -- (-726.306) (-726.859) (-727.497) [-727.296] * (-725.881) (-727.537) [-728.268] (-726.773) -- 0:00:35
449000 -- (-728.776) [-728.286] (-728.751) (-726.694) * [-728.636] (-727.214) (-727.638) (-726.513) -- 0:00:35
449500 -- (-728.984) (-727.953) (-726.728) [-726.682] * (-729.836) (-727.887) (-726.304) [-727.558] -- 0:00:35
450000 -- (-726.780) (-727.073) [-732.774] (-728.149) * (-728.843) [-728.831] (-726.134) (-726.050) -- 0:00:35
Average standard deviation of split frequencies: 0.010003
450500 -- (-727.221) (-732.320) [-727.373] (-726.991) * (-728.171) [-726.091] (-725.506) (-726.003) -- 0:00:35
451000 -- (-726.822) (-725.847) (-726.759) [-729.177] * (-727.290) [-726.105] (-728.622) (-727.844) -- 0:00:35
451500 -- (-727.847) (-726.097) (-726.651) [-726.381] * [-726.358] (-726.754) (-730.305) (-728.672) -- 0:00:35
452000 -- (-728.439) (-725.385) (-730.685) [-727.187] * (-726.820) [-728.104] (-731.710) (-728.837) -- 0:00:35
452500 -- [-731.240] (-727.356) (-727.896) (-726.007) * (-726.554) (-729.628) [-725.615] (-728.797) -- 0:00:35
453000 -- [-729.623] (-725.664) (-729.110) (-726.463) * (-728.025) (-733.940) [-725.776] (-730.162) -- 0:00:35
453500 -- (-728.503) [-726.840] (-727.795) (-727.964) * [-728.807] (-730.498) (-734.101) (-726.186) -- 0:00:34
454000 -- (-726.193) [-725.954] (-729.289) (-729.141) * (-726.781) (-725.789) [-725.993] (-727.906) -- 0:00:34
454500 -- (-727.533) [-725.825] (-727.500) (-727.810) * [-725.895] (-726.712) (-726.735) (-727.485) -- 0:00:36
455000 -- (-727.710) (-726.411) (-726.908) [-728.732] * (-725.793) (-726.658) (-725.696) [-726.243] -- 0:00:35
Average standard deviation of split frequencies: 0.010034
455500 -- (-727.059) (-727.438) (-727.213) [-729.169] * (-727.562) (-726.009) [-726.500] (-726.246) -- 0:00:35
456000 -- (-730.454) [-728.254] (-725.146) (-729.699) * (-728.890) (-725.558) [-726.208] (-726.516) -- 0:00:35
456500 -- (-729.652) [-726.076] (-725.163) (-727.689) * (-727.943) (-725.786) (-726.044) [-728.145] -- 0:00:35
457000 -- (-732.414) [-726.871] (-729.563) (-728.083) * [-726.206] (-727.613) (-726.262) (-728.870) -- 0:00:35
457500 -- (-727.063) (-726.832) (-726.965) [-727.421] * [-725.375] (-726.101) (-729.395) (-728.051) -- 0:00:35
458000 -- (-728.660) (-728.341) [-725.755] (-728.695) * (-728.008) [-728.990] (-728.742) (-729.927) -- 0:00:35
458500 -- (-727.343) (-727.760) [-725.802] (-726.375) * (-726.515) [-726.578] (-732.703) (-727.346) -- 0:00:35
459000 -- (-726.142) (-726.061) (-729.213) [-727.008] * (-725.594) [-725.735] (-726.961) (-725.208) -- 0:00:35
459500 -- [-726.615] (-730.445) (-727.575) (-729.736) * (-727.428) [-727.029] (-726.135) (-725.077) -- 0:00:35
460000 -- (-726.131) [-732.498] (-726.241) (-729.385) * (-727.772) (-726.050) (-726.032) [-725.772] -- 0:00:35
Average standard deviation of split frequencies: 0.009390
460500 -- (-725.765) (-728.843) [-725.851] (-725.891) * (-728.814) (-726.832) [-725.587] (-725.287) -- 0:00:35
461000 -- (-731.431) (-727.870) [-727.147] (-726.213) * (-729.491) (-726.750) [-726.355] (-725.551) -- 0:00:35
461500 -- (-727.155) [-726.207] (-727.872) (-726.259) * (-728.000) [-727.135] (-727.793) (-725.612) -- 0:00:35
462000 -- [-732.896] (-726.191) (-726.344) (-726.743) * (-727.990) (-726.365) [-725.716] (-725.677) -- 0:00:34
462500 -- (-732.757) [-725.827] (-728.632) (-727.617) * (-728.739) (-726.873) [-725.446] (-728.503) -- 0:00:34
463000 -- (-728.182) [-726.570] (-727.652) (-725.861) * (-725.840) (-725.684) (-733.133) [-728.446] -- 0:00:34
463500 -- (-734.035) (-731.099) (-728.080) [-728.982] * (-727.608) [-729.076] (-727.227) (-727.166) -- 0:00:34
464000 -- (-731.081) [-729.989] (-729.554) (-729.189) * [-726.794] (-729.521) (-725.670) (-730.261) -- 0:00:34
464500 -- [-728.470] (-731.429) (-726.438) (-727.192) * (-726.864) [-727.023] (-725.945) (-727.958) -- 0:00:34
465000 -- (-727.881) (-729.854) (-726.278) [-726.451] * [-727.884] (-728.764) (-728.427) (-729.738) -- 0:00:34
Average standard deviation of split frequencies: 0.009402
465500 -- (-728.704) [-733.040] (-726.965) (-729.263) * (-727.889) [-727.743] (-728.124) (-728.551) -- 0:00:34
466000 -- (-726.869) (-730.047) (-727.249) [-730.521] * (-735.672) [-727.405] (-728.269) (-726.048) -- 0:00:34
466500 -- (-731.524) (-726.585) [-727.325] (-729.412) * (-728.475) (-727.725) [-727.370] (-725.704) -- 0:00:34
467000 -- (-726.492) [-726.632] (-728.217) (-731.862) * (-727.917) [-727.464] (-729.672) (-725.399) -- 0:00:34
467500 -- (-726.884) (-729.194) (-726.330) [-726.884] * [-726.684] (-728.371) (-729.875) (-725.409) -- 0:00:34
468000 -- [-727.590] (-726.799) (-726.817) (-727.481) * [-728.506] (-726.132) (-727.668) (-725.409) -- 0:00:34
468500 -- [-727.003] (-729.824) (-726.634) (-725.351) * [-726.792] (-726.803) (-726.921) (-726.223) -- 0:00:34
469000 -- [-727.825] (-725.932) (-726.489) (-726.007) * (-728.608) (-726.307) [-727.528] (-727.853) -- 0:00:33
469500 -- (-726.203) (-725.568) [-731.304] (-726.726) * (-730.809) (-726.075) (-726.678) [-728.840] -- 0:00:33
470000 -- (-731.284) (-726.295) [-727.848] (-727.945) * [-726.294] (-727.136) (-731.466) (-729.566) -- 0:00:33
Average standard deviation of split frequencies: 0.008720
470500 -- (-728.558) (-728.527) (-729.807) [-727.138] * [-730.849] (-727.514) (-734.847) (-729.321) -- 0:00:33
471000 -- (-727.049) (-728.189) [-729.403] (-726.103) * [-726.264] (-727.024) (-729.307) (-731.394) -- 0:00:33
471500 -- (-727.729) [-727.179] (-727.794) (-733.779) * (-726.300) (-726.740) (-728.449) [-726.338] -- 0:00:34
472000 -- (-726.527) (-727.879) [-728.789] (-730.554) * (-725.815) [-725.984] (-728.110) (-727.952) -- 0:00:34
472500 -- (-726.879) [-726.962] (-726.776) (-726.478) * [-727.332] (-727.597) (-726.807) (-729.085) -- 0:00:34
473000 -- (-729.074) (-728.163) (-733.235) [-728.197] * (-727.613) [-727.845] (-729.446) (-728.157) -- 0:00:34
473500 -- (-726.755) (-728.067) (-732.671) [-726.622] * [-726.254] (-728.385) (-728.536) (-730.320) -- 0:00:34
474000 -- [-728.678] (-728.910) (-729.165) (-727.715) * (-726.717) [-727.276] (-725.206) (-730.657) -- 0:00:34
474500 -- (-726.709) [-726.488] (-727.775) (-729.880) * [-726.583] (-730.732) (-726.871) (-726.273) -- 0:00:34
475000 -- (-727.164) [-727.235] (-728.749) (-725.198) * [-726.638] (-726.811) (-726.024) (-727.069) -- 0:00:34
Average standard deviation of split frequencies: 0.008738
475500 -- (-729.421) (-729.167) [-730.006] (-725.556) * [-730.672] (-727.301) (-726.148) (-727.872) -- 0:00:34
476000 -- [-725.596] (-729.425) (-727.860) (-727.295) * (-728.313) (-731.558) [-725.469] (-725.917) -- 0:00:34
476500 -- (-726.979) [-728.186] (-727.411) (-727.939) * [-732.654] (-728.055) (-728.368) (-725.462) -- 0:00:34
477000 -- (-725.983) [-727.836] (-726.365) (-727.735) * (-728.212) (-729.139) [-726.980] (-729.721) -- 0:00:33
477500 -- (-726.880) [-727.091] (-727.288) (-730.035) * [-729.413] (-728.717) (-728.066) (-729.941) -- 0:00:33
478000 -- [-725.800] (-731.794) (-728.934) (-729.056) * (-731.852) [-727.443] (-726.556) (-728.733) -- 0:00:33
478500 -- (-725.962) (-729.813) [-728.088] (-727.513) * [-725.819] (-730.287) (-727.728) (-731.519) -- 0:00:33
479000 -- (-727.864) (-727.070) (-727.641) [-728.465] * (-725.627) (-734.993) (-728.962) [-727.547] -- 0:00:33
479500 -- (-726.160) (-729.020) [-727.247] (-727.907) * (-726.314) [-727.426] (-729.600) (-728.254) -- 0:00:33
480000 -- (-734.374) [-726.340] (-729.125) (-726.222) * (-729.326) (-725.879) (-727.069) [-727.473] -- 0:00:33
Average standard deviation of split frequencies: 0.009057
480500 -- (-727.997) (-727.212) [-731.283] (-725.342) * (-731.781) (-726.826) [-725.470] (-726.416) -- 0:00:33
481000 -- [-727.581] (-726.123) (-728.598) (-727.169) * (-728.836) (-726.692) (-725.498) [-726.141] -- 0:00:33
481500 -- (-728.207) [-731.296] (-730.327) (-727.436) * (-730.473) (-725.877) (-725.902) [-726.631] -- 0:00:33
482000 -- (-729.507) (-728.709) (-728.138) [-725.548] * [-730.577] (-730.308) (-726.009) (-725.314) -- 0:00:33
482500 -- (-726.627) [-726.563] (-728.059) (-727.141) * (-728.151) [-726.734] (-729.341) (-725.152) -- 0:00:33
483000 -- [-726.764] (-725.408) (-728.070) (-726.787) * (-727.153) [-726.620] (-728.567) (-727.322) -- 0:00:33
483500 -- (-725.914) (-731.239) [-726.949] (-728.738) * [-726.743] (-727.036) (-727.224) (-725.825) -- 0:00:33
484000 -- (-727.510) [-733.119] (-730.807) (-727.858) * (-726.660) (-727.416) (-727.911) [-727.446] -- 0:00:33
484500 -- (-725.222) (-726.535) [-725.454] (-726.798) * [-726.009] (-726.623) (-726.841) (-728.585) -- 0:00:32
485000 -- (-727.622) (-727.439) (-726.785) [-726.888] * (-729.929) (-727.757) [-727.231] (-728.924) -- 0:00:32
Average standard deviation of split frequencies: 0.008730
485500 -- (-727.610) [-727.859] (-728.647) (-726.769) * (-726.150) (-728.791) (-726.544) [-728.890] -- 0:00:32
486000 -- (-730.528) (-729.872) [-732.821] (-730.185) * (-727.983) [-727.695] (-726.336) (-729.639) -- 0:00:32
486500 -- [-730.400] (-728.509) (-729.612) (-726.965) * (-726.802) [-727.291] (-727.857) (-726.144) -- 0:00:32
487000 -- (-726.420) (-725.991) (-731.242) [-727.271] * (-726.009) (-727.636) (-726.691) [-729.747] -- 0:00:32
487500 -- (-731.759) (-727.862) [-726.258] (-729.602) * (-731.499) (-726.741) (-732.389) [-727.523] -- 0:00:32
488000 -- [-726.591] (-727.840) (-726.580) (-728.461) * [-726.365] (-725.864) (-732.342) (-726.735) -- 0:00:32
488500 -- (-728.346) (-726.007) [-726.678] (-728.611) * (-726.290) (-725.840) (-728.691) [-726.458] -- 0:00:33
489000 -- (-727.664) [-727.848] (-727.186) (-728.435) * (-728.151) (-729.344) [-727.462] (-725.712) -- 0:00:33
489500 -- (-728.762) (-728.836) [-727.426] (-728.760) * (-726.625) (-728.175) [-725.844] (-729.276) -- 0:00:33
490000 -- [-727.275] (-728.872) (-727.316) (-727.272) * (-725.846) [-729.213] (-726.898) (-728.897) -- 0:00:33
Average standard deviation of split frequencies: 0.009099
490500 -- (-728.222) (-730.254) (-726.930) [-726.406] * (-727.520) (-726.386) [-727.682] (-728.238) -- 0:00:33
491000 -- [-728.485] (-725.545) (-726.847) (-725.143) * (-727.337) [-727.455] (-730.517) (-727.469) -- 0:00:33
491500 -- (-728.063) [-728.447] (-732.478) (-727.370) * (-727.478) (-726.280) (-728.530) [-729.113] -- 0:00:33
492000 -- (-727.138) [-727.722] (-727.801) (-725.851) * [-727.071] (-726.533) (-726.016) (-727.226) -- 0:00:33
492500 -- (-726.810) (-725.544) [-731.384] (-726.808) * (-727.591) (-728.648) (-727.340) [-725.876] -- 0:00:32
493000 -- (-729.117) [-728.462] (-729.258) (-725.583) * [-732.878] (-725.801) (-728.011) (-727.231) -- 0:00:32
493500 -- (-727.679) (-726.110) [-727.303] (-725.975) * (-725.424) (-726.820) (-728.990) [-730.492] -- 0:00:32
494000 -- (-730.092) [-725.970] (-728.962) (-726.053) * [-726.368] (-725.435) (-726.190) (-729.800) -- 0:00:32
494500 -- (-728.437) (-730.616) (-725.887) [-729.048] * (-726.291) (-727.608) (-727.293) [-726.126] -- 0:00:32
495000 -- (-728.365) (-730.176) (-727.620) [-727.075] * (-728.148) (-730.417) (-729.149) [-726.266] -- 0:00:32
Average standard deviation of split frequencies: 0.008744
495500 -- (-731.984) (-728.648) (-732.066) [-726.799] * [-728.754] (-727.767) (-727.047) (-726.343) -- 0:00:32
496000 -- (-730.907) [-729.521] (-728.729) (-726.142) * [-727.360] (-726.736) (-729.160) (-726.391) -- 0:00:32
496500 -- (-728.315) [-727.189] (-725.534) (-728.317) * (-726.919) [-726.784] (-727.226) (-727.463) -- 0:00:32
497000 -- (-726.785) [-726.818] (-726.784) (-729.918) * (-729.725) [-726.357] (-726.427) (-729.276) -- 0:00:32
497500 -- (-728.661) (-730.169) (-728.013) [-726.902] * (-735.387) (-726.234) [-729.515] (-731.653) -- 0:00:32
498000 -- [-727.276] (-729.630) (-726.259) (-727.850) * [-730.377] (-726.960) (-728.051) (-731.004) -- 0:00:32
498500 -- [-726.569] (-727.742) (-728.818) (-728.564) * (-729.897) [-729.121] (-730.666) (-727.546) -- 0:00:32
499000 -- [-726.186] (-726.381) (-728.144) (-725.731) * [-727.426] (-726.499) (-726.248) (-727.352) -- 0:00:32
499500 -- (-729.153) (-727.737) (-727.381) [-725.715] * (-729.088) (-729.289) (-726.615) [-725.979] -- 0:00:32
500000 -- (-728.385) [-725.741] (-729.959) (-727.528) * (-729.894) (-730.024) (-727.890) [-727.677] -- 0:00:32
Average standard deviation of split frequencies: 0.008662
500500 -- (-736.258) (-727.948) (-725.709) [-725.919] * (-733.097) [-726.954] (-727.986) (-725.928) -- 0:00:31
501000 -- [-730.816] (-725.550) (-729.067) (-729.794) * (-733.210) [-726.700] (-726.711) (-731.037) -- 0:00:31
501500 -- (-729.705) (-727.220) [-728.073] (-729.406) * [-727.423] (-729.093) (-725.650) (-727.591) -- 0:00:31
502000 -- (-726.013) (-726.546) [-727.520] (-730.384) * (-727.484) (-728.018) (-727.821) [-731.262] -- 0:00:31
502500 -- (-725.791) (-728.666) [-726.849] (-729.369) * (-727.315) [-725.695] (-727.503) (-725.894) -- 0:00:31
503000 -- (-727.545) (-729.936) [-727.347] (-726.511) * (-728.576) [-727.283] (-729.651) (-725.825) -- 0:00:31
503500 -- (-725.726) (-727.986) (-729.279) [-726.344] * [-726.051] (-735.952) (-728.242) (-726.846) -- 0:00:31
504000 -- (-727.043) (-726.767) (-729.554) [-728.982] * (-726.849) [-729.430] (-725.597) (-730.016) -- 0:00:31
504500 -- (-727.224) (-725.624) (-726.848) [-730.576] * (-726.605) [-726.592] (-726.820) (-731.407) -- 0:00:31
505000 -- [-728.282] (-726.822) (-728.651) (-728.090) * (-727.289) (-727.636) (-727.422) [-726.226] -- 0:00:31
Average standard deviation of split frequencies: 0.008768
505500 -- (-726.494) (-726.909) [-729.336] (-727.519) * (-729.392) (-730.080) (-726.554) [-725.672] -- 0:00:32
506000 -- [-727.584] (-728.336) (-726.629) (-725.600) * [-726.304] (-725.053) (-727.374) (-726.226) -- 0:00:32
506500 -- (-727.232) [-727.011] (-726.754) (-728.292) * (-727.091) [-729.146] (-728.506) (-725.905) -- 0:00:32
507000 -- (-734.940) (-728.565) (-726.195) [-727.165] * (-729.745) (-731.061) (-733.725) [-727.866] -- 0:00:32
507500 -- (-726.720) [-726.965] (-725.929) (-726.216) * (-731.300) [-728.957] (-727.316) (-727.527) -- 0:00:32
508000 -- (-726.124) [-725.686] (-728.369) (-726.400) * (-725.357) (-728.307) (-726.568) [-727.348] -- 0:00:31
508500 -- [-725.704] (-725.995) (-727.244) (-728.652) * (-727.562) [-726.690] (-725.726) (-731.058) -- 0:00:31
509000 -- (-726.109) (-727.374) [-725.568] (-731.304) * (-727.318) [-726.110] (-727.621) (-728.410) -- 0:00:31
509500 -- (-725.900) (-728.665) (-725.597) [-727.609] * (-726.636) [-727.626] (-727.563) (-726.035) -- 0:00:31
510000 -- [-727.056] (-726.350) (-728.359) (-726.755) * (-730.809) (-728.037) (-726.756) [-728.534] -- 0:00:31
Average standard deviation of split frequencies: 0.008943
510500 -- (-727.761) (-728.333) [-726.196] (-728.254) * (-731.228) [-727.265] (-726.990) (-727.980) -- 0:00:31
511000 -- (-726.942) (-727.064) (-729.640) [-727.334] * (-731.270) (-726.395) [-725.945] (-726.136) -- 0:00:31
511500 -- [-725.825] (-726.603) (-726.629) (-727.033) * [-728.362] (-726.369) (-726.642) (-732.451) -- 0:00:31
512000 -- (-727.993) [-727.720] (-726.175) (-726.931) * (-733.742) (-725.736) (-727.260) [-728.009] -- 0:00:31
512500 -- [-725.377] (-726.817) (-728.766) (-731.395) * [-726.013] (-725.790) (-729.359) (-727.605) -- 0:00:31
513000 -- (-725.617) (-726.616) [-727.080] (-728.382) * (-730.385) (-728.221) [-727.568] (-726.332) -- 0:00:31
513500 -- [-727.211] (-725.586) (-725.925) (-728.618) * (-727.582) (-729.301) (-727.763) [-727.853] -- 0:00:31
514000 -- [-729.551] (-727.045) (-725.896) (-725.832) * [-726.012] (-729.729) (-727.672) (-727.068) -- 0:00:31
514500 -- [-728.378] (-727.110) (-732.713) (-728.118) * [-728.448] (-731.509) (-727.506) (-728.796) -- 0:00:31
515000 -- (-727.472) (-727.738) (-726.702) [-726.363] * (-726.568) [-729.285] (-726.394) (-726.537) -- 0:00:31
Average standard deviation of split frequencies: 0.008279
515500 -- (-726.614) (-728.849) (-728.115) [-727.239] * [-725.937] (-729.342) (-726.544) (-727.443) -- 0:00:31
516000 -- (-727.449) (-727.569) (-732.164) [-726.343] * (-727.131) [-727.947] (-728.024) (-726.039) -- 0:00:30
516500 -- [-728.961] (-728.108) (-734.474) (-726.168) * (-729.393) (-728.853) [-731.072] (-727.259) -- 0:00:30
517000 -- (-728.019) [-725.964] (-733.063) (-726.161) * [-725.943] (-725.702) (-727.715) (-727.377) -- 0:00:30
517500 -- (-726.284) [-726.434] (-730.838) (-725.212) * (-726.206) (-725.708) [-726.518] (-727.041) -- 0:00:30
518000 -- (-727.160) (-726.127) (-730.941) [-725.651] * (-728.720) (-728.111) [-730.313] (-725.187) -- 0:00:30
518500 -- [-729.412] (-729.427) (-725.835) (-725.161) * (-726.134) (-725.831) [-728.576] (-729.428) -- 0:00:30
519000 -- (-731.159) [-730.992] (-728.450) (-725.484) * (-726.064) [-726.738] (-730.669) (-728.725) -- 0:00:30
519500 -- (-727.821) (-725.708) [-725.163] (-733.503) * (-727.561) (-726.190) (-727.337) [-725.880] -- 0:00:30
520000 -- (-727.925) [-725.874] (-728.759) (-725.519) * (-726.125) (-726.466) [-726.931] (-726.623) -- 0:00:30
Average standard deviation of split frequencies: 0.008714
520500 -- (-727.649) [-725.978] (-728.268) (-735.112) * [-727.524] (-727.243) (-726.300) (-728.926) -- 0:00:30
521000 -- (-727.970) [-726.399] (-726.962) (-728.856) * (-729.579) [-727.707] (-726.188) (-727.377) -- 0:00:30
521500 -- (-729.379) (-725.513) [-731.478] (-727.404) * (-728.114) (-733.913) [-725.254] (-725.870) -- 0:00:30
522000 -- [-727.737] (-728.933) (-730.633) (-727.714) * (-726.516) [-728.439] (-725.224) (-726.165) -- 0:00:31
522500 -- [-727.970] (-734.884) (-727.273) (-726.833) * (-726.506) [-726.741] (-727.609) (-728.367) -- 0:00:31
523000 -- (-727.665) (-729.428) [-727.132] (-725.616) * [-728.223] (-727.322) (-727.865) (-726.266) -- 0:00:31
523500 -- (-727.961) [-725.846] (-726.421) (-730.755) * [-726.489] (-730.413) (-726.990) (-726.762) -- 0:00:30
524000 -- (-731.320) (-728.479) (-727.712) [-726.653] * [-725.949] (-727.547) (-728.092) (-729.823) -- 0:00:30
524500 -- (-729.197) (-729.463) [-726.091] (-725.831) * (-726.779) (-731.258) (-731.324) [-728.830] -- 0:00:30
525000 -- (-729.197) (-729.612) (-727.738) [-726.313] * (-727.466) (-726.287) (-726.835) [-728.246] -- 0:00:30
Average standard deviation of split frequencies: 0.008402
525500 -- (-727.154) (-727.382) [-727.011] (-728.228) * (-727.287) (-729.138) [-727.723] (-725.595) -- 0:00:30
526000 -- [-727.487] (-727.403) (-726.776) (-727.127) * [-727.316] (-727.084) (-730.078) (-728.963) -- 0:00:30
526500 -- (-729.036) (-726.411) [-726.084] (-726.689) * (-726.744) (-728.675) (-728.995) [-725.517] -- 0:00:30
527000 -- (-731.957) (-726.322) (-727.052) [-726.480] * [-726.256] (-729.745) (-726.986) (-732.100) -- 0:00:30
527500 -- (-726.786) (-729.691) [-727.131] (-726.600) * [-726.187] (-731.661) (-727.609) (-726.989) -- 0:00:30
528000 -- (-727.081) [-725.906] (-729.611) (-726.061) * (-726.239) [-733.290] (-725.521) (-727.893) -- 0:00:30
528500 -- (-727.852) [-725.764] (-729.981) (-728.273) * [-727.523] (-729.755) (-726.523) (-725.415) -- 0:00:30
529000 -- [-726.151] (-727.175) (-727.358) (-725.995) * (-728.212) [-728.986] (-730.230) (-730.056) -- 0:00:30
529500 -- (-726.328) (-726.073) [-726.705] (-727.370) * (-726.111) [-726.270] (-728.341) (-732.599) -- 0:00:30
530000 -- (-726.172) (-727.869) (-727.219) [-731.161] * (-725.883) [-727.262] (-727.017) (-727.324) -- 0:00:30
Average standard deviation of split frequencies: 0.008606
530500 -- [-727.199] (-725.918) (-728.323) (-730.196) * (-727.412) (-726.886) (-726.615) [-725.807] -- 0:00:30
531000 -- (-728.843) (-731.184) (-728.594) [-726.890] * (-727.355) [-726.294] (-729.883) (-726.786) -- 0:00:30
531500 -- (-728.925) (-728.333) [-726.680] (-725.691) * [-725.872] (-727.834) (-725.956) (-725.742) -- 0:00:29
532000 -- (-727.600) [-729.135] (-725.829) (-730.120) * (-730.558) (-726.712) [-727.464] (-729.264) -- 0:00:29
532500 -- (-729.789) (-729.104) [-726.915] (-728.275) * [-726.678] (-730.014) (-726.565) (-728.348) -- 0:00:29
533000 -- [-731.408] (-728.644) (-726.942) (-726.052) * (-729.912) [-726.861] (-727.649) (-726.514) -- 0:00:29
533500 -- (-729.282) (-726.366) (-726.416) [-727.092] * (-728.830) (-725.726) (-727.896) [-726.890] -- 0:00:29
534000 -- (-727.103) (-726.095) (-727.211) [-729.482] * (-728.763) [-725.806] (-725.925) (-727.507) -- 0:00:29
534500 -- (-726.629) [-727.327] (-727.028) (-729.458) * (-727.564) (-732.390) [-725.823] (-728.664) -- 0:00:29
535000 -- (-727.817) [-728.078] (-729.731) (-730.408) * (-727.000) (-731.502) [-727.430] (-727.439) -- 0:00:29
Average standard deviation of split frequencies: 0.008850
535500 -- (-725.886) [-726.069] (-727.693) (-726.917) * [-725.874] (-727.961) (-727.662) (-729.242) -- 0:00:29
536000 -- (-726.881) [-728.703] (-730.043) (-726.926) * [-727.194] (-729.589) (-729.297) (-728.466) -- 0:00:29
536500 -- (-727.377) (-731.267) (-729.783) [-728.983] * [-726.312] (-728.792) (-726.850) (-727.048) -- 0:00:29
537000 -- (-731.402) (-732.703) (-728.347) [-727.239] * (-725.557) [-731.458] (-726.630) (-726.087) -- 0:00:29
537500 -- [-727.453] (-730.471) (-730.452) (-725.856) * (-728.736) (-732.982) (-728.395) [-726.514] -- 0:00:29
538000 -- (-730.913) (-729.516) [-726.911] (-726.376) * (-726.454) (-732.155) (-727.938) [-727.850] -- 0:00:29
538500 -- [-727.096] (-728.076) (-728.889) (-730.244) * (-733.576) (-729.175) [-726.004] (-726.308) -- 0:00:29
539000 -- (-727.247) [-728.889] (-727.971) (-730.147) * (-732.367) (-729.713) [-726.565] (-727.187) -- 0:00:29
539500 -- (-727.870) (-728.330) [-729.266] (-728.505) * (-731.319) (-727.422) [-726.358] (-727.679) -- 0:00:29
540000 -- [-729.528] (-729.254) (-726.055) (-726.050) * (-726.382) (-726.950) [-726.582] (-725.655) -- 0:00:29
Average standard deviation of split frequencies: 0.008773
540500 -- (-732.261) (-727.753) [-725.531] (-726.884) * (-728.062) (-726.788) (-727.127) [-726.361] -- 0:00:29
541000 -- (-726.885) [-729.898] (-730.170) (-726.664) * (-726.614) (-728.654) [-727.104] (-727.589) -- 0:00:29
541500 -- [-727.546] (-732.517) (-726.685) (-731.170) * [-727.574] (-734.457) (-727.939) (-727.030) -- 0:00:29
542000 -- (-728.691) [-726.648] (-728.048) (-728.055) * (-726.269) (-725.513) (-725.288) [-729.365] -- 0:00:29
542500 -- (-729.254) [-726.870] (-728.088) (-728.139) * (-732.013) (-727.164) [-730.155] (-726.842) -- 0:00:29
543000 -- [-728.270] (-725.684) (-728.947) (-728.178) * (-730.376) (-728.986) [-731.186] (-730.777) -- 0:00:29
543500 -- [-730.261] (-727.336) (-729.124) (-733.391) * (-734.200) (-728.014) (-727.949) [-731.501] -- 0:00:29
544000 -- [-727.597] (-725.882) (-726.972) (-730.912) * (-726.146) [-725.763] (-730.848) (-731.667) -- 0:00:29
544500 -- [-726.964] (-726.820) (-730.097) (-730.730) * (-730.875) (-726.302) [-728.709] (-726.763) -- 0:00:29
545000 -- [-727.352] (-728.888) (-727.802) (-728.402) * [-726.520] (-725.376) (-728.002) (-726.170) -- 0:00:29
Average standard deviation of split frequencies: 0.009065
545500 -- (-727.513) (-728.679) [-727.733] (-725.810) * (-735.762) (-726.517) (-728.960) [-728.441] -- 0:00:29
546000 -- (-728.244) (-726.391) (-726.778) [-729.490] * (-732.123) (-731.303) (-729.908) [-725.972] -- 0:00:29
546500 -- (-728.730) (-727.183) [-726.175] (-728.216) * (-731.906) (-725.624) [-728.827] (-729.900) -- 0:00:29
547000 -- [-726.468] (-730.752) (-730.679) (-726.992) * (-726.112) (-727.896) [-728.047] (-726.288) -- 0:00:28
547500 -- (-726.629) (-729.534) [-727.839] (-727.599) * (-729.689) (-728.844) [-725.688] (-732.482) -- 0:00:28
548000 -- (-727.958) (-731.227) (-726.928) [-726.757] * (-728.218) (-725.321) (-725.699) [-727.789] -- 0:00:28
548500 -- (-727.963) [-727.319] (-726.032) (-725.372) * (-726.835) (-727.064) [-725.831] (-726.495) -- 0:00:28
549000 -- (-732.185) (-729.544) (-727.608) [-728.661] * (-726.550) [-728.260] (-727.152) (-727.463) -- 0:00:28
549500 -- [-731.173] (-731.305) (-726.534) (-725.450) * [-725.329] (-729.218) (-731.692) (-727.662) -- 0:00:28
550000 -- (-728.828) [-727.567] (-728.628) (-725.479) * [-725.445] (-726.420) (-729.953) (-728.222) -- 0:00:28
Average standard deviation of split frequencies: 0.008989
550500 -- [-729.821] (-730.914) (-728.687) (-726.677) * (-726.601) [-726.186] (-728.636) (-726.828) -- 0:00:28
551000 -- [-730.498] (-727.632) (-733.596) (-726.501) * (-728.404) (-728.236) (-727.104) [-727.855] -- 0:00:28
551500 -- (-725.903) (-732.395) (-730.560) [-726.092] * [-728.411] (-726.709) (-728.436) (-727.323) -- 0:00:28
552000 -- (-726.579) (-728.727) (-729.424) [-725.440] * [-727.782] (-729.407) (-726.471) (-725.243) -- 0:00:28
552500 -- [-731.040] (-728.752) (-727.125) (-729.368) * [-726.402] (-726.711) (-727.601) (-728.897) -- 0:00:28
553000 -- (-727.692) (-727.806) [-727.010] (-729.496) * (-727.478) (-727.153) (-733.994) [-727.687] -- 0:00:28
553500 -- [-727.191] (-731.114) (-726.866) (-729.497) * [-727.118] (-728.252) (-726.544) (-731.150) -- 0:00:28
554000 -- (-730.408) [-725.784] (-729.543) (-726.070) * [-726.993] (-728.313) (-726.346) (-729.912) -- 0:00:28
554500 -- (-726.716) [-725.833] (-726.565) (-727.247) * (-729.978) [-726.959] (-726.883) (-730.908) -- 0:00:28
555000 -- [-726.721] (-727.443) (-728.685) (-726.662) * (-729.700) [-727.520] (-728.805) (-729.705) -- 0:00:28
Average standard deviation of split frequencies: 0.008478
555500 -- (-727.175) [-726.420] (-728.933) (-727.217) * (-730.033) (-726.599) (-730.066) [-728.654] -- 0:00:28
556000 -- (-726.215) (-728.050) [-730.241] (-725.703) * [-725.860] (-726.731) (-733.219) (-729.479) -- 0:00:28
556500 -- (-726.483) (-730.403) (-729.639) [-725.751] * [-726.255] (-729.931) (-727.435) (-731.286) -- 0:00:28
557000 -- (-727.798) (-729.197) (-726.146) [-725.493] * (-726.468) [-728.392] (-725.815) (-731.751) -- 0:00:28
557500 -- (-726.170) (-726.918) [-725.967] (-732.501) * (-727.849) [-727.170] (-726.153) (-726.470) -- 0:00:28
558000 -- (-725.433) (-727.751) [-725.900] (-726.208) * (-726.306) (-726.699) (-727.384) [-727.745] -- 0:00:28
558500 -- (-728.619) (-725.926) (-725.000) [-726.798] * (-727.658) [-726.364] (-726.095) (-725.918) -- 0:00:28
559000 -- (-727.566) [-726.387] (-729.336) (-728.863) * [-728.184] (-726.773) (-726.621) (-728.076) -- 0:00:28
559500 -- (-729.206) [-727.153] (-727.515) (-730.020) * (-729.970) (-729.609) (-728.529) [-728.733] -- 0:00:28
560000 -- (-729.553) (-728.242) [-726.311] (-727.654) * [-727.064] (-729.320) (-727.444) (-727.534) -- 0:00:28
Average standard deviation of split frequencies: 0.008093
560500 -- (-727.042) [-726.188] (-726.308) (-726.033) * (-725.775) (-727.939) [-727.140] (-731.141) -- 0:00:28
561000 -- [-727.107] (-725.435) (-725.602) (-731.084) * [-725.721] (-730.384) (-726.964) (-730.311) -- 0:00:28
561500 -- (-728.343) (-727.563) (-726.985) [-727.534] * (-732.153) (-729.618) (-728.674) [-726.534] -- 0:00:28
562000 -- (-726.694) (-729.242) (-728.083) [-726.944] * (-728.694) (-727.780) [-726.054] (-729.948) -- 0:00:28
562500 -- [-726.738] (-730.089) (-729.631) (-726.199) * (-726.983) (-728.730) [-727.179] (-731.485) -- 0:00:28
563000 -- (-728.370) [-729.870] (-731.782) (-726.997) * [-728.429] (-729.671) (-728.282) (-727.624) -- 0:00:27
563500 -- (-725.829) [-725.292] (-729.634) (-727.618) * (-726.272) (-728.575) [-727.396] (-728.378) -- 0:00:27
564000 -- (-725.400) (-726.272) (-727.880) [-730.466] * [-725.916] (-730.551) (-727.787) (-727.027) -- 0:00:27
564500 -- (-728.945) [-728.404] (-727.860) (-731.046) * [-728.918] (-727.491) (-729.802) (-726.240) -- 0:00:27
565000 -- (-728.399) (-727.576) (-726.785) [-728.793] * (-727.004) (-728.430) [-727.064] (-726.241) -- 0:00:27
Average standard deviation of split frequencies: 0.007548
565500 -- [-728.279] (-725.555) (-729.817) (-732.016) * (-728.243) (-726.881) [-727.459] (-727.930) -- 0:00:27
566000 -- (-726.395) (-725.791) (-728.289) [-728.518] * (-725.827) (-726.130) (-726.049) [-727.241] -- 0:00:27
566500 -- [-726.209] (-725.758) (-732.593) (-728.405) * [-725.406] (-731.061) (-727.213) (-725.758) -- 0:00:27
567000 -- (-729.042) (-727.388) [-727.664] (-729.355) * (-725.729) [-727.669] (-727.570) (-729.032) -- 0:00:27
567500 -- (-727.110) [-727.375] (-728.929) (-732.905) * (-728.904) (-727.438) (-726.949) [-730.944] -- 0:00:27
568000 -- (-729.631) (-726.954) (-726.140) [-728.924] * (-726.562) (-727.463) [-726.231] (-727.075) -- 0:00:27
568500 -- (-725.527) [-727.523] (-726.733) (-725.814) * (-726.866) [-727.266] (-727.744) (-726.618) -- 0:00:27
569000 -- [-729.103] (-727.585) (-727.019) (-728.094) * (-726.110) (-727.359) (-729.336) [-728.877] -- 0:00:27
569500 -- (-727.120) (-726.169) [-725.427] (-725.375) * (-726.669) (-726.859) (-725.094) [-729.524] -- 0:00:27
570000 -- (-725.498) (-725.830) [-728.339] (-727.135) * (-725.482) (-725.843) (-729.535) [-728.495] -- 0:00:27
Average standard deviation of split frequencies: 0.007848
570500 -- (-726.553) (-725.825) [-725.574] (-726.093) * (-726.156) (-725.126) (-728.090) [-727.963] -- 0:00:27
571000 -- (-725.778) (-727.808) [-725.952] (-726.587) * (-730.178) (-726.064) (-727.049) [-729.063] -- 0:00:27
571500 -- (-729.548) (-727.384) (-729.766) [-727.000] * [-728.144] (-727.989) (-727.761) (-727.746) -- 0:00:27
572000 -- [-725.523] (-728.375) (-726.978) (-727.538) * [-729.449] (-726.363) (-726.198) (-730.200) -- 0:00:27
572500 -- (-728.233) (-728.575) [-725.848] (-727.793) * (-727.425) [-726.244] (-731.168) (-727.133) -- 0:00:27
573000 -- (-727.817) (-729.150) [-725.471] (-725.600) * (-729.143) (-725.826) [-727.283] (-731.690) -- 0:00:27
573500 -- [-729.009] (-730.002) (-729.429) (-725.958) * (-726.711) [-726.325] (-727.177) (-729.645) -- 0:00:27
574000 -- (-725.977) (-727.392) [-728.382] (-725.531) * [-726.922] (-726.395) (-726.026) (-729.278) -- 0:00:27
574500 -- [-726.237] (-726.020) (-727.315) (-731.527) * [-726.988] (-728.756) (-726.369) (-727.853) -- 0:00:27
575000 -- (-726.229) (-728.367) (-726.461) [-730.238] * (-727.102) [-728.065] (-726.657) (-726.815) -- 0:00:27
Average standard deviation of split frequencies: 0.007775
575500 -- [-727.015] (-728.873) (-726.907) (-726.454) * (-725.918) (-729.542) [-728.087] (-731.647) -- 0:00:27
576000 -- (-729.741) [-727.529] (-730.046) (-733.289) * (-726.808) (-727.713) (-730.726) [-730.144] -- 0:00:27
576500 -- (-730.885) [-729.575] (-725.322) (-726.693) * (-725.687) (-731.244) (-728.233) [-729.823] -- 0:00:27
577000 -- (-725.817) (-726.848) [-725.270] (-734.127) * [-727.547] (-725.906) (-730.890) (-726.532) -- 0:00:27
577500 -- (-727.121) (-728.372) [-725.835] (-728.681) * (-728.407) [-725.671] (-726.443) (-725.922) -- 0:00:27
578000 -- [-726.573] (-731.348) (-727.058) (-728.911) * (-727.629) (-729.311) [-726.640] (-727.239) -- 0:00:27
578500 -- (-727.709) [-730.145] (-726.536) (-727.645) * (-726.865) (-727.414) (-726.545) [-726.326] -- 0:00:26
579000 -- (-726.482) (-726.464) (-728.053) [-727.649] * (-732.394) [-726.773] (-726.239) (-726.745) -- 0:00:26
579500 -- (-730.678) (-728.998) (-727.575) [-729.714] * (-725.603) (-729.979) (-731.191) [-726.077] -- 0:00:26
580000 -- (-728.340) [-726.371] (-727.525) (-728.558) * (-727.874) [-726.966] (-726.814) (-729.882) -- 0:00:26
Average standard deviation of split frequencies: 0.008372
580500 -- (-727.805) (-729.542) (-729.800) [-729.612] * (-727.590) (-729.355) (-730.466) [-728.528] -- 0:00:26
581000 -- [-729.065] (-728.090) (-726.466) (-730.137) * [-727.473] (-729.659) (-728.281) (-728.631) -- 0:00:26
581500 -- (-727.788) [-727.053] (-726.574) (-726.071) * (-729.958) (-740.260) (-732.058) [-726.786] -- 0:00:26
582000 -- (-725.925) (-726.425) [-728.316] (-727.925) * (-729.542) (-728.054) [-728.211] (-728.037) -- 0:00:26
582500 -- (-726.936) (-729.604) [-728.128] (-729.803) * [-727.292] (-730.147) (-726.500) (-730.721) -- 0:00:26
583000 -- (-730.599) [-726.757] (-725.627) (-725.862) * (-728.534) [-729.143] (-728.455) (-728.269) -- 0:00:26
583500 -- (-729.713) (-727.919) [-725.884] (-727.040) * (-727.025) (-729.583) (-727.498) [-726.100] -- 0:00:26
584000 -- (-731.416) (-725.665) (-726.553) [-727.161] * (-726.407) (-727.169) (-726.728) [-728.073] -- 0:00:26
584500 -- (-728.775) [-728.234] (-725.584) (-726.998) * [-727.354] (-727.094) (-729.896) (-726.458) -- 0:00:26
585000 -- [-728.048] (-728.600) (-730.281) (-728.322) * (-725.647) [-728.715] (-729.466) (-726.314) -- 0:00:26
Average standard deviation of split frequencies: 0.007290
585500 -- (-727.528) (-729.231) [-727.247] (-726.929) * (-728.234) (-727.771) (-727.377) [-726.476] -- 0:00:26
586000 -- (-726.095) (-729.039) (-729.893) [-728.661] * (-729.069) [-725.823] (-726.609) (-728.580) -- 0:00:26
586500 -- [-726.601] (-729.892) (-728.265) (-728.019) * (-727.288) [-726.215] (-727.865) (-728.798) -- 0:00:26
587000 -- [-725.346] (-728.136) (-728.813) (-730.582) * (-727.655) (-728.318) (-731.800) [-727.652] -- 0:00:26
587500 -- (-727.323) (-731.610) [-726.807] (-726.216) * (-727.943) [-725.217] (-727.449) (-727.779) -- 0:00:26
588000 -- [-730.326] (-728.948) (-725.914) (-727.615) * (-727.641) (-725.434) [-726.046] (-726.594) -- 0:00:26
588500 -- (-728.029) (-727.350) [-729.461] (-728.603) * (-727.936) (-726.519) (-727.326) [-725.308] -- 0:00:26
589000 -- (-727.724) (-727.314) (-726.994) [-728.836] * (-726.617) (-727.944) [-727.659] (-727.166) -- 0:00:26
589500 -- [-728.405] (-729.020) (-727.103) (-731.193) * [-725.930] (-728.075) (-727.629) (-727.405) -- 0:00:26
590000 -- (-726.989) (-725.448) [-730.869] (-728.412) * (-727.853) (-725.672) [-729.839] (-727.227) -- 0:00:26
Average standard deviation of split frequencies: 0.007289
590500 -- [-727.400] (-727.851) (-728.949) (-727.285) * (-727.278) (-726.428) [-725.291] (-727.448) -- 0:00:26
591000 -- (-728.932) (-728.822) [-726.374] (-727.771) * (-726.034) (-726.961) (-725.435) [-727.674] -- 0:00:26
591500 -- (-733.336) [-728.068] (-728.114) (-729.721) * [-725.996] (-726.797) (-729.157) (-730.543) -- 0:00:26
592000 -- (-734.339) (-725.879) [-726.255] (-727.003) * (-731.428) [-726.424] (-726.554) (-725.720) -- 0:00:26
592500 -- (-733.716) (-726.065) (-727.965) [-728.881] * (-729.201) [-726.241] (-726.139) (-725.610) -- 0:00:26
593000 -- [-728.271] (-726.465) (-726.962) (-727.275) * (-726.377) (-731.833) (-726.103) [-725.519] -- 0:00:26
593500 -- (-730.667) (-727.144) [-726.557] (-726.492) * [-727.213] (-725.625) (-725.327) (-726.198) -- 0:00:26
594000 -- (-733.114) (-725.925) (-726.238) [-728.267] * [-732.975] (-726.499) (-727.227) (-727.247) -- 0:00:25
594500 -- [-730.200] (-727.836) (-727.166) (-728.614) * [-726.240] (-726.596) (-728.754) (-727.408) -- 0:00:25
595000 -- [-727.834] (-725.564) (-725.663) (-731.185) * (-728.678) [-728.736] (-733.572) (-732.840) -- 0:00:25
Average standard deviation of split frequencies: 0.006908
595500 -- [-726.993] (-730.187) (-729.785) (-726.182) * (-727.220) (-728.213) [-732.779] (-727.380) -- 0:00:25
596000 -- (-730.562) [-727.220] (-726.517) (-727.090) * (-726.985) (-729.709) (-730.675) [-728.265] -- 0:00:25
596500 -- (-728.819) [-728.091] (-728.601) (-726.085) * (-726.749) [-726.414] (-727.409) (-730.313) -- 0:00:25
597000 -- (-730.534) (-726.027) [-726.914] (-728.262) * (-731.439) (-726.443) [-729.363] (-729.875) -- 0:00:25
597500 -- [-726.227] (-725.970) (-730.416) (-730.352) * [-727.977] (-727.211) (-730.389) (-731.076) -- 0:00:25
598000 -- (-726.997) [-726.012] (-729.679) (-727.334) * [-726.742] (-726.116) (-730.055) (-728.284) -- 0:00:25
598500 -- (-733.811) [-725.179] (-730.389) (-728.230) * [-728.387] (-727.115) (-726.636) (-726.799) -- 0:00:25
599000 -- (-727.484) (-725.923) [-728.134] (-727.519) * [-731.312] (-728.158) (-727.565) (-733.987) -- 0:00:25
599500 -- (-729.498) (-726.924) (-727.363) [-725.431] * (-725.688) [-728.639] (-726.111) (-729.291) -- 0:00:25
600000 -- (-726.570) (-726.179) [-729.166] (-726.480) * (-726.909) (-725.897) [-727.388] (-737.434) -- 0:00:25
Average standard deviation of split frequencies: 0.007063
600500 -- (-729.380) [-727.718] (-727.309) (-726.907) * [-729.001] (-731.540) (-727.691) (-728.477) -- 0:00:25
601000 -- [-729.138] (-725.990) (-727.768) (-726.591) * (-727.666) [-726.305] (-730.614) (-727.918) -- 0:00:25
601500 -- [-726.137] (-726.818) (-730.730) (-729.281) * (-729.958) (-727.899) [-726.124] (-727.776) -- 0:00:25
602000 -- [-727.753] (-728.620) (-730.135) (-728.882) * (-727.963) (-730.709) [-727.486] (-727.198) -- 0:00:25
602500 -- (-725.966) (-728.857) (-725.779) [-732.886] * [-726.338] (-727.258) (-727.205) (-726.166) -- 0:00:25
603000 -- (-728.130) (-729.522) [-728.714] (-727.251) * (-725.167) (-728.408) (-728.344) [-727.772] -- 0:00:25
603500 -- (-733.388) [-727.044] (-726.901) (-727.488) * (-725.183) [-726.854] (-727.862) (-725.767) -- 0:00:24
604000 -- [-728.911] (-725.103) (-727.781) (-728.001) * (-727.062) (-726.670) (-725.548) [-728.760] -- 0:00:25
604500 -- (-730.380) (-730.059) (-727.257) [-726.422] * (-728.533) [-729.514] (-727.990) (-727.550) -- 0:00:25
605000 -- (-728.626) (-731.535) [-729.413] (-729.536) * (-727.875) (-725.918) [-727.001] (-729.078) -- 0:00:25
Average standard deviation of split frequencies: 0.007260
605500 -- (-726.955) (-730.188) (-730.019) [-726.686] * [-725.959] (-728.572) (-727.656) (-725.564) -- 0:00:25
606000 -- (-727.962) [-729.094] (-729.601) (-725.877) * (-727.393) [-728.426] (-726.847) (-726.278) -- 0:00:25
606500 -- [-725.965] (-725.189) (-730.864) (-727.518) * (-726.748) (-728.795) [-726.585] (-727.532) -- 0:00:25
607000 -- [-726.306] (-727.313) (-731.574) (-725.977) * (-728.307) [-728.560] (-728.874) (-727.447) -- 0:00:25
607500 -- (-727.277) (-726.812) (-731.876) [-727.303] * (-728.651) (-728.353) [-725.553] (-727.094) -- 0:00:25
608000 -- (-728.444) [-731.867] (-726.863) (-730.474) * [-726.830] (-726.431) (-731.164) (-726.080) -- 0:00:25
608500 -- [-728.213] (-725.733) (-726.776) (-725.169) * [-726.416] (-726.737) (-728.603) (-726.193) -- 0:00:25
609000 -- (-730.355) [-726.022] (-725.210) (-725.301) * (-732.204) [-727.551] (-726.333) (-728.603) -- 0:00:25
609500 -- (-729.992) (-726.058) (-729.614) [-727.182] * [-729.023] (-727.030) (-730.316) (-732.458) -- 0:00:24
610000 -- (-728.079) (-725.909) [-729.446] (-726.519) * (-727.614) [-727.500] (-726.765) (-728.275) -- 0:00:24
Average standard deviation of split frequencies: 0.007565
610500 -- [-728.811] (-729.837) (-727.893) (-726.941) * [-729.266] (-728.335) (-727.873) (-729.328) -- 0:00:24
611000 -- (-726.117) (-726.911) (-727.044) [-726.427] * [-727.920] (-728.218) (-726.099) (-725.863) -- 0:00:24
611500 -- (-725.363) [-726.918] (-730.029) (-728.224) * (-729.609) (-725.657) (-728.116) [-728.034] -- 0:00:24
612000 -- [-726.920] (-727.791) (-726.709) (-730.815) * (-726.717) (-728.062) (-727.143) [-728.504] -- 0:00:24
612500 -- (-728.530) [-727.611] (-727.323) (-730.469) * [-727.867] (-729.175) (-727.223) (-730.474) -- 0:00:24
613000 -- (-731.243) [-727.808] (-725.982) (-731.522) * (-727.166) [-729.509] (-725.913) (-732.185) -- 0:00:24
613500 -- (-726.979) (-726.434) [-726.352] (-726.564) * (-729.001) (-728.532) [-725.746] (-726.875) -- 0:00:24
614000 -- [-725.822] (-726.897) (-726.791) (-725.411) * [-729.944] (-731.244) (-729.492) (-727.140) -- 0:00:24
614500 -- (-726.661) [-726.707] (-726.219) (-728.169) * [-725.188] (-729.204) (-727.595) (-725.654) -- 0:00:24
615000 -- [-726.161] (-727.284) (-727.300) (-727.521) * (-726.814) (-727.667) (-727.020) [-731.966] -- 0:00:24
Average standard deviation of split frequencies: 0.007347
615500 -- [-726.092] (-727.476) (-726.155) (-730.500) * [-727.330] (-725.872) (-730.298) (-727.315) -- 0:00:24
616000 -- [-726.522] (-728.599) (-725.911) (-727.417) * (-728.432) [-726.037] (-728.796) (-726.156) -- 0:00:24
616500 -- (-729.102) [-729.594] (-725.582) (-727.918) * (-726.948) (-726.084) (-727.880) [-728.191] -- 0:00:24
617000 -- (-726.890) (-729.123) [-725.943] (-729.554) * (-729.247) [-727.298] (-726.775) (-727.372) -- 0:00:24
617500 -- (-725.998) [-730.828] (-727.223) (-725.845) * [-732.005] (-727.774) (-726.662) (-727.275) -- 0:00:24
618000 -- (-731.599) (-730.801) [-726.130] (-725.459) * (-728.302) (-726.438) [-726.945] (-728.770) -- 0:00:24
618500 -- [-727.381] (-730.915) (-733.678) (-725.211) * (-727.526) [-730.365] (-725.624) (-725.635) -- 0:00:24
619000 -- (-728.270) (-730.963) [-726.074] (-726.502) * (-726.882) (-730.895) (-726.515) [-727.748] -- 0:00:24
619500 -- (-728.375) [-727.255] (-725.408) (-729.619) * (-728.491) [-732.290] (-726.688) (-725.972) -- 0:00:23
620000 -- (-732.437) (-726.708) [-726.663] (-726.257) * (-727.117) (-729.244) [-729.299] (-728.991) -- 0:00:23
Average standard deviation of split frequencies: 0.007899
620500 -- [-731.083] (-726.180) (-725.486) (-727.379) * (-726.123) (-729.115) [-730.674] (-726.739) -- 0:00:23
621000 -- (-725.824) (-729.684) (-727.112) [-730.436] * (-727.442) [-728.955] (-727.351) (-729.061) -- 0:00:24
621500 -- [-727.426] (-726.008) (-729.027) (-726.328) * (-726.535) (-726.085) (-727.553) [-730.315] -- 0:00:24
622000 -- (-726.913) (-728.969) [-727.057] (-727.238) * (-725.618) (-726.284) (-730.032) [-728.165] -- 0:00:24
622500 -- (-725.722) (-727.543) [-726.027] (-727.457) * [-726.677] (-729.943) (-725.601) (-729.649) -- 0:00:24
623000 -- [-726.073] (-731.183) (-726.277) (-732.004) * (-728.737) [-727.309] (-728.754) (-729.703) -- 0:00:24
623500 -- (-729.811) [-726.817] (-732.245) (-732.898) * (-735.026) (-727.462) (-726.904) [-728.049] -- 0:00:24
624000 -- [-729.320] (-727.564) (-726.817) (-726.627) * (-726.685) (-725.983) (-726.823) [-725.717] -- 0:00:24
624500 -- (-729.022) [-727.159] (-728.389) (-730.197) * (-729.152) (-726.084) [-727.187] (-725.634) -- 0:00:24
625000 -- [-727.686] (-727.242) (-727.308) (-727.382) * (-729.931) [-734.612] (-728.530) (-726.881) -- 0:00:24
Average standard deviation of split frequencies: 0.008785
625500 -- [-727.863] (-726.358) (-727.774) (-725.622) * (-728.300) (-727.393) [-728.466] (-731.369) -- 0:00:23
626000 -- (-727.291) (-726.619) (-731.907) [-727.425] * (-728.377) (-729.749) [-726.354] (-727.673) -- 0:00:23
626500 -- (-730.188) (-729.129) (-728.046) [-725.942] * (-726.374) (-727.667) [-725.719] (-725.837) -- 0:00:23
627000 -- (-727.848) (-728.500) (-729.940) [-726.356] * (-729.587) (-726.321) (-726.928) [-727.121] -- 0:00:23
627500 -- [-725.476] (-728.886) (-726.851) (-728.209) * [-727.865] (-726.028) (-727.347) (-726.905) -- 0:00:23
628000 -- (-725.876) (-730.014) [-727.812] (-726.430) * (-727.345) (-728.807) [-728.537] (-728.548) -- 0:00:23
628500 -- (-726.222) [-728.306] (-726.141) (-725.861) * (-729.296) [-726.590] (-729.713) (-726.332) -- 0:00:23
629000 -- (-728.571) (-726.559) [-726.619] (-729.729) * (-727.212) [-727.821] (-725.966) (-727.785) -- 0:00:23
629500 -- (-725.555) (-729.902) [-726.202] (-726.205) * (-727.048) (-725.426) [-726.608] (-726.904) -- 0:00:23
630000 -- [-726.275] (-729.112) (-726.099) (-728.978) * [-726.581] (-726.492) (-727.012) (-726.333) -- 0:00:23
Average standard deviation of split frequencies: 0.008770
630500 -- [-728.902] (-726.707) (-727.891) (-729.684) * (-727.120) [-729.863] (-726.792) (-726.404) -- 0:00:23
631000 -- (-728.294) (-726.348) (-725.915) [-729.721] * [-728.290] (-727.894) (-726.212) (-728.809) -- 0:00:23
631500 -- (-729.054) [-726.581] (-725.885) (-735.610) * (-726.886) [-726.558] (-729.338) (-728.846) -- 0:00:23
632000 -- (-728.142) [-727.717] (-726.884) (-730.641) * (-726.856) [-728.822] (-726.253) (-729.003) -- 0:00:23
632500 -- (-732.027) [-726.133] (-730.772) (-726.648) * (-726.068) [-726.182] (-727.478) (-726.263) -- 0:00:23
633000 -- [-732.313] (-729.167) (-730.180) (-727.643) * (-726.780) (-734.637) (-729.035) [-729.642] -- 0:00:23
633500 -- (-729.634) (-726.949) [-725.987] (-727.760) * (-726.512) [-731.570] (-727.591) (-728.745) -- 0:00:23
634000 -- (-727.554) [-727.272] (-728.575) (-726.376) * [-729.059] (-730.222) (-729.258) (-726.373) -- 0:00:23
634500 -- (-726.821) (-730.989) [-727.562] (-727.061) * (-727.957) [-728.184] (-726.059) (-726.817) -- 0:00:23
635000 -- (-725.725) (-730.363) [-726.583] (-727.388) * (-726.489) [-725.710] (-726.085) (-725.587) -- 0:00:22
Average standard deviation of split frequencies: 0.008549
635500 -- (-729.900) (-727.516) (-725.421) [-726.997] * (-726.303) (-726.418) [-727.265] (-725.634) -- 0:00:22
636000 -- (-726.959) (-726.828) (-728.299) [-726.811] * [-725.602] (-728.381) (-728.798) (-727.011) -- 0:00:22
636500 -- (-728.226) (-725.972) [-726.862] (-725.786) * (-726.038) [-727.214] (-725.346) (-726.511) -- 0:00:22
637000 -- (-729.833) [-726.496] (-730.211) (-727.795) * (-729.186) (-728.094) [-726.439] (-730.462) -- 0:00:22
637500 -- [-729.816] (-725.878) (-732.169) (-728.285) * (-728.216) [-729.669] (-725.632) (-729.674) -- 0:00:22
638000 -- (-730.207) [-726.383] (-726.849) (-726.202) * (-727.621) [-728.213] (-725.354) (-732.070) -- 0:00:23
638500 -- (-728.739) (-728.069) (-726.055) [-726.288] * (-726.265) [-728.425] (-725.935) (-731.485) -- 0:00:23
639000 -- (-725.278) (-729.418) (-726.803) [-730.065] * (-726.820) (-727.937) (-731.064) [-725.840] -- 0:00:23
639500 -- (-726.961) (-727.032) [-727.039] (-728.667) * [-726.462] (-729.376) (-729.864) (-726.137) -- 0:00:23
640000 -- [-729.022] (-733.239) (-727.880) (-729.263) * [-729.093] (-729.871) (-725.475) (-726.939) -- 0:00:23
Average standard deviation of split frequencies: 0.008290
640500 -- [-726.894] (-729.094) (-733.900) (-726.843) * [-727.925] (-728.701) (-725.521) (-728.881) -- 0:00:23
641000 -- (-730.129) (-731.438) (-729.281) [-727.930] * (-728.083) (-727.221) [-726.917] (-726.567) -- 0:00:22
641500 -- (-727.071) (-726.462) (-726.588) [-725.799] * [-726.704] (-730.329) (-725.772) (-728.677) -- 0:00:22
642000 -- (-725.979) (-727.272) (-730.506) [-732.153] * [-729.690] (-728.395) (-733.211) (-728.782) -- 0:00:22
642500 -- (-729.122) (-727.267) (-725.650) [-725.685] * (-729.192) [-730.124] (-730.182) (-729.077) -- 0:00:22
643000 -- [-725.641] (-727.016) (-725.896) (-728.519) * (-731.566) (-727.101) (-727.567) [-730.021] -- 0:00:22
643500 -- (-727.614) [-727.703] (-726.276) (-728.596) * (-725.741) (-726.311) (-727.969) [-726.462] -- 0:00:22
644000 -- [-726.311] (-727.429) (-725.562) (-733.111) * (-727.989) (-725.599) [-725.755] (-728.066) -- 0:00:22
644500 -- [-725.306] (-727.207) (-727.695) (-726.652) * [-727.122] (-730.244) (-731.402) (-726.841) -- 0:00:22
645000 -- (-731.875) [-725.953] (-726.653) (-725.786) * (-726.447) (-727.202) (-729.568) [-726.237] -- 0:00:22
Average standard deviation of split frequencies: 0.008076
645500 -- (-726.312) (-726.732) [-725.703] (-726.316) * (-730.418) [-725.951] (-725.933) (-726.616) -- 0:00:22
646000 -- (-729.036) [-727.866] (-728.835) (-727.515) * (-730.364) [-729.194] (-727.017) (-727.688) -- 0:00:22
646500 -- (-729.744) [-727.401] (-727.176) (-730.064) * [-727.052] (-726.864) (-731.799) (-728.109) -- 0:00:22
647000 -- (-728.113) [-725.710] (-728.056) (-726.116) * (-733.120) (-726.638) [-728.164] (-728.926) -- 0:00:22
647500 -- (-727.750) [-727.204] (-728.719) (-730.756) * (-725.530) (-729.065) [-729.447] (-732.054) -- 0:00:22
648000 -- (-728.718) (-727.509) [-729.168] (-727.075) * (-727.744) (-726.889) (-726.066) [-728.019] -- 0:00:22
648500 -- (-729.330) [-727.010] (-727.340) (-727.104) * (-726.283) (-727.094) [-730.232] (-730.481) -- 0:00:22
649000 -- (-728.050) [-726.087] (-728.691) (-725.946) * (-727.333) (-728.191) [-726.108] (-729.035) -- 0:00:22
649500 -- (-726.304) (-727.956) (-732.216) [-726.488] * [-727.435] (-727.848) (-726.334) (-728.533) -- 0:00:22
650000 -- (-727.809) (-727.199) (-731.659) [-727.203] * [-728.344] (-728.884) (-728.051) (-731.440) -- 0:00:22
Average standard deviation of split frequencies: 0.007776
650500 -- [-727.329] (-726.854) (-732.305) (-726.552) * (-729.395) (-727.208) (-731.225) [-730.175] -- 0:00:22
651000 -- (-728.140) (-728.638) [-727.917] (-728.418) * (-726.316) [-730.753] (-727.497) (-728.370) -- 0:00:21
651500 -- (-732.101) (-726.667) [-726.893] (-728.277) * (-728.699) (-726.790) [-726.195] (-729.163) -- 0:00:21
652000 -- (-726.066) [-726.433] (-726.054) (-728.434) * (-726.524) [-725.617] (-725.592) (-731.112) -- 0:00:21
652500 -- [-726.170] (-727.308) (-729.018) (-729.722) * (-726.317) [-725.612] (-725.609) (-729.794) -- 0:00:21
653000 -- (-725.979) [-727.629] (-725.203) (-728.886) * (-727.540) (-725.571) [-726.757] (-726.544) -- 0:00:21
653500 -- (-729.475) (-725.570) [-730.835] (-732.276) * (-729.863) (-729.486) (-725.290) [-725.466] -- 0:00:21
654000 -- (-731.766) (-730.474) (-725.423) [-727.838] * (-726.250) (-729.486) (-729.402) [-725.464] -- 0:00:21
654500 -- (-729.346) (-728.680) [-727.054] (-726.747) * (-726.598) (-727.870) (-731.883) [-726.908] -- 0:00:22
655000 -- (-727.147) (-728.653) (-728.183) [-727.545] * [-726.587] (-728.136) (-727.245) (-727.042) -- 0:00:22
Average standard deviation of split frequencies: 0.007761
655500 -- (-726.961) (-728.310) (-725.684) [-727.704] * (-728.257) (-726.988) (-727.547) [-727.219] -- 0:00:22
656000 -- (-726.987) (-728.495) [-725.710] (-729.981) * (-725.292) [-726.547] (-727.583) (-732.811) -- 0:00:22
656500 -- (-727.125) (-726.760) [-725.266] (-728.813) * [-725.590] (-726.190) (-725.668) (-725.743) -- 0:00:21
657000 -- [-726.262] (-729.833) (-725.477) (-729.219) * (-725.590) [-725.504] (-729.641) (-725.559) -- 0:00:21
657500 -- (-725.465) (-731.658) [-726.365] (-729.073) * (-726.853) (-726.327) (-728.657) [-726.830] -- 0:00:21
658000 -- [-726.065] (-731.861) (-726.762) (-728.055) * (-730.718) (-726.191) [-726.661] (-727.875) -- 0:00:21
658500 -- (-728.355) (-728.528) (-725.506) [-731.192] * (-729.765) (-726.768) [-726.374] (-726.899) -- 0:00:21
659000 -- (-726.799) [-729.208] (-729.494) (-727.142) * [-727.955] (-728.335) (-726.076) (-726.854) -- 0:00:21
659500 -- (-729.195) (-726.875) [-726.457] (-727.182) * (-729.241) [-726.894] (-728.181) (-727.839) -- 0:00:21
660000 -- (-731.985) [-728.373] (-726.518) (-730.696) * (-726.553) (-726.520) [-729.172] (-730.030) -- 0:00:21
Average standard deviation of split frequencies: 0.007183
660500 -- (-726.563) (-728.238) [-730.310] (-727.448) * [-726.163] (-730.939) (-727.208) (-735.911) -- 0:00:21
661000 -- (-725.265) (-731.489) (-728.628) [-727.022] * (-725.673) (-730.124) (-728.962) [-730.949] -- 0:00:21
661500 -- (-725.954) [-727.728] (-726.010) (-733.684) * (-727.552) [-727.145] (-727.655) (-729.180) -- 0:00:21
662000 -- (-726.371) (-726.380) (-729.386) [-728.524] * (-728.125) [-727.327] (-726.563) (-726.920) -- 0:00:21
662500 -- (-725.585) (-726.264) (-729.990) [-726.175] * (-736.740) [-726.665] (-730.861) (-725.832) -- 0:00:21
663000 -- (-729.382) (-733.314) (-727.431) [-726.353] * (-729.889) (-728.480) [-727.882] (-726.227) -- 0:00:21
663500 -- (-726.752) (-725.709) (-727.432) [-725.878] * (-728.345) (-728.831) [-726.011] (-726.147) -- 0:00:21
664000 -- [-727.017] (-727.373) (-731.982) (-727.623) * (-729.898) (-728.791) [-726.031] (-726.464) -- 0:00:21
664500 -- [-726.480] (-730.739) (-726.088) (-726.503) * (-729.685) (-729.225) (-727.238) [-728.851] -- 0:00:21
665000 -- (-727.994) (-728.452) [-727.717] (-726.232) * (-727.174) [-728.828] (-728.953) (-725.664) -- 0:00:21
Average standard deviation of split frequencies: 0.007408
665500 -- (-728.544) (-725.601) (-729.754) [-725.548] * (-728.024) (-728.274) [-729.847] (-727.462) -- 0:00:21
666000 -- (-728.010) (-727.628) (-734.460) [-725.410] * (-726.031) (-727.265) [-726.652] (-731.789) -- 0:00:21
666500 -- (-726.693) [-735.223] (-737.576) (-726.198) * (-726.209) (-725.777) (-728.412) [-725.557] -- 0:00:21
667000 -- (-725.368) (-726.049) (-727.237) [-726.217] * (-727.323) [-725.590] (-725.952) (-728.104) -- 0:00:20
667500 -- [-726.800] (-727.364) (-726.881) (-727.449) * (-728.538) (-730.471) [-728.494] (-726.547) -- 0:00:20
668000 -- (-726.549) (-727.552) (-725.913) [-725.779] * (-727.633) [-725.503] (-729.039) (-725.620) -- 0:00:20
668500 -- (-727.675) (-728.285) [-727.916] (-727.501) * (-733.742) (-730.236) (-727.787) [-729.165] -- 0:00:20
669000 -- (-727.759) (-726.819) (-726.824) [-727.562] * (-726.374) (-731.249) [-726.369] (-728.814) -- 0:00:20
669500 -- [-727.505] (-725.963) (-728.411) (-728.016) * [-726.897] (-731.069) (-727.347) (-730.374) -- 0:00:20
670000 -- (-728.032) (-725.117) [-727.792] (-727.907) * [-728.478] (-733.491) (-727.612) (-728.401) -- 0:00:20
Average standard deviation of split frequencies: 0.007310
670500 -- (-728.178) (-727.236) (-729.343) [-726.516] * (-728.968) [-728.147] (-728.889) (-728.724) -- 0:00:21
671000 -- (-727.591) (-726.769) [-731.312] (-728.713) * [-725.950] (-735.679) (-727.085) (-726.476) -- 0:00:21
671500 -- [-727.975] (-726.051) (-727.432) (-726.873) * (-725.955) (-726.198) [-725.734] (-726.886) -- 0:00:21
672000 -- (-728.079) (-727.733) (-725.497) [-732.558] * (-726.976) (-726.560) [-725.963] (-735.190) -- 0:00:20
672500 -- (-730.330) [-726.397] (-728.654) (-727.923) * (-727.568) [-729.045] (-727.237) (-726.224) -- 0:00:20
673000 -- (-726.959) (-726.610) [-729.043] (-726.242) * (-727.748) [-726.507] (-728.361) (-731.839) -- 0:00:20
673500 -- (-728.379) (-732.498) (-731.679) [-727.014] * (-727.026) (-731.067) [-729.092] (-726.823) -- 0:00:20
674000 -- (-730.419) (-725.227) (-726.878) [-727.244] * (-729.810) (-727.040) [-727.082] (-726.196) -- 0:00:20
674500 -- (-725.772) (-725.435) [-726.286] (-726.403) * (-730.124) (-726.439) (-726.722) [-726.227] -- 0:00:20
675000 -- (-727.572) (-726.402) (-727.098) [-726.911] * (-729.085) (-729.981) [-726.226] (-727.422) -- 0:00:20
Average standard deviation of split frequencies: 0.007299
675500 -- (-728.457) [-727.707] (-728.259) (-728.294) * (-725.944) [-729.306] (-731.824) (-726.033) -- 0:00:20
676000 -- [-726.415] (-730.442) (-726.150) (-730.556) * (-727.447) [-726.161] (-725.672) (-728.086) -- 0:00:20
676500 -- (-727.270) (-728.781) (-725.657) [-729.792] * (-727.282) [-727.814] (-728.911) (-731.675) -- 0:00:20
677000 -- (-726.719) (-730.342) (-727.557) [-727.394] * (-728.138) (-728.184) (-729.035) [-726.662] -- 0:00:20
677500 -- [-729.570] (-725.973) (-726.667) (-728.576) * (-730.103) [-727.515] (-726.823) (-726.735) -- 0:00:20
678000 -- (-728.149) [-726.418] (-729.312) (-726.949) * (-727.347) (-726.736) (-728.995) [-726.734] -- 0:00:20
678500 -- (-727.309) (-725.812) (-731.513) [-727.912] * [-727.554] (-727.037) (-728.726) (-726.491) -- 0:00:20
679000 -- [-726.915] (-727.092) (-728.584) (-725.059) * (-728.503) (-726.168) (-728.999) [-726.410] -- 0:00:20
679500 -- (-728.299) [-729.955] (-725.868) (-725.521) * (-727.105) [-726.141] (-726.902) (-725.517) -- 0:00:20
680000 -- (-727.373) (-733.245) (-725.426) [-727.847] * (-727.580) (-728.018) [-726.435] (-728.034) -- 0:00:20
Average standard deviation of split frequencies: 0.007705
680500 -- [-725.829] (-728.322) (-725.986) (-727.556) * (-727.515) [-731.282] (-725.988) (-726.117) -- 0:00:20
681000 -- (-727.885) (-725.847) [-727.195] (-726.987) * (-727.970) (-728.466) (-725.956) [-725.396] -- 0:00:20
681500 -- (-727.011) (-730.094) [-727.964] (-726.103) * (-729.401) (-726.632) [-727.024] (-726.037) -- 0:00:20
682000 -- [-728.692] (-728.689) (-730.523) (-727.661) * (-728.850) (-725.012) (-726.064) [-726.001] -- 0:00:20
682500 -- (-728.911) (-729.347) (-728.475) [-726.825] * (-727.198) [-725.687] (-728.459) (-725.480) -- 0:00:20
683000 -- (-728.104) (-725.669) (-726.162) [-727.305] * (-727.219) (-728.093) [-725.873] (-727.207) -- 0:00:19
683500 -- (-725.762) (-727.980) (-726.305) [-729.776] * (-730.915) (-729.625) [-729.429] (-728.168) -- 0:00:19
684000 -- (-734.502) [-726.218] (-726.286) (-730.323) * (-725.544) (-726.515) [-725.345] (-728.340) -- 0:00:19
684500 -- (-729.304) (-729.303) (-732.426) [-728.479] * (-727.594) (-728.046) [-729.107] (-726.643) -- 0:00:19
685000 -- [-729.865] (-728.154) (-726.902) (-727.870) * [-725.513] (-733.444) (-726.436) (-726.414) -- 0:00:19
Average standard deviation of split frequencies: 0.007731
685500 -- (-726.381) (-727.790) [-729.404] (-728.225) * (-726.323) (-730.019) [-727.582] (-728.681) -- 0:00:19
686000 -- (-728.085) (-731.554) (-726.411) [-727.669] * (-727.741) (-729.481) (-727.897) [-727.342] -- 0:00:19
686500 -- (-727.181) [-726.401] (-728.093) (-727.065) * (-727.359) [-727.179] (-730.850) (-729.380) -- 0:00:19
687000 -- (-729.134) [-727.483] (-728.335) (-728.895) * (-727.966) (-726.463) [-726.497] (-727.693) -- 0:00:20
687500 -- (-726.344) (-726.623) [-730.764] (-727.925) * (-728.337) (-727.378) (-726.570) [-725.153] -- 0:00:20
688000 -- (-726.168) [-726.060] (-729.834) (-725.997) * (-729.773) (-726.817) [-726.045] (-726.346) -- 0:00:19
688500 -- [-728.284] (-727.843) (-726.979) (-728.803) * (-726.262) (-729.766) [-727.445] (-730.801) -- 0:00:19
689000 -- (-727.677) (-727.741) (-727.074) [-726.096] * (-727.681) (-731.835) (-729.127) [-731.221] -- 0:00:19
689500 -- (-730.781) (-727.102) (-726.774) [-726.819] * [-728.505] (-728.443) (-728.568) (-729.978) -- 0:00:19
690000 -- [-725.583] (-726.982) (-730.685) (-729.419) * (-730.712) (-730.352) (-730.681) [-729.433] -- 0:00:19
Average standard deviation of split frequencies: 0.007849
690500 -- [-726.866] (-726.751) (-734.140) (-725.213) * [-728.724] (-727.915) (-734.954) (-727.309) -- 0:00:19
691000 -- (-727.066) (-728.489) (-729.351) [-726.508] * [-726.856] (-726.698) (-727.397) (-726.990) -- 0:00:19
691500 -- (-726.431) (-726.383) (-729.700) [-728.396] * (-726.797) (-727.252) [-725.258] (-731.417) -- 0:00:19
692000 -- [-730.660] (-728.490) (-726.669) (-729.007) * (-727.187) [-727.915] (-727.824) (-725.970) -- 0:00:19
692500 -- (-729.825) (-727.234) [-727.481] (-729.860) * (-729.404) [-728.783] (-727.669) (-725.711) -- 0:00:19
693000 -- (-727.152) (-725.435) (-729.583) [-728.625] * (-727.012) [-728.741] (-727.289) (-728.197) -- 0:00:19
693500 -- (-725.378) (-726.185) [-731.344] (-725.835) * (-727.298) [-725.405] (-728.000) (-729.733) -- 0:00:19
694000 -- [-727.186] (-727.643) (-727.850) (-725.101) * (-729.823) (-725.880) (-729.685) [-728.363] -- 0:00:19
694500 -- (-728.992) (-728.478) (-729.526) [-728.421] * (-728.579) (-725.594) [-726.986] (-731.132) -- 0:00:19
695000 -- [-725.286] (-726.848) (-728.154) (-727.983) * (-726.390) (-725.577) [-726.836] (-735.798) -- 0:00:19
Average standard deviation of split frequencies: 0.008085
695500 -- [-727.670] (-725.985) (-726.243) (-726.043) * (-726.494) [-729.163] (-730.301) (-732.257) -- 0:00:19
696000 -- [-728.153] (-725.098) (-726.709) (-726.005) * [-726.076] (-727.894) (-728.943) (-725.820) -- 0:00:19
696500 -- [-726.229] (-729.554) (-727.723) (-726.334) * (-727.586) [-727.101] (-726.490) (-725.753) -- 0:00:19
697000 -- (-730.869) (-725.603) (-726.377) [-727.236] * (-726.507) (-727.225) [-725.869] (-726.849) -- 0:00:19
697500 -- [-726.454] (-727.879) (-725.803) (-727.651) * (-727.521) (-727.845) [-725.489] (-726.887) -- 0:00:19
698000 -- (-727.438) (-727.118) (-727.397) [-727.144] * (-728.071) [-725.151] (-726.059) (-726.410) -- 0:00:19
698500 -- (-727.591) (-736.627) (-729.779) [-728.922] * (-726.309) (-726.456) [-726.146] (-727.328) -- 0:00:18
699000 -- (-726.250) (-727.831) (-729.232) [-726.756] * (-727.772) [-726.166] (-726.514) (-726.009) -- 0:00:18
699500 -- (-727.596) (-725.994) [-728.104] (-727.985) * (-726.373) (-728.314) [-727.416] (-727.350) -- 0:00:18
700000 -- (-731.631) (-726.392) (-725.301) [-726.172] * [-726.684] (-730.549) (-728.875) (-726.257) -- 0:00:18
Average standard deviation of split frequencies: 0.007737
700500 -- (-730.283) [-725.274] (-725.261) (-726.109) * (-728.319) (-726.908) [-731.855] (-729.007) -- 0:00:18
701000 -- [-726.466] (-726.482) (-729.864) (-726.544) * (-733.390) (-727.902) [-726.628] (-731.940) -- 0:00:18
701500 -- (-725.867) (-728.363) [-725.915] (-725.632) * (-728.427) (-726.929) [-727.781] (-729.148) -- 0:00:18
702000 -- (-727.757) [-727.212] (-726.733) (-725.991) * (-728.461) (-727.275) [-726.277] (-729.012) -- 0:00:18
702500 -- [-726.566] (-729.246) (-729.416) (-726.528) * (-727.102) (-726.970) [-726.320] (-726.928) -- 0:00:18
703000 -- (-726.611) (-728.663) [-728.569] (-726.933) * (-728.084) (-727.696) (-729.822) [-726.810] -- 0:00:18
703500 -- (-728.998) (-728.670) [-726.192] (-729.065) * (-726.209) (-726.738) (-728.627) [-726.596] -- 0:00:18
704000 -- [-726.304] (-727.420) (-726.397) (-726.602) * [-725.930] (-729.006) (-727.122) (-727.600) -- 0:00:18
704500 -- (-731.028) (-731.770) [-728.455] (-732.144) * (-728.870) (-727.394) [-726.499] (-725.454) -- 0:00:18
705000 -- (-728.618) [-728.039] (-727.194) (-727.135) * (-726.108) (-728.538) [-725.179] (-725.584) -- 0:00:18
Average standard deviation of split frequencies: 0.007470
705500 -- [-728.656] (-728.259) (-726.009) (-728.937) * (-725.179) [-726.374] (-725.874) (-730.153) -- 0:00:18
706000 -- (-728.373) (-729.576) (-728.925) [-727.856] * [-728.110] (-728.379) (-734.785) (-725.810) -- 0:00:18
706500 -- (-728.355) (-728.158) [-726.783] (-726.502) * [-728.000] (-727.834) (-728.383) (-727.121) -- 0:00:18
707000 -- (-730.887) [-732.721] (-726.087) (-726.623) * [-727.041] (-728.449) (-727.978) (-727.262) -- 0:00:18
707500 -- (-729.383) (-730.080) [-727.776] (-727.648) * (-725.758) [-730.578] (-729.814) (-727.826) -- 0:00:18
708000 -- (-728.384) (-731.613) (-727.034) [-728.461] * (-728.961) (-728.242) [-726.501] (-726.753) -- 0:00:18
708500 -- (-728.083) [-727.955] (-727.794) (-727.707) * [-727.173] (-727.974) (-727.065) (-729.045) -- 0:00:18
709000 -- [-729.603] (-731.345) (-729.223) (-725.922) * [-727.427] (-728.631) (-726.488) (-726.926) -- 0:00:18
709500 -- (-730.119) (-727.166) [-727.255] (-726.905) * (-728.570) (-726.492) [-726.032] (-729.819) -- 0:00:18
710000 -- (-732.724) [-725.788] (-727.923) (-729.355) * (-730.533) (-726.484) (-726.250) [-725.456] -- 0:00:18
Average standard deviation of split frequencies: 0.007609
710500 -- (-725.661) (-727.542) (-727.058) [-727.418] * (-729.255) [-726.154] (-725.534) (-726.609) -- 0:00:18
711000 -- [-725.252] (-727.862) (-725.457) (-726.375) * (-728.905) [-726.074] (-726.176) (-726.802) -- 0:00:18
711500 -- (-725.889) (-728.369) [-725.460] (-725.766) * (-729.274) (-729.698) (-726.539) [-727.612] -- 0:00:18
712000 -- (-726.937) (-726.403) [-725.895] (-727.224) * (-729.722) (-731.494) [-727.280] (-727.386) -- 0:00:18
712500 -- (-730.068) (-729.401) [-725.624] (-727.625) * (-733.102) (-736.304) [-726.160] (-728.780) -- 0:00:18
713000 -- (-729.634) (-727.313) (-725.936) [-728.518] * (-730.391) (-732.705) [-728.046] (-725.101) -- 0:00:18
713500 -- (-728.074) (-726.777) [-730.941] (-730.503) * (-728.697) (-726.974) [-725.937] (-725.508) -- 0:00:18
714000 -- (-726.769) (-726.820) [-728.626] (-732.916) * (-734.462) [-727.892] (-726.470) (-726.950) -- 0:00:18
714500 -- (-727.439) [-728.896] (-732.453) (-732.330) * (-727.101) [-726.505] (-726.888) (-726.165) -- 0:00:17
715000 -- (-727.029) (-726.207) [-726.412] (-727.586) * (-725.506) [-725.324] (-725.779) (-725.420) -- 0:00:17
Average standard deviation of split frequencies: 0.007397
715500 -- [-728.772] (-728.184) (-727.296) (-727.214) * [-725.522] (-726.300) (-730.213) (-732.104) -- 0:00:17
716000 -- (-727.310) [-725.295] (-727.731) (-726.106) * (-726.132) (-730.217) [-727.035] (-732.326) -- 0:00:17
716500 -- (-727.276) (-729.750) [-728.340] (-730.594) * (-728.274) [-729.870] (-729.115) (-731.735) -- 0:00:17
717000 -- (-725.920) (-727.221) (-728.125) [-726.223] * (-729.426) [-727.440] (-729.330) (-727.439) -- 0:00:17
717500 -- (-726.754) (-730.543) [-729.093] (-729.451) * (-725.548) (-726.935) [-726.580] (-728.615) -- 0:00:17
718000 -- [-726.125] (-728.648) (-730.894) (-729.132) * (-726.355) (-727.815) (-727.786) [-728.761] -- 0:00:17
718500 -- [-727.425] (-728.929) (-728.174) (-729.917) * [-726.454] (-729.337) (-727.662) (-730.695) -- 0:00:17
719000 -- (-726.291) (-725.792) [-729.167] (-730.262) * [-727.473] (-726.713) (-726.519) (-727.197) -- 0:00:17
719500 -- (-727.286) [-725.489] (-730.402) (-731.638) * (-727.506) (-725.550) (-728.337) [-726.105] -- 0:00:17
720000 -- (-727.741) [-727.425] (-728.717) (-727.480) * (-729.017) (-725.350) (-725.435) [-726.166] -- 0:00:17
Average standard deviation of split frequencies: 0.006787
720500 -- (-727.350) [-725.527] (-730.702) (-730.083) * (-726.767) (-726.176) (-726.130) [-728.628] -- 0:00:17
721000 -- (-730.399) (-725.144) (-726.474) [-729.606] * (-725.342) [-728.044] (-728.066) (-727.132) -- 0:00:17
721500 -- (-733.257) (-728.441) (-728.101) [-730.451] * (-726.765) [-728.148] (-727.445) (-726.405) -- 0:00:17
722000 -- (-728.145) (-730.737) (-727.715) [-726.967] * (-729.152) (-726.870) (-725.873) [-726.425] -- 0:00:17
722500 -- (-727.397) [-727.972] (-726.496) (-727.029) * (-728.504) (-731.728) [-725.242] (-727.699) -- 0:00:17
723000 -- [-725.417] (-730.016) (-726.085) (-727.095) * (-727.553) (-728.280) [-725.248] (-730.839) -- 0:00:17
723500 -- (-726.538) [-727.493] (-727.885) (-726.065) * (-727.349) [-725.370] (-725.337) (-727.083) -- 0:00:17
724000 -- [-728.720] (-730.887) (-726.700) (-726.763) * (-727.311) (-726.070) [-727.191] (-727.083) -- 0:00:17
724500 -- (-728.479) (-728.618) (-728.944) [-726.005] * [-727.633] (-727.024) (-733.831) (-728.478) -- 0:00:17
725000 -- (-732.081) [-729.046] (-726.263) (-726.711) * (-726.823) (-730.422) (-730.350) [-726.454] -- 0:00:17
Average standard deviation of split frequencies: 0.006990
725500 -- (-728.405) (-727.970) (-726.189) [-729.221] * (-727.117) [-730.072] (-728.455) (-725.943) -- 0:00:17
726000 -- (-726.455) [-727.390] (-726.731) (-729.406) * (-728.063) (-734.358) [-726.382] (-728.301) -- 0:00:17
726500 -- (-727.624) [-726.775] (-727.494) (-728.882) * (-726.888) [-726.228] (-730.565) (-727.168) -- 0:00:17
727000 -- (-726.525) (-729.871) (-727.142) [-727.145] * (-731.917) (-725.425) [-726.211] (-726.754) -- 0:00:17
727500 -- (-727.110) [-729.051] (-726.725) (-726.926) * (-729.217) [-727.138] (-726.098) (-734.024) -- 0:00:17
728000 -- (-728.982) (-731.241) [-726.635] (-725.332) * (-727.056) (-727.079) [-726.485] (-726.900) -- 0:00:17
728500 -- (-727.578) [-727.655] (-725.825) (-729.367) * (-727.767) (-726.345) [-726.571] (-727.099) -- 0:00:17
729000 -- [-727.321] (-727.507) (-726.447) (-731.631) * (-727.250) (-728.057) [-726.895] (-728.750) -- 0:00:17
729500 -- (-727.285) [-727.240] (-728.977) (-729.741) * (-729.322) (-726.665) (-727.991) [-727.480] -- 0:00:17
730000 -- [-726.243] (-725.862) (-729.798) (-727.496) * (-730.934) [-729.990] (-729.958) (-729.416) -- 0:00:17
Average standard deviation of split frequencies: 0.007135
730500 -- (-728.067) [-725.618] (-729.077) (-725.894) * (-729.262) (-726.585) [-726.936] (-727.301) -- 0:00:16
731000 -- (-727.572) [-727.347] (-726.023) (-729.868) * (-727.717) [-726.628] (-726.826) (-726.624) -- 0:00:16
731500 -- [-727.474] (-727.568) (-727.545) (-726.082) * (-729.326) (-726.597) (-731.777) [-726.359] -- 0:00:16
732000 -- [-731.806] (-728.715) (-727.064) (-727.152) * (-727.725) [-727.974] (-730.024) (-728.307) -- 0:00:16
732500 -- (-725.931) (-727.303) (-726.631) [-726.058] * (-728.376) [-731.739] (-727.340) (-727.972) -- 0:00:16
733000 -- [-726.872] (-726.784) (-727.534) (-727.212) * (-728.386) (-732.015) (-728.669) [-726.166] -- 0:00:16
733500 -- [-726.488] (-732.308) (-729.626) (-728.942) * (-732.678) [-729.849] (-727.592) (-726.555) -- 0:00:16
734000 -- [-728.090] (-727.635) (-728.237) (-729.548) * (-729.347) (-726.754) [-726.187] (-726.683) -- 0:00:16
734500 -- (-729.455) (-726.384) [-725.532] (-728.088) * (-728.612) (-729.054) (-727.362) [-727.139] -- 0:00:16
735000 -- [-725.489] (-727.071) (-726.726) (-727.972) * (-726.774) [-726.533] (-725.868) (-726.825) -- 0:00:16
Average standard deviation of split frequencies: 0.007083
735500 -- [-726.289] (-726.213) (-725.669) (-729.847) * [-725.885] (-726.836) (-725.324) (-726.257) -- 0:00:16
736000 -- [-726.349] (-729.002) (-726.103) (-725.991) * [-725.924] (-726.161) (-725.390) (-731.552) -- 0:00:16
736500 -- (-733.080) [-726.395] (-728.683) (-725.806) * [-728.426] (-727.294) (-725.081) (-727.850) -- 0:00:16
737000 -- (-727.669) (-728.204) (-727.216) [-726.144] * (-725.705) (-725.906) (-727.821) [-726.107] -- 0:00:16
737500 -- (-727.351) (-728.089) (-726.561) [-732.190] * [-726.525] (-727.465) (-729.529) (-729.616) -- 0:00:16
738000 -- (-727.244) [-734.470] (-730.872) (-729.794) * [-725.935] (-725.884) (-727.621) (-727.182) -- 0:00:16
738500 -- (-726.994) (-726.743) (-734.725) [-725.960] * (-726.286) (-728.150) [-728.273] (-725.975) -- 0:00:16
739000 -- (-727.274) (-728.020) (-727.968) [-726.651] * (-726.158) (-726.175) [-727.776] (-727.663) -- 0:00:16
739500 -- [-728.297] (-726.571) (-727.194) (-727.317) * [-727.130] (-726.894) (-726.886) (-734.241) -- 0:00:16
740000 -- (-730.099) (-729.092) (-735.605) [-725.484] * (-726.201) [-727.299] (-726.802) (-727.038) -- 0:00:16
Average standard deviation of split frequencies: 0.007375
740500 -- [-728.424] (-731.042) (-729.131) (-725.432) * (-729.644) [-727.714] (-730.548) (-726.579) -- 0:00:16
741000 -- (-727.907) (-730.822) (-727.896) [-726.078] * (-728.369) (-726.463) (-730.484) [-727.082] -- 0:00:16
741500 -- (-729.172) (-730.180) (-727.635) [-726.008] * (-727.017) (-725.367) (-730.348) [-729.514] -- 0:00:16
742000 -- [-728.528] (-725.795) (-726.682) (-725.888) * (-726.688) (-727.592) [-729.714] (-730.304) -- 0:00:16
742500 -- (-727.240) (-725.408) (-725.907) [-727.532] * (-731.613) (-728.681) (-732.241) [-728.306] -- 0:00:16
743000 -- (-730.133) (-727.975) [-727.763] (-727.945) * (-728.352) [-725.261] (-727.790) (-728.306) -- 0:00:16
743500 -- (-730.379) [-725.708] (-734.181) (-727.022) * [-726.224] (-727.272) (-729.657) (-729.626) -- 0:00:16
744000 -- (-730.175) [-725.892] (-727.420) (-727.206) * [-729.510] (-728.705) (-730.561) (-731.589) -- 0:00:16
744500 -- (-729.701) [-729.080] (-726.861) (-730.490) * [-731.289] (-730.707) (-727.260) (-726.946) -- 0:00:16
745000 -- (-726.332) (-727.666) [-725.907] (-729.328) * (-727.823) (-727.947) (-727.210) [-726.863] -- 0:00:16
Average standard deviation of split frequencies: 0.007657
745500 -- (-727.840) [-734.321] (-726.203) (-730.127) * (-725.973) (-727.219) [-726.995] (-729.562) -- 0:00:16
746000 -- (-729.959) (-731.249) [-727.033] (-725.798) * (-728.894) (-727.414) [-729.627] (-732.313) -- 0:00:16
746500 -- [-726.110] (-726.929) (-725.553) (-727.370) * (-728.061) (-726.892) (-727.693) [-727.731] -- 0:00:15
747000 -- (-727.377) [-728.778] (-726.771) (-726.717) * (-728.343) [-728.070] (-725.529) (-726.356) -- 0:00:15
747500 -- [-726.738] (-729.134) (-729.970) (-726.741) * [-726.503] (-726.850) (-727.850) (-727.570) -- 0:00:15
748000 -- (-728.591) [-726.220] (-728.007) (-726.940) * (-727.887) (-728.406) (-726.908) [-727.452] -- 0:00:15
748500 -- (-728.215) [-726.163] (-729.610) (-726.913) * [-726.968] (-728.340) (-727.059) (-728.195) -- 0:00:15
749000 -- (-726.795) (-728.300) [-728.443] (-726.246) * (-731.089) [-728.951] (-728.170) (-729.186) -- 0:00:15
749500 -- (-726.417) [-726.923] (-727.332) (-729.561) * (-726.583) [-727.260] (-725.488) (-729.371) -- 0:00:15
750000 -- (-727.116) [-726.170] (-729.690) (-731.343) * [-728.832] (-726.103) (-726.899) (-725.617) -- 0:00:15
Average standard deviation of split frequencies: 0.007979
750500 -- (-727.345) (-729.661) [-729.451] (-727.221) * [-726.016] (-726.683) (-727.100) (-730.391) -- 0:00:15
751000 -- [-727.743] (-726.098) (-727.500) (-729.411) * [-727.543] (-727.558) (-727.701) (-728.013) -- 0:00:15
751500 -- [-728.706] (-727.696) (-730.580) (-729.131) * (-726.025) (-725.589) (-728.767) [-725.230] -- 0:00:15
752000 -- (-732.355) (-735.446) (-725.393) [-726.650] * [-726.728] (-729.028) (-728.333) (-725.647) -- 0:00:15
752500 -- [-727.591] (-729.653) (-726.955) (-726.901) * (-726.667) [-727.451] (-732.039) (-727.355) -- 0:00:15
753000 -- (-728.271) (-727.667) (-726.266) [-725.992] * (-725.583) [-729.207] (-726.865) (-728.151) -- 0:00:15
753500 -- (-727.420) [-725.410] (-730.834) (-726.571) * (-726.818) (-733.240) (-726.681) [-727.633] -- 0:00:15
754000 -- (-728.042) [-728.183] (-726.508) (-726.536) * (-728.929) (-728.698) [-726.055] (-728.915) -- 0:00:15
754500 -- (-730.096) (-727.450) (-731.571) [-731.290] * (-731.390) [-728.997] (-731.713) (-727.531) -- 0:00:15
755000 -- (-726.324) (-731.408) [-727.461] (-726.165) * (-726.920) [-728.082] (-727.941) (-730.261) -- 0:00:15
Average standard deviation of split frequencies: 0.008180
755500 -- (-725.625) [-726.824] (-731.405) (-726.031) * [-728.994] (-731.037) (-730.142) (-728.084) -- 0:00:15
756000 -- (-726.169) [-727.001] (-727.536) (-731.189) * (-729.876) (-726.210) (-731.181) [-727.844] -- 0:00:15
756500 -- (-728.226) (-727.436) (-730.953) [-725.756] * (-728.065) (-727.817) (-730.675) [-729.618] -- 0:00:15
757000 -- (-729.158) (-726.335) [-726.031] (-725.551) * (-727.384) (-727.067) (-728.390) [-731.256] -- 0:00:15
757500 -- [-730.639] (-729.143) (-728.806) (-727.535) * (-727.459) [-727.704] (-726.860) (-728.230) -- 0:00:15
758000 -- (-731.073) [-726.969] (-725.727) (-730.298) * (-728.886) (-728.110) [-725.439] (-727.644) -- 0:00:15
758500 -- [-728.851] (-725.497) (-728.801) (-733.507) * (-730.720) [-725.699] (-726.483) (-727.579) -- 0:00:15
759000 -- [-727.682] (-731.655) (-727.450) (-727.344) * (-726.806) (-726.913) (-728.725) [-726.282] -- 0:00:15
759500 -- (-726.927) [-731.550] (-726.900) (-727.489) * (-728.447) (-726.669) [-727.006] (-728.186) -- 0:00:15
760000 -- (-726.661) (-731.326) (-728.718) [-728.887] * (-729.328) (-725.796) (-728.877) [-727.254] -- 0:00:15
Average standard deviation of split frequencies: 0.007692
760500 -- (-726.653) (-726.459) (-727.999) [-731.771] * (-726.062) [-728.305] (-727.143) (-726.726) -- 0:00:15
761000 -- (-728.435) [-727.109] (-727.548) (-731.656) * (-727.987) (-725.892) [-727.543] (-727.802) -- 0:00:15
761500 -- [-730.213] (-732.072) (-730.115) (-726.949) * (-730.005) [-730.520] (-727.412) (-726.319) -- 0:00:15
762000 -- (-727.309) (-726.284) [-729.580] (-730.183) * [-727.477] (-726.574) (-726.692) (-727.079) -- 0:00:14
762500 -- (-726.790) (-726.511) (-727.360) [-727.636] * (-726.905) (-727.382) (-729.380) [-728.983] -- 0:00:14
763000 -- (-727.588) (-725.793) [-729.033] (-733.166) * (-729.549) (-725.719) [-725.359] (-727.269) -- 0:00:14
763500 -- (-729.282) (-726.844) (-726.689) [-727.015] * (-729.461) [-727.260] (-728.705) (-727.922) -- 0:00:14
764000 -- (-728.766) (-726.461) (-727.092) [-727.969] * (-726.089) (-727.447) [-730.979] (-732.319) -- 0:00:14
764500 -- (-731.295) (-728.829) [-725.365] (-730.634) * [-727.579] (-726.051) (-734.084) (-731.152) -- 0:00:14
765000 -- (-730.831) (-726.744) (-727.542) [-731.110] * (-727.706) (-727.976) (-727.000) [-727.147] -- 0:00:14
Average standard deviation of split frequencies: 0.007928
765500 -- (-729.445) [-725.442] (-725.288) (-727.770) * (-725.525) (-725.664) (-727.026) [-726.024] -- 0:00:14
766000 -- (-728.435) (-725.755) [-725.693] (-727.245) * (-730.378) (-725.264) (-727.071) [-726.024] -- 0:00:14
766500 -- (-726.113) (-726.859) [-725.303] (-726.257) * (-727.181) [-728.176] (-727.669) (-727.245) -- 0:00:14
767000 -- (-726.685) (-726.374) (-725.018) [-725.745] * (-728.621) (-727.326) [-726.933] (-727.095) -- 0:00:14
767500 -- [-729.034] (-726.349) (-729.282) (-726.524) * [-725.731] (-728.410) (-727.035) (-726.812) -- 0:00:14
768000 -- (-726.854) (-726.037) (-725.723) [-725.942] * (-727.677) [-729.448] (-727.907) (-727.982) -- 0:00:14
768500 -- (-726.802) [-726.770] (-726.786) (-729.740) * (-726.164) (-728.977) (-725.773) [-726.442] -- 0:00:14
769000 -- [-728.052] (-728.197) (-725.976) (-728.003) * (-732.093) [-729.553] (-728.120) (-726.606) -- 0:00:14
769500 -- (-726.503) [-725.732] (-725.769) (-725.690) * (-725.302) [-733.467] (-727.052) (-727.278) -- 0:00:14
770000 -- (-727.385) (-726.636) (-727.219) [-727.031] * (-727.478) (-727.981) (-727.266) [-730.766] -- 0:00:14
Average standard deviation of split frequencies: 0.007916
770500 -- (-730.137) [-728.355] (-726.788) (-728.456) * (-728.722) (-726.824) (-731.702) [-726.407] -- 0:00:14
771000 -- [-727.619] (-729.379) (-726.932) (-726.598) * (-726.398) [-727.227] (-726.017) (-725.447) -- 0:00:14
771500 -- (-725.432) (-727.801) [-726.202] (-726.295) * (-726.901) (-726.233) (-727.666) [-725.435] -- 0:00:14
772000 -- [-726.098] (-729.450) (-726.318) (-727.947) * (-726.558) [-726.911] (-726.270) (-728.838) -- 0:00:14
772500 -- (-726.595) (-734.064) (-726.768) [-730.015] * (-727.742) (-728.154) [-726.317] (-726.879) -- 0:00:14
773000 -- [-726.843] (-731.976) (-729.057) (-727.494) * (-727.508) (-726.794) (-727.282) [-728.429] -- 0:00:14
773500 -- (-725.928) [-726.883] (-727.210) (-729.920) * (-725.962) (-725.607) [-725.532] (-727.657) -- 0:00:14
774000 -- (-732.754) [-726.504] (-726.959) (-727.567) * (-726.470) (-727.113) (-732.588) [-727.399] -- 0:00:14
774500 -- [-735.752] (-727.129) (-726.727) (-726.905) * (-727.736) (-727.480) (-734.091) [-726.529] -- 0:00:14
775000 -- (-726.291) (-727.229) (-727.885) [-726.188] * (-726.191) (-728.223) (-731.343) [-726.335] -- 0:00:14
Average standard deviation of split frequencies: 0.007969
775500 -- (-726.318) [-726.163] (-727.330) (-725.901) * (-727.831) (-730.677) [-729.727] (-727.243) -- 0:00:14
776000 -- (-726.137) (-726.736) (-726.656) [-725.663] * (-729.776) [-726.215] (-727.673) (-727.257) -- 0:00:14
776500 -- [-727.629] (-725.965) (-726.651) (-726.846) * (-726.427) (-728.240) (-725.444) [-726.268] -- 0:00:14
777000 -- (-727.756) (-725.308) (-725.871) [-726.879] * (-726.253) (-726.367) [-726.823] (-725.723) -- 0:00:14
777500 -- (-727.108) [-729.285] (-726.597) (-728.364) * [-727.720] (-726.881) (-726.521) (-725.899) -- 0:00:14
778000 -- [-726.901] (-729.462) (-726.708) (-730.207) * (-726.599) (-727.765) (-727.499) [-726.035] -- 0:00:13
778500 -- (-729.846) [-729.331] (-725.736) (-727.923) * (-727.876) (-725.968) (-726.145) [-730.409] -- 0:00:13
779000 -- (-727.120) (-731.327) (-725.337) [-726.055] * (-727.607) (-725.932) [-726.837] (-726.719) -- 0:00:13
779500 -- (-728.129) (-726.806) (-726.507) [-726.465] * (-725.910) [-727.093] (-728.402) (-729.486) -- 0:00:13
780000 -- (-728.409) (-725.918) (-729.031) [-725.790] * (-726.044) (-729.109) (-732.904) [-725.711] -- 0:00:13
Average standard deviation of split frequencies: 0.008190
780500 -- (-731.031) (-725.984) [-726.835] (-726.435) * (-729.032) (-725.798) [-726.578] (-728.092) -- 0:00:13
781000 -- (-729.735) [-727.745] (-728.456) (-728.155) * (-727.481) (-728.157) (-727.439) [-729.221] -- 0:00:13
781500 -- (-729.059) (-728.852) [-726.579] (-729.380) * (-727.044) [-728.595] (-729.743) (-729.580) -- 0:00:13
782000 -- (-726.628) (-727.046) [-727.051] (-726.717) * (-727.222) [-728.440] (-730.906) (-725.446) -- 0:00:13
782500 -- (-730.615) [-726.269] (-732.364) (-725.972) * (-726.826) (-727.042) (-726.940) [-727.377] -- 0:00:13
783000 -- (-728.213) [-731.669] (-729.647) (-726.038) * (-728.876) (-728.968) [-726.275] (-725.132) -- 0:00:13
783500 -- [-727.396] (-728.905) (-728.474) (-728.824) * [-727.663] (-727.968) (-730.822) (-725.138) -- 0:00:13
784000 -- (-727.836) (-728.559) (-727.771) [-728.912] * (-727.276) (-725.693) (-727.073) [-725.255] -- 0:00:13
784500 -- (-726.900) [-728.958] (-727.418) (-728.185) * (-728.522) [-726.055] (-729.072) (-725.696) -- 0:00:13
785000 -- [-727.210] (-728.128) (-728.025) (-725.263) * [-727.408] (-725.275) (-725.578) (-732.301) -- 0:00:13
Average standard deviation of split frequencies: 0.008220
785500 -- (-730.795) (-727.381) [-728.029] (-727.236) * [-729.832] (-727.896) (-727.187) (-728.465) -- 0:00:13
786000 -- (-728.704) [-728.456] (-726.557) (-726.765) * (-725.793) (-726.630) [-726.303] (-725.930) -- 0:00:13
786500 -- (-729.442) [-726.801] (-726.554) (-727.111) * [-725.955] (-727.638) (-730.912) (-726.654) -- 0:00:13
787000 -- (-730.417) [-726.137] (-725.950) (-726.848) * (-727.916) (-727.090) (-728.577) [-726.719] -- 0:00:13
787500 -- [-727.769] (-728.738) (-726.939) (-727.659) * (-727.966) (-725.948) (-726.268) [-728.780] -- 0:00:13
788000 -- (-730.540) [-726.659] (-727.446) (-729.651) * (-727.126) (-730.355) [-729.140] (-728.352) -- 0:00:13
788500 -- (-731.875) [-726.653] (-726.781) (-726.678) * (-730.868) (-725.178) (-730.692) [-728.819] -- 0:00:13
789000 -- (-726.816) (-727.206) [-727.053] (-729.115) * [-726.521] (-727.071) (-729.178) (-726.170) -- 0:00:13
789500 -- (-726.105) (-727.253) (-727.351) [-728.393] * (-727.564) [-730.964] (-727.587) (-728.908) -- 0:00:13
790000 -- (-726.172) (-727.193) (-727.211) [-728.862] * [-726.949] (-726.694) (-726.828) (-726.897) -- 0:00:13
Average standard deviation of split frequencies: 0.008066
790500 -- [-727.330] (-726.452) (-728.115) (-728.955) * (-725.849) (-727.577) [-727.022] (-725.467) -- 0:00:13
791000 -- (-727.000) (-726.723) (-730.019) [-728.869] * (-730.036) [-727.967] (-726.900) (-726.140) -- 0:00:13
791500 -- (-727.805) [-729.800] (-729.433) (-728.313) * (-729.758) (-727.423) [-727.326] (-726.335) -- 0:00:13
792000 -- (-727.594) [-731.661] (-726.758) (-729.558) * [-731.760] (-726.403) (-729.847) (-730.520) -- 0:00:13
792500 -- (-726.302) [-725.759] (-728.707) (-725.822) * (-725.972) (-725.839) (-726.648) [-726.834] -- 0:00:13
793000 -- (-726.556) (-732.259) (-730.662) [-725.657] * [-728.185] (-725.715) (-729.643) (-729.533) -- 0:00:13
793500 -- (-726.776) [-731.708] (-729.521) (-726.530) * (-726.831) [-726.062] (-726.317) (-734.574) -- 0:00:13
794000 -- (-726.473) (-728.034) (-727.718) [-726.161] * (-726.108) (-727.095) [-725.623] (-735.238) -- 0:00:12
794500 -- [-727.218] (-729.014) (-725.716) (-726.537) * [-726.268] (-726.052) (-725.299) (-728.962) -- 0:00:12
795000 -- (-725.549) [-727.886] (-726.426) (-728.533) * (-727.783) (-727.181) [-726.773] (-726.853) -- 0:00:12
Average standard deviation of split frequencies: 0.007978
795500 -- (-726.197) (-729.753) (-725.362) [-729.677] * [-727.198] (-726.442) (-726.393) (-726.112) -- 0:00:12
796000 -- (-727.858) (-726.458) [-728.500] (-725.923) * (-727.792) (-731.581) (-727.753) [-726.415] -- 0:00:12
796500 -- (-726.784) [-726.951] (-727.048) (-727.056) * [-726.935] (-725.995) (-729.149) (-727.898) -- 0:00:12
797000 -- (-729.865) [-727.528] (-727.312) (-726.676) * [-727.195] (-727.057) (-729.923) (-728.886) -- 0:00:12
797500 -- (-727.473) [-728.873] (-726.361) (-727.445) * (-727.050) (-727.217) [-725.677] (-728.894) -- 0:00:12
798000 -- (-726.007) (-730.160) (-726.599) [-728.959] * (-727.791) (-729.807) [-727.882] (-726.938) -- 0:00:12
798500 -- (-726.300) (-725.939) (-727.133) [-726.125] * (-729.097) (-729.318) (-728.974) [-726.022] -- 0:00:12
799000 -- (-726.618) (-728.146) [-727.657] (-727.053) * (-729.030) [-727.639] (-730.580) (-726.102) -- 0:00:12
799500 -- (-729.490) [-726.524] (-726.520) (-727.421) * (-730.945) (-726.220) (-729.941) [-725.675] -- 0:00:12
800000 -- (-730.755) [-728.257] (-726.345) (-726.174) * [-731.841] (-728.905) (-727.659) (-725.725) -- 0:00:12
Average standard deviation of split frequencies: 0.007728
800500 -- (-727.938) [-726.953] (-729.732) (-728.069) * (-729.451) [-726.888] (-727.187) (-726.744) -- 0:00:12
801000 -- (-729.744) [-726.854] (-725.829) (-727.568) * [-726.296] (-726.917) (-726.566) (-726.888) -- 0:00:12
801500 -- (-727.222) (-726.660) (-725.981) [-728.906] * [-725.641] (-726.383) (-728.057) (-725.592) -- 0:00:12
802000 -- [-725.655] (-728.274) (-737.296) (-729.821) * [-727.732] (-731.782) (-726.197) (-725.478) -- 0:00:12
802500 -- [-728.373] (-728.125) (-729.850) (-729.770) * (-726.132) [-728.170] (-727.990) (-727.081) -- 0:00:12
803000 -- (-727.137) [-727.339] (-726.223) (-726.666) * (-726.247) (-727.575) (-727.708) [-727.374] -- 0:00:12
803500 -- (-725.863) (-726.826) [-726.291] (-727.114) * (-727.094) (-725.794) (-731.395) [-726.077] -- 0:00:12
804000 -- (-726.475) [-728.808] (-728.220) (-726.428) * (-729.260) [-729.188] (-726.828) (-727.483) -- 0:00:12
804500 -- (-729.849) (-729.226) (-728.696) [-725.247] * (-730.712) (-726.895) (-729.417) [-726.861] -- 0:00:12
805000 -- (-728.304) (-727.530) (-728.253) [-726.845] * [-729.716] (-726.297) (-726.106) (-726.051) -- 0:00:12
Average standard deviation of split frequencies: 0.007672
805500 -- [-728.779] (-729.766) (-728.210) (-728.147) * (-730.707) (-725.667) [-727.191] (-726.989) -- 0:00:12
806000 -- (-732.447) [-726.325] (-728.108) (-726.020) * [-726.959] (-728.631) (-728.071) (-729.827) -- 0:00:12
806500 -- (-726.589) [-725.590] (-729.536) (-725.624) * (-728.699) [-729.503] (-728.130) (-725.523) -- 0:00:12
807000 -- [-727.532] (-726.227) (-728.768) (-730.376) * (-727.265) (-726.281) (-727.595) [-726.104] -- 0:00:12
807500 -- (-728.534) (-728.189) (-729.016) [-728.297] * (-727.506) [-727.772] (-727.320) (-727.411) -- 0:00:12
808000 -- (-727.762) (-728.361) [-726.885] (-728.471) * (-727.086) (-729.921) [-726.432] (-726.881) -- 0:00:12
808500 -- (-729.425) (-728.860) [-727.398] (-727.182) * (-728.289) (-731.052) (-726.040) [-725.514] -- 0:00:12
809000 -- [-726.198] (-725.593) (-725.938) (-726.298) * (-725.463) (-725.996) [-726.076] (-726.184) -- 0:00:12
809500 -- (-726.101) (-727.779) [-726.233] (-728.882) * [-726.281] (-727.568) (-727.237) (-727.630) -- 0:00:12
810000 -- [-726.872] (-728.037) (-725.735) (-726.486) * (-725.541) (-727.273) (-725.540) [-726.453] -- 0:00:11
Average standard deviation of split frequencies: 0.007628
810500 -- (-730.499) (-731.623) (-726.531) [-725.156] * [-727.334] (-727.235) (-728.025) (-727.592) -- 0:00:11
811000 -- [-725.394] (-727.626) (-727.174) (-727.155) * (-729.324) (-726.473) (-730.925) [-726.396] -- 0:00:11
811500 -- (-728.549) (-725.731) [-727.098] (-728.239) * (-725.810) [-725.516] (-726.393) (-728.153) -- 0:00:11
812000 -- (-729.785) (-726.868) [-726.930] (-726.719) * (-725.701) (-728.626) (-725.796) [-726.331] -- 0:00:11
812500 -- (-727.789) (-725.856) [-727.526] (-726.586) * [-726.592] (-726.173) (-729.894) (-731.833) -- 0:00:11
813000 -- (-726.124) [-725.949] (-729.652) (-728.187) * (-725.544) (-726.891) [-725.408] (-726.825) -- 0:00:11
813500 -- (-727.749) (-726.813) (-728.349) [-728.009] * [-726.610] (-727.918) (-729.994) (-727.856) -- 0:00:11
814000 -- (-731.590) [-728.729] (-728.406) (-727.283) * (-728.677) (-729.330) [-729.181] (-727.000) -- 0:00:11
814500 -- (-727.201) [-726.453] (-728.477) (-727.853) * (-726.431) [-727.040] (-726.178) (-726.393) -- 0:00:11
815000 -- (-729.660) [-726.295] (-729.138) (-730.270) * [-731.330] (-727.162) (-728.130) (-727.090) -- 0:00:11
Average standard deviation of split frequencies: 0.007402
815500 -- (-727.611) [-726.292] (-728.361) (-726.234) * (-729.083) [-725.925] (-726.509) (-728.346) -- 0:00:11
816000 -- [-727.273] (-728.293) (-734.656) (-726.108) * (-727.674) (-726.198) [-727.880] (-728.379) -- 0:00:11
816500 -- (-726.371) (-730.261) (-727.417) [-726.946] * (-727.374) [-725.931] (-731.788) (-725.779) -- 0:00:11
817000 -- [-729.505] (-729.230) (-725.118) (-727.401) * (-728.473) (-727.568) (-728.167) [-726.272] -- 0:00:11
817500 -- (-729.132) [-726.440] (-727.308) (-727.733) * (-727.817) [-726.488] (-727.254) (-726.221) -- 0:00:11
818000 -- (-729.283) (-725.282) [-727.490] (-726.687) * [-729.955] (-730.116) (-725.846) (-725.688) -- 0:00:11
818500 -- (-731.745) [-725.513] (-725.495) (-727.398) * (-726.859) [-726.925] (-728.423) (-726.608) -- 0:00:11
819000 -- (-728.738) (-734.483) [-726.914] (-725.337) * [-729.844] (-725.596) (-727.620) (-731.081) -- 0:00:11
819500 -- (-731.300) (-731.832) [-726.065] (-729.931) * [-729.889] (-729.591) (-728.931) (-727.826) -- 0:00:11
820000 -- (-725.288) (-728.899) (-726.486) [-726.576] * (-726.108) [-726.367] (-727.380) (-727.096) -- 0:00:11
Average standard deviation of split frequencies: 0.007826
820500 -- (-730.448) (-725.354) (-727.582) [-727.400] * [-726.308] (-726.549) (-731.455) (-726.643) -- 0:00:11
821000 -- (-725.868) (-726.652) (-725.729) [-726.257] * [-726.921] (-728.271) (-725.586) (-726.748) -- 0:00:11
821500 -- (-727.825) (-726.847) (-730.140) [-729.522] * (-728.717) [-728.916] (-726.998) (-726.497) -- 0:00:11
822000 -- [-726.843] (-729.184) (-727.808) (-728.373) * [-728.322] (-726.234) (-727.926) (-731.548) -- 0:00:11
822500 -- [-728.223] (-734.717) (-726.495) (-727.329) * (-728.823) (-726.568) (-728.667) [-727.086] -- 0:00:11
823000 -- (-726.134) [-731.452] (-725.726) (-728.689) * (-725.818) [-726.680] (-728.223) (-727.151) -- 0:00:11
823500 -- [-727.183] (-728.087) (-726.579) (-727.091) * (-727.816) [-729.107] (-728.885) (-726.069) -- 0:00:11
824000 -- (-727.639) [-727.658] (-728.321) (-726.096) * [-727.362] (-728.007) (-728.191) (-726.130) -- 0:00:11
824500 -- (-726.323) (-728.693) [-727.907] (-726.305) * [-727.426] (-727.157) (-731.988) (-726.260) -- 0:00:11
825000 -- (-729.148) [-727.151] (-725.249) (-728.731) * (-727.400) (-726.766) [-725.526] (-725.755) -- 0:00:11
Average standard deviation of split frequencies: 0.008594
825500 -- (-727.253) (-727.809) (-726.137) [-730.937] * (-729.006) [-728.192] (-726.924) (-726.325) -- 0:00:10
826000 -- (-725.404) (-726.772) [-727.307] (-727.114) * [-730.130] (-726.676) (-726.503) (-727.827) -- 0:00:10
826500 -- (-735.674) (-725.858) [-728.783] (-727.175) * (-728.440) [-727.576] (-726.839) (-726.629) -- 0:00:10
827000 -- (-730.513) [-726.499] (-728.228) (-726.973) * (-728.933) (-726.559) (-729.662) [-727.179] -- 0:00:10
827500 -- (-726.589) (-725.841) [-725.877] (-726.079) * (-729.385) (-729.237) [-729.782] (-728.247) -- 0:00:10
828000 -- (-728.003) [-726.279] (-729.150) (-727.473) * (-730.224) (-729.339) [-729.103] (-730.352) -- 0:00:10
828500 -- [-729.217] (-726.658) (-727.173) (-728.311) * (-728.016) (-726.890) (-730.530) [-729.555] -- 0:00:10
829000 -- [-728.359] (-726.606) (-726.702) (-727.256) * (-726.111) (-727.583) (-725.833) [-728.558] -- 0:00:10
829500 -- (-729.558) (-730.109) (-726.272) [-728.926] * (-727.269) (-729.860) [-728.370] (-726.648) -- 0:00:10
830000 -- (-729.516) [-727.163] (-728.757) (-728.871) * (-727.302) (-727.146) [-727.650] (-726.478) -- 0:00:10
Average standard deviation of split frequencies: 0.008913
830500 -- (-727.854) (-727.166) (-728.219) [-726.033] * [-725.744] (-727.952) (-727.804) (-730.245) -- 0:00:10
831000 -- (-726.512) (-728.246) [-730.252] (-726.910) * (-725.815) [-730.642] (-727.171) (-728.064) -- 0:00:10
831500 -- [-725.864] (-727.748) (-729.896) (-726.531) * [-727.222] (-727.228) (-732.552) (-726.828) -- 0:00:10
832000 -- [-727.948] (-726.099) (-729.155) (-726.486) * (-725.643) (-727.153) (-727.052) [-726.321] -- 0:00:10
832500 -- (-727.412) (-727.123) (-733.134) [-727.298] * (-727.878) (-726.945) (-731.308) [-726.826] -- 0:00:10
833000 -- (-727.091) (-727.737) (-726.060) [-727.444] * (-727.594) (-726.432) [-727.348] (-729.123) -- 0:00:10
833500 -- (-726.412) [-728.447] (-726.724) (-726.667) * [-726.422] (-726.498) (-727.533) (-728.767) -- 0:00:10
834000 -- [-726.655] (-725.961) (-729.472) (-728.444) * (-727.753) [-726.817] (-728.062) (-729.209) -- 0:00:10
834500 -- (-728.492) [-729.775] (-726.354) (-729.033) * (-727.675) [-726.288] (-727.817) (-727.447) -- 0:00:10
835000 -- [-726.705] (-727.502) (-726.107) (-733.972) * (-725.806) (-725.701) [-727.865] (-731.957) -- 0:00:10
Average standard deviation of split frequencies: 0.008599
835500 -- (-725.881) (-725.714) (-725.915) [-729.412] * (-725.539) (-725.658) [-727.312] (-727.636) -- 0:00:10
836000 -- [-726.326] (-735.011) (-725.804) (-728.964) * [-725.472] (-727.945) (-726.614) (-726.704) -- 0:00:10
836500 -- (-729.282) (-730.302) [-725.507] (-727.064) * (-726.551) (-728.843) [-726.109] (-726.976) -- 0:00:10
837000 -- (-728.973) [-726.545] (-726.405) (-726.279) * (-727.757) (-726.670) (-726.893) [-726.793] -- 0:00:10
837500 -- [-728.113] (-727.194) (-726.397) (-725.650) * (-728.617) (-731.680) (-727.025) [-727.855] -- 0:00:10
838000 -- (-729.361) (-726.339) (-726.548) [-725.483] * (-726.252) [-725.671] (-726.956) (-731.080) -- 0:00:10
838500 -- (-725.934) [-728.337] (-731.718) (-727.302) * [-726.838] (-728.869) (-725.517) (-725.898) -- 0:00:10
839000 -- (-726.499) [-727.267] (-729.090) (-726.566) * (-727.756) (-730.896) [-725.887] (-726.634) -- 0:00:10
839500 -- (-733.660) (-727.954) (-728.604) [-728.284] * (-728.423) (-726.590) (-727.002) [-726.768] -- 0:00:10
840000 -- (-726.960) (-727.903) (-727.072) [-725.637] * [-726.694] (-730.251) (-728.972) (-729.787) -- 0:00:10
Average standard deviation of split frequencies: 0.008727
840500 -- (-729.080) (-727.574) [-726.629] (-726.623) * (-726.040) [-726.246] (-728.550) (-728.120) -- 0:00:10
841000 -- (-725.911) (-725.540) [-729.655] (-726.362) * (-726.545) (-728.235) [-729.828] (-728.171) -- 0:00:10
841500 -- [-735.739] (-725.144) (-731.971) (-728.272) * (-727.337) (-727.722) [-725.902] (-727.228) -- 0:00:09
842000 -- [-728.691] (-725.976) (-726.592) (-727.614) * (-728.286) [-730.991] (-727.295) (-726.343) -- 0:00:09
842500 -- (-726.205) [-725.314] (-727.420) (-727.483) * (-731.546) (-727.719) [-728.500] (-727.544) -- 0:00:09
843000 -- (-725.555) (-727.833) [-725.308] (-725.849) * (-731.230) (-727.648) [-726.797] (-725.922) -- 0:00:09
843500 -- [-726.244] (-727.442) (-727.118) (-728.157) * (-727.803) (-729.768) (-729.490) [-728.943] -- 0:00:09
844000 -- [-727.604] (-726.733) (-728.267) (-726.366) * (-727.146) [-726.878] (-726.723) (-732.993) -- 0:00:09
844500 -- (-728.321) (-730.558) (-726.613) [-725.157] * (-731.082) [-726.614] (-726.870) (-727.279) -- 0:00:09
845000 -- (-726.944) [-730.185] (-728.724) (-729.133) * (-727.848) (-726.977) (-728.786) [-728.147] -- 0:00:09
Average standard deviation of split frequencies: 0.008811
845500 -- [-729.172] (-726.935) (-728.216) (-725.793) * [-726.052] (-728.606) (-726.027) (-725.601) -- 0:00:09
846000 -- [-728.571] (-726.934) (-727.511) (-728.025) * (-728.343) [-727.247] (-728.040) (-726.231) -- 0:00:09
846500 -- (-728.375) (-726.000) (-730.880) [-726.702] * (-726.958) (-725.742) [-727.649] (-726.777) -- 0:00:09
847000 -- (-731.232) (-728.255) (-728.270) [-726.453] * (-725.799) [-727.230] (-730.221) (-729.161) -- 0:00:09
847500 -- (-725.346) (-727.907) [-728.853] (-726.437) * (-726.693) (-730.090) (-731.302) [-728.064] -- 0:00:09
848000 -- [-725.893] (-726.752) (-730.450) (-726.264) * [-727.022] (-728.955) (-729.494) (-726.270) -- 0:00:09
848500 -- [-727.386] (-731.997) (-733.208) (-725.962) * (-725.779) [-729.993] (-728.968) (-730.503) -- 0:00:09
849000 -- (-725.546) (-730.216) (-729.639) [-726.855] * (-728.001) (-728.675) (-726.229) [-727.106] -- 0:00:09
849500 -- (-727.083) (-727.380) (-727.003) [-726.771] * [-726.263] (-729.577) (-728.528) (-728.826) -- 0:00:09
850000 -- (-727.316) (-728.646) [-728.319] (-725.688) * (-727.589) (-729.899) [-727.036] (-727.660) -- 0:00:09
Average standard deviation of split frequencies: 0.008936
850500 -- [-730.436] (-728.110) (-726.483) (-729.433) * (-731.485) (-725.897) [-726.185] (-728.983) -- 0:00:09
851000 -- (-728.646) (-728.101) [-725.398] (-728.784) * (-725.272) [-725.680] (-727.432) (-733.332) -- 0:00:09
851500 -- [-725.774] (-726.750) (-726.431) (-728.694) * [-726.426] (-725.869) (-727.495) (-728.144) -- 0:00:09
852000 -- (-727.257) [-725.718] (-726.768) (-734.321) * (-728.346) (-729.361) (-726.474) [-728.518] -- 0:00:09
852500 -- [-725.833] (-727.125) (-727.489) (-726.381) * (-731.858) [-725.774] (-728.190) (-729.938) -- 0:00:09
853000 -- (-732.174) (-730.103) [-728.551] (-726.152) * (-728.577) (-727.988) (-727.232) [-725.455] -- 0:00:09
853500 -- (-727.037) [-728.643] (-726.683) (-728.930) * (-727.701) (-732.444) (-726.175) [-725.448] -- 0:00:09
854000 -- (-728.109) [-727.639] (-727.778) (-726.244) * (-730.658) [-735.255] (-728.726) (-727.882) -- 0:00:09
854500 -- (-726.905) (-727.747) (-730.944) [-726.444] * (-734.129) (-730.031) (-730.756) [-730.760] -- 0:00:09
855000 -- (-726.572) [-725.117] (-727.626) (-727.382) * (-732.888) (-726.088) [-728.161] (-728.216) -- 0:00:09
Average standard deviation of split frequencies: 0.008949
855500 -- [-734.220] (-726.439) (-727.926) (-729.750) * (-727.122) (-726.445) (-728.374) [-726.507] -- 0:00:09
856000 -- (-729.869) [-726.801] (-727.834) (-727.994) * (-727.881) (-730.039) (-726.954) [-730.403] -- 0:00:09
856500 -- (-726.751) [-727.171] (-725.715) (-726.100) * [-726.676] (-727.299) (-727.426) (-728.419) -- 0:00:09
857000 -- (-727.211) (-726.668) (-727.434) [-728.695] * (-726.429) (-726.533) (-729.884) [-728.584] -- 0:00:09
857500 -- [-728.974] (-726.435) (-726.212) (-727.332) * [-728.903] (-725.912) (-728.192) (-728.807) -- 0:00:08
858000 -- (-727.006) (-727.871) (-726.120) [-727.194] * [-726.401] (-726.205) (-726.872) (-728.839) -- 0:00:08
858500 -- [-725.767] (-728.735) (-727.963) (-729.936) * (-728.919) (-731.976) [-730.815] (-728.618) -- 0:00:08
859000 -- (-728.374) [-727.242] (-728.669) (-728.061) * (-727.786) (-729.028) [-725.440] (-729.613) -- 0:00:08
859500 -- (-730.219) (-726.774) [-727.188] (-725.489) * (-726.334) (-729.395) [-726.008] (-728.747) -- 0:00:08
860000 -- (-725.853) [-729.802] (-727.057) (-726.038) * [-726.004] (-727.322) (-726.091) (-726.754) -- 0:00:08
Average standard deviation of split frequencies: 0.009003
860500 -- (-726.706) (-731.600) (-726.298) [-729.423] * (-728.237) (-728.068) (-727.682) [-725.892] -- 0:00:08
861000 -- [-727.395] (-727.362) (-727.457) (-729.641) * [-728.514] (-727.696) (-730.511) (-726.838) -- 0:00:08
861500 -- (-726.754) (-728.061) (-731.339) [-725.337] * [-725.747] (-728.401) (-727.202) (-727.615) -- 0:00:08
862000 -- (-725.777) [-725.533] (-727.275) (-727.161) * [-728.648] (-728.712) (-728.654) (-726.915) -- 0:00:08
862500 -- (-728.433) (-726.731) [-729.122] (-725.999) * (-726.297) (-727.322) (-728.702) [-727.861] -- 0:00:08
863000 -- (-725.377) (-727.147) [-727.172] (-726.107) * (-725.944) [-726.528] (-725.859) (-727.865) -- 0:00:08
863500 -- (-728.761) [-730.632] (-728.963) (-727.464) * [-726.994] (-725.881) (-725.684) (-726.563) -- 0:00:08
864000 -- (-727.655) [-726.332] (-726.307) (-728.605) * [-727.219] (-729.017) (-726.014) (-726.064) -- 0:00:08
864500 -- (-727.800) [-725.750] (-728.694) (-726.042) * [-727.690] (-728.272) (-728.084) (-728.571) -- 0:00:08
865000 -- (-727.683) [-727.125] (-731.407) (-731.627) * (-727.721) (-727.640) (-727.094) [-730.871] -- 0:00:08
Average standard deviation of split frequencies: 0.009318
865500 -- (-730.975) [-727.691] (-725.797) (-730.393) * (-727.867) [-729.199] (-725.222) (-727.790) -- 0:00:08
866000 -- (-726.653) (-725.340) (-727.382) [-733.539] * [-729.794] (-727.194) (-725.429) (-728.116) -- 0:00:08
866500 -- [-730.162] (-727.623) (-727.333) (-733.274) * (-728.880) (-727.547) [-725.829] (-728.763) -- 0:00:08
867000 -- (-726.951) (-727.230) [-728.115] (-728.777) * (-731.355) (-728.373) [-725.579] (-731.139) -- 0:00:08
867500 -- (-726.246) [-725.539] (-727.270) (-732.447) * (-730.378) (-727.268) (-725.973) [-725.769] -- 0:00:08
868000 -- [-728.768] (-727.076) (-727.317) (-727.388) * (-729.384) (-726.824) [-729.669] (-725.671) -- 0:00:08
868500 -- (-731.786) (-726.221) (-732.427) [-727.648] * (-725.178) (-726.637) [-728.402] (-726.684) -- 0:00:08
869000 -- (-726.454) [-730.005] (-730.582) (-728.422) * [-725.941] (-728.765) (-729.633) (-732.295) -- 0:00:08
869500 -- (-726.120) (-731.164) [-727.469] (-727.855) * (-728.061) (-728.295) (-725.325) [-728.195] -- 0:00:08
870000 -- (-726.895) (-731.635) [-727.877] (-731.419) * (-730.625) [-725.991] (-728.160) (-728.189) -- 0:00:08
Average standard deviation of split frequencies: 0.009714
870500 -- (-730.318) [-726.506] (-728.819) (-728.968) * (-728.998) [-726.765] (-726.648) (-725.867) -- 0:00:08
871000 -- [-727.798] (-726.816) (-725.847) (-728.796) * [-727.649] (-730.676) (-732.471) (-728.768) -- 0:00:08
871500 -- (-725.588) (-727.386) (-728.191) [-728.940] * (-729.298) (-730.816) (-730.988) [-726.284] -- 0:00:08
872000 -- [-729.137] (-726.111) (-730.801) (-728.506) * (-727.590) (-726.677) (-726.432) [-727.747] -- 0:00:08
872500 -- [-725.414] (-731.685) (-731.134) (-730.590) * [-726.279] (-728.246) (-726.599) (-726.585) -- 0:00:08
873000 -- (-726.250) (-732.665) [-726.750] (-728.145) * (-725.824) [-731.247] (-727.017) (-731.437) -- 0:00:08
873500 -- (-725.913) (-734.107) (-732.182) [-725.743] * (-725.969) (-727.680) [-727.256] (-731.520) -- 0:00:07
874000 -- (-728.439) (-732.083) [-728.991] (-729.301) * [-726.511] (-726.467) (-727.386) (-727.144) -- 0:00:07
874500 -- (-728.424) [-728.336] (-728.125) (-731.082) * (-729.482) (-727.923) (-731.930) [-726.042] -- 0:00:07
875000 -- (-725.885) (-727.961) (-726.349) [-725.809] * (-728.687) [-726.446] (-726.905) (-725.705) -- 0:00:07
Average standard deviation of split frequencies: 0.009417
875500 -- (-726.580) (-728.417) [-727.171] (-727.533) * [-733.432] (-729.083) (-726.606) (-725.542) -- 0:00:07
876000 -- (-726.684) (-726.455) (-726.868) [-726.659] * (-727.970) (-725.741) [-728.765] (-729.201) -- 0:00:07
876500 -- (-727.012) [-726.621] (-725.694) (-725.739) * [-729.666] (-730.771) (-727.255) (-728.247) -- 0:00:07
877000 -- (-726.313) [-730.232] (-734.285) (-727.131) * (-727.658) (-726.015) (-726.192) [-732.055] -- 0:00:07
877500 -- (-725.617) (-728.890) (-734.754) [-727.775] * (-727.189) [-729.579] (-727.815) (-729.887) -- 0:00:07
878000 -- [-725.728] (-732.579) (-731.533) (-726.331) * (-727.057) (-727.708) [-725.335] (-727.706) -- 0:00:07
878500 -- (-725.728) (-733.895) (-726.577) [-728.761] * [-726.275] (-731.530) (-727.723) (-730.108) -- 0:00:07
879000 -- (-725.659) (-727.471) (-726.369) [-728.639] * (-726.607) (-730.748) (-725.460) [-727.981] -- 0:00:07
879500 -- (-728.554) (-725.384) [-728.216] (-737.344) * (-727.750) (-729.940) (-727.617) [-727.618] -- 0:00:07
880000 -- (-727.030) [-726.858] (-728.497) (-726.325) * (-727.602) (-728.986) [-728.146] (-730.087) -- 0:00:07
Average standard deviation of split frequencies: 0.009367
880500 -- (-726.911) (-730.814) (-725.880) [-727.493] * [-729.962] (-726.143) (-728.163) (-729.168) -- 0:00:07
881000 -- [-726.513] (-728.728) (-725.846) (-726.611) * (-727.350) [-727.643] (-726.664) (-731.268) -- 0:00:07
881500 -- (-727.090) (-727.067) [-729.401] (-726.663) * (-725.895) [-734.345] (-728.891) (-727.193) -- 0:00:07
882000 -- (-726.707) (-730.972) [-731.002] (-728.309) * (-729.693) (-728.921) (-727.470) [-726.050] -- 0:00:07
882500 -- [-727.233] (-725.183) (-728.656) (-727.263) * [-726.147] (-727.861) (-725.880) (-726.025) -- 0:00:07
883000 -- (-726.555) [-725.190] (-728.075) (-726.587) * (-726.558) (-728.174) [-727.379] (-726.320) -- 0:00:07
883500 -- (-725.731) (-726.233) (-729.728) [-727.086] * (-730.302) (-729.108) [-726.278] (-728.375) -- 0:00:07
884000 -- (-725.785) (-727.433) [-727.244] (-725.483) * (-729.381) [-727.226] (-726.539) (-733.014) -- 0:00:07
884500 -- (-726.657) [-727.089] (-728.907) (-726.148) * (-730.689) (-731.017) [-726.894] (-725.837) -- 0:00:07
885000 -- [-726.993] (-727.416) (-725.603) (-726.859) * (-727.062) (-729.030) (-727.248) [-726.302] -- 0:00:07
Average standard deviation of split frequencies: 0.009211
885500 -- (-725.562) [-726.785] (-727.666) (-730.576) * (-727.292) (-727.212) (-726.252) [-726.302] -- 0:00:07
886000 -- [-726.177] (-726.431) (-727.683) (-728.749) * (-728.141) (-729.971) [-726.323] (-726.515) -- 0:00:07
886500 -- [-726.074] (-727.815) (-727.189) (-725.975) * (-729.437) (-728.968) [-726.596] (-727.428) -- 0:00:07
887000 -- (-727.873) [-726.678] (-727.189) (-726.130) * (-728.509) (-726.167) [-725.932] (-728.527) -- 0:00:07
887500 -- (-726.607) (-728.070) [-726.659] (-728.647) * (-728.136) [-726.433] (-727.583) (-727.714) -- 0:00:07
888000 -- (-726.581) [-726.218] (-732.092) (-729.345) * (-730.608) (-727.943) (-726.716) [-725.587] -- 0:00:07
888500 -- (-730.480) (-726.680) (-728.021) [-726.486] * [-729.536] (-727.331) (-727.174) (-726.206) -- 0:00:07
889000 -- (-728.902) (-727.157) [-726.475] (-731.643) * (-726.690) [-729.342] (-727.412) (-725.577) -- 0:00:06
889500 -- (-727.065) (-728.807) [-727.063] (-725.342) * (-726.879) (-731.403) [-727.418] (-727.493) -- 0:00:06
890000 -- (-727.152) [-731.911] (-730.131) (-727.853) * [-727.526] (-725.864) (-727.090) (-725.401) -- 0:00:06
Average standard deviation of split frequencies: 0.008998
890500 -- (-728.603) (-727.282) [-727.313] (-729.343) * (-726.002) [-726.347] (-728.257) (-725.501) -- 0:00:06
891000 -- (-727.456) (-728.252) (-725.686) [-728.392] * (-726.439) (-726.929) [-726.798] (-727.001) -- 0:00:06
891500 -- (-727.847) (-726.422) [-726.388] (-726.444) * [-728.294] (-728.191) (-727.792) (-728.009) -- 0:00:06
892000 -- (-727.423) (-726.500) [-726.337] (-729.355) * (-728.182) (-728.567) [-726.949] (-728.953) -- 0:00:06
892500 -- (-726.394) (-728.485) (-726.832) [-730.064] * [-729.597] (-727.180) (-728.950) (-726.234) -- 0:00:06
893000 -- [-726.159] (-725.759) (-725.410) (-730.125) * (-727.900) (-728.768) [-725.956] (-726.237) -- 0:00:06
893500 -- [-726.431] (-727.101) (-730.881) (-727.901) * (-727.557) (-730.163) [-725.837] (-726.089) -- 0:00:06
894000 -- [-728.597] (-727.752) (-728.119) (-728.850) * [-726.812] (-728.322) (-725.188) (-725.856) -- 0:00:06
894500 -- [-727.511] (-726.718) (-731.841) (-726.622) * (-729.008) [-727.011] (-727.324) (-727.272) -- 0:00:06
895000 -- (-730.035) (-733.941) (-728.550) [-726.885] * (-726.789) (-727.216) (-727.559) [-725.328] -- 0:00:06
Average standard deviation of split frequencies: 0.008977
895500 -- (-727.715) (-728.230) [-727.653] (-725.527) * [-725.937] (-727.337) (-727.745) (-725.352) -- 0:00:06
896000 -- [-727.651] (-726.653) (-727.355) (-726.265) * (-727.041) [-727.056] (-727.642) (-730.940) -- 0:00:06
896500 -- [-725.972] (-726.985) (-728.960) (-731.701) * (-726.813) [-725.846] (-727.622) (-728.355) -- 0:00:06
897000 -- (-725.226) (-725.138) (-734.614) [-727.695] * (-726.082) [-727.966] (-725.857) (-728.588) -- 0:00:06
897500 -- [-728.091] (-725.667) (-733.762) (-728.474) * (-726.090) [-729.753] (-725.744) (-726.507) -- 0:00:06
898000 -- (-730.411) [-728.130] (-727.835) (-726.640) * (-726.028) (-731.317) (-726.975) [-725.734] -- 0:00:06
898500 -- (-726.940) (-726.512) (-728.073) [-725.715] * (-725.977) (-731.965) [-727.084] (-725.691) -- 0:00:06
899000 -- [-727.313] (-727.781) (-730.122) (-725.866) * (-727.430) (-726.416) (-731.433) [-726.813] -- 0:00:06
899500 -- (-726.668) [-727.096] (-726.948) (-725.432) * (-727.278) (-728.360) [-726.941] (-728.667) -- 0:00:06
900000 -- [-726.682] (-727.275) (-727.735) (-726.697) * (-728.015) (-726.481) (-731.762) [-728.712] -- 0:00:06
Average standard deviation of split frequencies: 0.008603
900500 -- (-728.307) (-726.657) [-725.790] (-727.953) * (-725.910) (-726.911) [-725.554] (-729.300) -- 0:00:06
901000 -- (-725.262) (-727.050) (-730.179) [-727.408] * [-729.105] (-725.812) (-727.705) (-730.281) -- 0:00:06
901500 -- (-727.449) (-726.129) (-726.492) [-726.077] * (-727.024) (-727.520) [-729.513] (-729.760) -- 0:00:06
902000 -- [-725.597] (-727.873) (-726.998) (-726.085) * (-725.568) (-727.249) (-729.388) [-727.930] -- 0:00:06
902500 -- [-725.845] (-727.719) (-726.765) (-725.297) * [-728.042] (-729.817) (-730.050) (-726.059) -- 0:00:06
903000 -- (-726.760) [-727.848] (-728.248) (-725.411) * [-727.328] (-728.155) (-726.214) (-727.635) -- 0:00:06
903500 -- (-726.451) (-727.794) (-725.720) [-726.654] * (-725.434) [-730.590] (-725.374) (-726.796) -- 0:00:06
904000 -- (-728.571) (-727.149) (-730.595) [-731.038] * (-727.422) (-726.397) (-725.506) [-725.540] -- 0:00:06
904500 -- (-729.418) (-726.011) (-726.962) [-727.816] * (-726.956) (-726.701) [-725.506] (-730.872) -- 0:00:06
905000 -- [-727.141] (-727.982) (-730.937) (-729.464) * [-727.522] (-727.327) (-725.542) (-727.643) -- 0:00:05
Average standard deviation of split frequencies: 0.009138
905500 -- (-726.184) (-726.533) (-730.359) [-729.049] * (-725.723) (-725.107) [-725.760] (-727.436) -- 0:00:05
906000 -- (-727.021) (-728.284) (-726.774) [-726.035] * (-725.528) (-731.627) [-726.197] (-732.565) -- 0:00:05
906500 -- (-728.493) (-725.994) (-732.703) [-726.175] * (-729.807) [-733.455] (-726.365) (-727.672) -- 0:00:05
907000 -- (-730.080) (-732.050) (-730.244) [-728.217] * [-726.671] (-733.055) (-726.284) (-725.985) -- 0:00:05
907500 -- (-727.210) [-728.808] (-728.586) (-728.151) * (-728.142) (-726.313) [-728.112] (-726.600) -- 0:00:05
908000 -- (-728.274) (-726.662) (-727.821) [-726.108] * [-725.592] (-727.380) (-730.268) (-730.711) -- 0:00:05
908500 -- (-728.207) (-726.463) [-731.178] (-727.600) * (-727.961) (-728.961) [-728.319] (-727.847) -- 0:00:05
909000 -- [-726.569] (-730.310) (-727.666) (-728.080) * [-726.537] (-726.904) (-726.281) (-726.754) -- 0:00:05
909500 -- [-726.467] (-729.238) (-730.118) (-728.989) * (-726.578) (-729.330) [-726.446] (-727.129) -- 0:00:05
910000 -- (-731.050) [-726.827] (-728.511) (-729.062) * (-726.952) (-728.166) [-728.333] (-728.697) -- 0:00:05
Average standard deviation of split frequencies: 0.009221
910500 -- (-727.081) [-727.943] (-730.353) (-727.526) * (-729.405) (-735.342) [-726.197] (-731.804) -- 0:00:05
911000 -- (-727.286) (-726.185) [-726.753] (-726.115) * (-734.097) (-726.596) (-728.541) [-727.815] -- 0:00:05
911500 -- (-727.176) (-726.346) (-730.064) [-726.476] * (-726.703) (-728.591) [-725.870] (-727.348) -- 0:00:05
912000 -- (-728.922) (-730.895) (-730.218) [-728.252] * (-728.283) [-727.721] (-732.187) (-727.058) -- 0:00:05
912500 -- [-728.587] (-732.838) (-726.115) (-728.234) * (-727.671) (-735.923) (-730.398) [-729.829] -- 0:00:05
913000 -- (-730.052) (-726.919) (-727.999) [-729.031] * (-728.229) [-731.462] (-731.453) (-728.609) -- 0:00:05
913500 -- (-728.575) [-725.912] (-726.491) (-726.788) * [-728.485] (-727.927) (-731.269) (-728.759) -- 0:00:05
914000 -- (-727.787) (-726.146) (-726.826) [-727.579] * (-726.291) [-725.654] (-726.262) (-727.984) -- 0:00:05
914500 -- (-726.572) (-727.011) (-726.544) [-727.050] * (-729.244) (-725.627) [-728.080] (-727.263) -- 0:00:05
915000 -- (-726.329) (-727.489) [-728.486] (-727.901) * (-729.640) (-725.818) [-727.612] (-725.290) -- 0:00:05
Average standard deviation of split frequencies: 0.009424
915500 -- (-729.350) (-727.672) [-727.378] (-726.296) * (-730.712) [-726.677] (-725.609) (-725.456) -- 0:00:05
916000 -- (-729.151) (-732.714) (-729.769) [-731.241] * [-728.669] (-726.530) (-727.696) (-729.024) -- 0:00:05
916500 -- (-729.640) (-726.626) (-731.281) [-726.813] * (-728.220) [-727.123] (-725.537) (-726.981) -- 0:00:05
917000 -- (-728.422) (-727.803) [-726.920] (-727.551) * (-729.302) [-726.481] (-725.831) (-727.116) -- 0:00:05
917500 -- [-726.661] (-731.410) (-726.407) (-725.584) * (-726.409) (-738.430) (-725.564) [-727.281] -- 0:00:05
918000 -- [-727.531] (-725.203) (-727.189) (-725.903) * (-725.853) (-728.067) [-726.080] (-727.509) -- 0:00:05
918500 -- (-730.308) (-729.165) (-725.924) [-725.392] * [-727.393] (-726.825) (-729.219) (-731.566) -- 0:00:05
919000 -- (-727.662) [-727.193] (-726.661) (-726.890) * (-726.756) [-729.581] (-729.162) (-727.780) -- 0:00:05
919500 -- (-729.373) (-729.379) [-727.368] (-726.037) * (-726.830) (-725.802) (-727.956) [-727.713] -- 0:00:04
920000 -- (-726.565) (-733.002) [-727.694] (-727.425) * (-729.372) (-726.512) (-728.147) [-728.461] -- 0:00:04
Average standard deviation of split frequencies: 0.009376
920500 -- (-728.962) [-730.917] (-727.110) (-726.434) * (-726.613) [-726.781] (-726.597) (-731.222) -- 0:00:05
921000 -- (-731.209) (-731.334) (-728.051) [-729.221] * (-726.888) (-727.399) [-727.439] (-727.152) -- 0:00:04
921500 -- [-726.696] (-727.436) (-725.790) (-725.646) * [-726.433] (-727.997) (-727.868) (-727.717) -- 0:00:04
922000 -- [-728.751] (-727.215) (-725.830) (-725.795) * (-727.152) (-727.414) [-731.508] (-728.771) -- 0:00:04
922500 -- [-728.680] (-726.067) (-730.236) (-725.926) * [-725.872] (-727.746) (-727.707) (-727.544) -- 0:00:04
923000 -- (-730.293) (-726.380) (-726.036) [-728.103] * (-727.913) [-726.702] (-726.220) (-726.204) -- 0:00:04
923500 -- (-726.451) (-729.784) (-726.026) [-726.604] * (-725.545) (-728.083) (-726.443) [-728.157] -- 0:00:04
924000 -- [-728.554] (-725.406) (-726.958) (-725.821) * (-726.658) (-726.193) (-726.470) [-726.797] -- 0:00:04
924500 -- (-727.153) (-727.204) [-727.746] (-725.821) * (-728.367) [-727.310] (-728.819) (-727.904) -- 0:00:04
925000 -- [-727.946] (-729.393) (-729.194) (-729.817) * (-728.406) (-729.944) [-729.432] (-730.175) -- 0:00:04
Average standard deviation of split frequencies: 0.009322
925500 -- (-731.499) (-727.786) [-726.852] (-726.486) * (-727.399) (-731.525) [-726.473] (-732.455) -- 0:00:04
926000 -- (-730.550) (-727.792) (-726.747) [-726.313] * (-727.388) (-728.207) [-726.559] (-727.541) -- 0:00:04
926500 -- (-730.146) [-726.854] (-730.734) (-726.380) * (-727.702) [-732.322] (-725.592) (-729.086) -- 0:00:04
927000 -- (-726.009) (-725.926) [-729.153] (-726.883) * [-729.636] (-728.649) (-726.277) (-726.849) -- 0:00:04
927500 -- [-726.836] (-725.579) (-728.833) (-725.780) * (-726.530) [-733.110] (-726.102) (-726.259) -- 0:00:04
928000 -- (-729.535) (-730.714) [-726.057] (-730.411) * (-726.267) (-731.660) [-727.845] (-727.569) -- 0:00:04
928500 -- (-726.433) (-728.016) (-727.580) [-730.499] * (-726.804) (-729.244) [-726.502] (-727.054) -- 0:00:04
929000 -- (-732.593) [-727.706] (-726.874) (-725.711) * (-726.597) (-727.127) [-727.382] (-727.940) -- 0:00:04
929500 -- (-727.751) [-727.717] (-729.107) (-731.794) * (-726.498) [-727.974] (-731.171) (-726.659) -- 0:00:04
930000 -- (-727.860) (-728.900) [-727.442] (-730.228) * [-726.545] (-732.215) (-725.758) (-725.413) -- 0:00:04
Average standard deviation of split frequencies: 0.009244
930500 -- (-731.421) (-727.359) (-728.582) [-727.369] * (-727.046) (-729.812) (-728.792) [-726.226] -- 0:00:04
931000 -- [-728.473] (-727.979) (-730.034) (-727.361) * (-729.353) [-731.002] (-725.903) (-726.124) -- 0:00:04
931500 -- (-730.365) (-732.549) (-729.093) [-726.673] * [-728.076] (-727.799) (-726.609) (-729.272) -- 0:00:04
932000 -- (-734.396) (-730.500) [-727.502] (-729.131) * [-727.334] (-729.094) (-727.532) (-731.912) -- 0:00:04
932500 -- [-733.703] (-728.361) (-725.802) (-727.695) * [-725.870] (-725.996) (-726.736) (-729.613) -- 0:00:04
933000 -- [-726.589] (-729.314) (-728.896) (-726.067) * (-726.456) (-727.098) (-726.472) [-729.635] -- 0:00:04
933500 -- (-726.299) (-727.486) [-727.633] (-727.374) * (-729.667) [-727.078] (-725.681) (-727.814) -- 0:00:04
934000 -- (-728.736) [-726.715] (-729.840) (-727.254) * (-732.951) (-726.543) [-728.380] (-728.019) -- 0:00:04
934500 -- (-726.545) [-730.188] (-729.656) (-727.656) * (-728.029) (-731.697) [-725.616] (-735.367) -- 0:00:04
935000 -- (-726.906) (-727.532) (-729.045) [-727.726] * [-727.776] (-729.200) (-729.397) (-727.616) -- 0:00:04
Average standard deviation of split frequencies: 0.009065
935500 -- [-727.131] (-726.367) (-726.571) (-730.645) * (-726.245) (-725.743) [-726.827] (-727.957) -- 0:00:03
936000 -- (-725.467) (-726.945) [-726.021] (-727.203) * (-726.854) [-727.780] (-726.609) (-728.165) -- 0:00:03
936500 -- (-726.072) (-729.837) [-727.207] (-727.699) * (-727.536) (-726.853) (-725.982) [-726.667] -- 0:00:03
937000 -- [-729.372] (-729.083) (-726.929) (-734.944) * (-727.684) (-727.209) (-729.588) [-733.688] -- 0:00:03
937500 -- (-726.426) [-726.621] (-729.670) (-730.276) * (-728.942) (-726.111) [-730.449] (-726.173) -- 0:00:03
938000 -- (-727.936) [-726.975] (-726.018) (-727.006) * (-728.002) (-730.089) (-729.245) [-726.790] -- 0:00:03
938500 -- (-726.787) (-728.314) (-727.791) [-725.115] * (-728.960) [-727.291] (-728.157) (-726.544) -- 0:00:03
939000 -- (-728.301) (-726.011) (-727.022) [-728.377] * (-727.019) (-728.568) [-727.618] (-726.607) -- 0:00:03
939500 -- (-732.794) [-727.525] (-727.234) (-729.915) * (-726.030) (-727.132) (-728.561) [-726.418] -- 0:00:03
940000 -- [-728.631] (-725.921) (-726.841) (-733.923) * (-728.126) [-728.376] (-728.288) (-726.770) -- 0:00:03
Average standard deviation of split frequencies: 0.009052
940500 -- (-728.693) (-726.308) (-727.098) [-728.464] * (-728.065) [-726.560] (-729.727) (-727.150) -- 0:00:03
941000 -- [-725.485] (-725.485) (-728.069) (-728.731) * (-728.333) (-726.693) [-727.070] (-727.581) -- 0:00:03
941500 -- (-726.192) (-725.369) (-729.313) [-726.897] * (-725.623) [-727.395] (-728.144) (-726.965) -- 0:00:03
942000 -- [-725.324] (-729.412) (-725.696) (-731.421) * (-727.399) (-725.573) (-728.577) [-727.516] -- 0:00:03
942500 -- (-726.544) (-731.405) [-729.086] (-728.466) * [-727.120] (-729.541) (-727.136) (-726.767) -- 0:00:03
943000 -- (-726.472) [-728.481] (-726.782) (-729.488) * (-726.223) (-729.674) (-728.022) [-725.570] -- 0:00:03
943500 -- [-726.183] (-727.328) (-726.106) (-729.443) * [-726.387] (-726.884) (-729.812) (-728.314) -- 0:00:03
944000 -- [-729.914] (-726.256) (-728.933) (-726.970) * [-726.046] (-726.820) (-727.177) (-733.726) -- 0:00:03
944500 -- (-727.230) (-726.569) (-727.288) [-727.318] * [-727.259] (-725.208) (-729.668) (-727.469) -- 0:00:03
945000 -- (-727.868) [-726.469] (-725.689) (-730.137) * (-727.392) (-725.634) [-725.314] (-726.930) -- 0:00:03
Average standard deviation of split frequencies: 0.008596
945500 -- (-725.482) (-728.241) [-729.513] (-729.015) * [-727.674] (-726.001) (-726.797) (-725.704) -- 0:00:03
946000 -- (-726.784) (-726.337) (-730.972) [-726.190] * [-726.678] (-727.451) (-725.621) (-727.433) -- 0:00:03
946500 -- (-727.865) (-729.039) [-728.141] (-728.247) * (-730.897) (-727.986) (-725.797) [-726.729] -- 0:00:03
947000 -- (-727.783) [-727.797] (-725.830) (-732.864) * (-729.548) [-728.011] (-726.873) (-731.565) -- 0:00:03
947500 -- [-727.605] (-726.610) (-727.751) (-733.639) * (-727.917) (-725.793) [-728.748] (-725.597) -- 0:00:03
948000 -- [-727.439] (-727.462) (-725.871) (-734.240) * (-727.683) [-731.650] (-728.413) (-727.380) -- 0:00:03
948500 -- (-728.135) (-726.348) (-726.976) [-728.583] * (-726.340) (-727.279) (-727.463) [-726.297] -- 0:00:03
949000 -- (-727.434) [-726.959] (-726.552) (-727.518) * (-728.005) (-726.402) [-726.373] (-727.965) -- 0:00:03
949500 -- (-726.092) [-725.860] (-729.983) (-729.451) * (-726.186) (-727.679) (-727.273) [-730.184] -- 0:00:03
950000 -- (-728.155) (-726.667) [-729.206] (-726.531) * (-726.393) [-727.399] (-726.989) (-726.809) -- 0:00:03
Average standard deviation of split frequencies: 0.008337
950500 -- [-726.759] (-729.388) (-730.093) (-726.875) * (-731.010) (-725.742) [-728.067] (-726.992) -- 0:00:03
951000 -- (-726.171) [-730.197] (-736.187) (-726.564) * (-727.792) (-728.325) [-726.057] (-726.050) -- 0:00:03
951500 -- [-725.720] (-728.121) (-726.704) (-728.938) * (-726.238) (-726.278) (-733.054) [-727.238] -- 0:00:03
952000 -- [-727.124] (-728.312) (-728.281) (-729.492) * (-726.689) [-725.198] (-726.729) (-726.531) -- 0:00:02
952500 -- (-729.305) [-728.590] (-725.812) (-726.906) * (-726.213) (-726.235) [-727.811] (-727.111) -- 0:00:02
953000 -- (-726.188) (-729.070) [-725.812] (-729.107) * (-730.648) (-728.473) [-726.613] (-728.177) -- 0:00:02
953500 -- (-726.717) [-727.704] (-727.174) (-730.615) * (-729.497) (-726.959) (-726.070) [-730.274] -- 0:00:02
954000 -- (-727.429) [-728.673] (-726.449) (-728.505) * (-727.093) [-728.089] (-726.333) (-727.247) -- 0:00:02
954500 -- (-727.350) [-727.624] (-730.129) (-726.978) * [-726.713] (-725.818) (-725.568) (-726.805) -- 0:00:02
955000 -- [-726.125] (-727.509) (-728.774) (-726.278) * (-726.305) [-726.794] (-726.995) (-725.548) -- 0:00:02
Average standard deviation of split frequencies: 0.008475
955500 -- (-726.970) (-726.433) (-729.346) [-725.112] * (-725.118) (-726.425) [-728.341] (-727.023) -- 0:00:02
956000 -- (-727.658) (-727.733) [-728.038] (-730.797) * (-725.109) (-728.555) [-725.794] (-726.240) -- 0:00:02
956500 -- (-727.196) (-729.136) [-727.338] (-728.833) * [-729.037] (-727.128) (-726.048) (-728.179) -- 0:00:02
957000 -- (-726.960) (-730.047) [-725.953] (-730.043) * (-733.300) [-726.860] (-727.734) (-726.949) -- 0:00:02
957500 -- [-727.277] (-731.143) (-726.141) (-728.526) * (-729.006) (-728.411) (-727.550) [-725.690] -- 0:00:02
958000 -- (-725.289) [-728.303] (-727.088) (-727.900) * (-727.885) [-726.887] (-727.945) (-731.121) -- 0:00:02
958500 -- (-728.639) (-727.454) [-726.160] (-727.079) * [-727.620] (-727.064) (-726.386) (-730.267) -- 0:00:02
959000 -- [-726.388] (-725.374) (-726.411) (-727.208) * (-726.467) (-726.003) [-729.916] (-729.230) -- 0:00:02
959500 -- (-728.026) [-726.520] (-732.556) (-728.636) * (-728.826) (-731.816) [-728.351] (-725.475) -- 0:00:02
960000 -- [-727.294] (-726.037) (-727.897) (-726.234) * (-728.541) (-727.989) (-726.391) [-725.686] -- 0:00:02
Average standard deviation of split frequencies: 0.008587
960500 -- [-726.257] (-728.832) (-725.107) (-726.405) * [-727.567] (-728.450) (-727.887) (-727.159) -- 0:00:02
961000 -- (-729.977) [-726.764] (-730.579) (-727.787) * (-727.323) [-727.884] (-731.006) (-726.746) -- 0:00:02
961500 -- (-730.669) (-727.125) [-730.069] (-728.213) * (-728.282) (-726.768) [-726.846] (-731.726) -- 0:00:02
962000 -- (-730.982) (-728.618) (-726.148) [-728.456] * (-729.332) [-727.209] (-728.133) (-727.547) -- 0:00:02
962500 -- (-729.440) [-726.340] (-730.457) (-727.322) * (-730.611) [-726.746] (-729.190) (-726.708) -- 0:00:02
963000 -- (-727.153) [-727.612] (-727.758) (-726.974) * (-731.681) [-725.812] (-727.882) (-727.368) -- 0:00:02
963500 -- [-726.645] (-726.984) (-726.210) (-733.284) * (-729.759) (-726.934) (-728.223) [-729.303] -- 0:00:02
964000 -- (-727.879) (-725.701) [-727.706] (-726.695) * (-727.401) (-728.657) [-731.471] (-730.458) -- 0:00:02
964500 -- (-727.443) (-726.450) [-726.537] (-731.407) * (-729.738) [-732.309] (-729.792) (-725.478) -- 0:00:02
965000 -- (-727.302) (-726.381) [-728.161] (-728.501) * (-726.157) [-729.131] (-728.337) (-725.630) -- 0:00:02
Average standard deviation of split frequencies: 0.008479
965500 -- (-729.940) (-729.497) [-726.886] (-729.575) * (-725.792) [-727.554] (-726.419) (-725.616) -- 0:00:02
966000 -- (-726.413) (-730.000) (-726.175) [-725.910] * (-727.239) (-727.075) (-728.632) [-725.461] -- 0:00:02
966500 -- (-727.369) (-734.075) [-725.988] (-728.405) * [-727.890] (-727.787) (-730.178) (-726.250) -- 0:00:02
967000 -- (-730.462) (-726.052) [-726.091] (-732.861) * (-727.663) [-729.309] (-727.977) (-725.788) -- 0:00:02
967500 -- [-726.708] (-728.848) (-727.432) (-726.665) * [-727.395] (-728.756) (-727.486) (-726.536) -- 0:00:02
968000 -- (-727.664) (-728.383) (-732.670) [-725.828] * (-726.343) (-730.481) [-726.670] (-727.630) -- 0:00:01
968500 -- [-727.364] (-727.703) (-728.600) (-730.403) * (-727.319) [-727.381] (-726.622) (-731.260) -- 0:00:01
969000 -- (-726.748) [-725.755] (-729.787) (-726.149) * (-728.061) (-726.198) [-726.310] (-728.730) -- 0:00:01
969500 -- [-728.254] (-725.755) (-727.350) (-726.262) * (-726.490) (-727.087) (-725.988) [-728.705] -- 0:00:01
970000 -- (-729.114) [-728.775] (-726.124) (-726.852) * (-725.426) [-727.577] (-726.775) (-726.167) -- 0:00:01
Average standard deviation of split frequencies: 0.008347
970500 -- (-727.069) [-727.908] (-727.726) (-727.940) * (-727.347) (-727.124) (-728.082) [-728.537] -- 0:00:01
971000 -- (-728.504) (-729.177) (-726.687) [-728.793] * (-726.428) [-727.260] (-726.746) (-728.148) -- 0:00:01
971500 -- (-727.737) [-726.815] (-727.725) (-725.514) * (-727.125) [-726.147] (-726.997) (-729.289) -- 0:00:01
972000 -- [-728.782] (-729.121) (-730.195) (-729.230) * (-729.559) [-726.182] (-727.496) (-734.013) -- 0:00:01
972500 -- [-729.093] (-727.029) (-726.063) (-728.225) * (-729.460) (-726.272) (-727.891) [-730.111] -- 0:00:01
973000 -- (-728.844) (-726.942) [-726.476] (-727.088) * (-727.078) (-726.318) [-729.378] (-726.658) -- 0:00:01
973500 -- [-727.116] (-730.134) (-725.702) (-729.356) * (-728.297) (-726.078) [-729.023] (-727.916) -- 0:00:01
974000 -- (-730.427) [-725.793] (-727.327) (-728.285) * (-725.392) (-728.464) [-726.955] (-729.586) -- 0:00:01
974500 -- (-726.906) (-726.531) [-727.206] (-729.928) * (-726.831) (-728.462) [-730.793] (-726.594) -- 0:00:01
975000 -- [-730.585] (-729.939) (-727.402) (-728.637) * (-725.379) (-726.136) (-726.849) [-726.102] -- 0:00:01
Average standard deviation of split frequencies: 0.008724
975500 -- (-727.776) (-728.279) [-730.059] (-732.461) * (-729.001) (-726.787) (-733.463) [-725.609] -- 0:00:01
976000 -- (-729.140) [-727.514] (-728.301) (-727.429) * [-727.400] (-728.887) (-728.046) (-726.247) -- 0:00:01
976500 -- (-732.469) [-726.499] (-725.968) (-726.621) * (-725.262) (-731.721) [-727.530] (-728.882) -- 0:00:01
977000 -- (-730.037) (-726.657) (-727.010) [-726.685] * (-725.224) (-725.946) [-727.957] (-729.971) -- 0:00:01
977500 -- (-728.390) (-730.195) (-729.027) [-731.514] * (-725.758) [-728.755] (-730.479) (-732.779) -- 0:00:01
978000 -- (-727.282) [-730.011] (-730.562) (-726.341) * (-728.079) (-729.587) (-728.079) [-730.352] -- 0:00:01
978500 -- (-726.419) [-728.458] (-727.053) (-726.483) * (-726.669) (-725.528) (-727.434) [-726.163] -- 0:00:01
979000 -- (-726.508) (-728.613) [-727.899] (-726.895) * (-726.300) [-728.359] (-727.987) (-725.507) -- 0:00:01
979500 -- (-727.297) (-732.517) (-727.953) [-726.618] * (-727.867) (-727.635) (-727.851) [-726.129] -- 0:00:01
980000 -- (-737.580) (-727.128) [-725.170] (-729.275) * (-728.058) (-728.332) [-725.744] (-726.186) -- 0:00:01
Average standard deviation of split frequencies: 0.009073
980500 -- (-729.789) (-729.401) [-728.029] (-728.339) * [-727.141] (-728.797) (-729.061) (-726.678) -- 0:00:01
981000 -- (-728.702) (-727.108) [-732.389] (-728.548) * (-727.207) (-729.105) (-727.904) [-727.489] -- 0:00:01
981500 -- [-728.466] (-729.357) (-731.968) (-726.565) * (-728.316) [-726.258] (-726.099) (-731.842) -- 0:00:01
982000 -- (-728.124) (-726.257) (-726.541) [-726.906] * (-729.235) (-726.072) (-726.098) [-729.021] -- 0:00:01
982500 -- (-737.062) (-729.649) (-726.537) [-727.737] * [-731.108] (-728.137) (-726.258) (-727.018) -- 0:00:01
983000 -- (-725.950) (-729.385) (-727.203) [-728.239] * (-730.047) [-727.273] (-726.365) (-730.319) -- 0:00:01
983500 -- (-729.592) [-725.979] (-726.332) (-727.993) * (-727.892) [-725.998] (-727.030) (-728.077) -- 0:00:01
984000 -- [-730.523] (-727.835) (-728.661) (-728.160) * (-728.878) (-726.790) [-729.183] (-728.689) -- 0:00:00
984500 -- (-725.854) [-728.934] (-726.245) (-729.380) * (-728.128) (-727.199) (-733.052) [-727.518] -- 0:00:00
985000 -- [-726.786] (-726.890) (-728.801) (-726.958) * [-727.932] (-726.242) (-726.854) (-726.520) -- 0:00:00
Average standard deviation of split frequencies: 0.009383
985500 -- [-728.897] (-726.915) (-729.245) (-727.086) * [-726.304] (-726.984) (-728.559) (-726.273) -- 0:00:00
986000 -- (-726.639) [-728.551] (-729.014) (-727.987) * (-727.048) [-725.759] (-726.637) (-732.698) -- 0:00:00
986500 -- (-726.407) (-727.617) [-725.451] (-727.669) * [-726.468] (-727.070) (-726.200) (-727.152) -- 0:00:00
987000 -- (-726.358) [-726.320] (-726.433) (-726.434) * (-728.079) (-727.964) (-725.702) [-726.426] -- 0:00:00
987500 -- [-727.957] (-729.253) (-730.530) (-731.140) * (-729.668) (-726.326) (-729.453) [-725.256] -- 0:00:00
988000 -- (-725.946) (-730.286) [-728.766] (-729.331) * [-727.306] (-726.750) (-727.518) (-726.240) -- 0:00:00
988500 -- [-727.647] (-726.082) (-727.171) (-727.233) * (-730.290) (-729.603) (-728.025) [-730.861] -- 0:00:00
989000 -- (-732.979) (-727.993) (-726.628) [-727.336] * (-726.946) (-729.214) (-726.999) [-728.045] -- 0:00:00
989500 -- (-735.429) (-725.700) (-727.037) [-727.223] * (-732.818) (-729.741) [-726.133] (-726.445) -- 0:00:00
990000 -- (-728.709) (-726.133) [-726.932] (-730.449) * (-727.280) (-729.503) [-731.508] (-729.928) -- 0:00:00
Average standard deviation of split frequencies: 0.008922
990500 -- (-728.152) (-726.697) [-725.388] (-725.737) * (-730.469) (-728.434) (-727.591) [-728.750] -- 0:00:00
991000 -- (-727.697) (-726.404) [-727.655] (-730.791) * [-728.759] (-726.762) (-728.190) (-726.974) -- 0:00:00
991500 -- [-729.069] (-726.485) (-725.453) (-726.937) * (-728.317) (-731.151) [-727.670] (-729.107) -- 0:00:00
992000 -- (-727.601) [-725.341] (-733.062) (-725.793) * (-726.663) [-725.908] (-728.239) (-726.087) -- 0:00:00
992500 -- (-731.497) [-726.683] (-730.884) (-726.950) * (-727.439) [-725.907] (-725.867) (-728.952) -- 0:00:00
993000 -- (-727.999) (-727.558) [-728.130] (-728.152) * (-726.198) [-725.918] (-726.287) (-731.576) -- 0:00:00
993500 -- [-726.493] (-725.614) (-728.485) (-726.289) * (-725.716) (-728.980) [-730.687] (-726.562) -- 0:00:00
994000 -- (-732.728) [-728.178] (-727.892) (-727.234) * (-729.310) (-726.719) [-725.642] (-727.027) -- 0:00:00
994500 -- (-731.631) (-730.225) [-727.054] (-726.442) * (-727.761) (-729.434) (-727.050) [-725.763] -- 0:00:00
995000 -- (-727.351) (-729.423) (-726.090) [-726.378] * (-730.076) [-726.491] (-727.002) (-729.263) -- 0:00:00
Average standard deviation of split frequencies: 0.008786
995500 -- [-725.894] (-729.699) (-726.332) (-729.805) * (-727.282) (-729.554) (-727.711) [-725.451] -- 0:00:00
996000 -- [-726.176] (-729.586) (-727.375) (-727.665) * (-725.923) (-725.153) (-726.746) [-728.606] -- 0:00:00
996500 -- (-727.309) (-729.951) (-727.440) [-725.966] * (-727.008) (-726.673) [-725.366] (-726.704) -- 0:00:00
997000 -- (-727.160) [-726.705] (-727.792) (-726.181) * (-726.779) [-726.238] (-727.745) (-725.333) -- 0:00:00
997500 -- [-728.472] (-726.511) (-725.466) (-728.700) * [-726.998] (-726.794) (-725.612) (-727.216) -- 0:00:00
998000 -- (-729.410) [-725.460] (-727.409) (-726.832) * [-725.674] (-726.370) (-727.632) (-727.762) -- 0:00:00
998500 -- (-728.811) (-727.147) (-728.838) [-728.138] * (-727.125) (-725.407) (-725.840) [-731.873] -- 0:00:00
999000 -- (-727.217) [-726.743] (-729.211) (-727.385) * (-728.454) (-728.603) (-726.179) [-726.834] -- 0:00:00
999500 -- (-727.517) (-727.002) (-726.859) [-725.562] * (-726.659) [-726.449] (-727.165) (-727.989) -- 0:00:00
1000000 -- (-727.687) [-727.360] (-729.324) (-726.418) * [-726.671] (-727.927) (-725.517) (-727.153) -- 0:00:00
Average standard deviation of split frequencies: 0.008450
Analysis completed in 1 mins 2 seconds
Analysis used 60.68 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -724.96
Likelihood of best state for "cold" chain of run 2 was -724.96
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 63 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
31.0 % ( 26 %) Dirichlet(Pi{all})
31.9 % ( 25 %) Slider(Pi{all})
78.2 % ( 61 %) Multiplier(Alpha{1,2})
77.9 % ( 52 %) Multiplier(Alpha{3})
23.5 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.2 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.3 % ( 28 %) Dirichlet(Pi{all})
32.3 % ( 21 %) Slider(Pi{all})
78.7 % ( 49 %) Multiplier(Alpha{1,2})
78.3 % ( 53 %) Multiplier(Alpha{3})
22.8 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 94 %) ParsSPR(Tau{all},V{all})
28.3 % ( 35 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166775 0.82 0.67
3 | 166204 166753 0.84
4 | 166748 167133 166387
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166311 0.82 0.67
3 | 166879 167138 0.84
4 | 166350 166773 166549
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -726.61
| 2 |
| |
| 1 2 1 |
| 1 22 1 2 2 1|
| 1 1 2 2 2 2 1 2 2 1 |
|* 1 2 2 2112 1 11 11 2 1 2 2 1 |
| 2 2 2 2 2 122 12 1 12 1 2 11 ** 22|
| 1 12 2 1 1 2 *2 2 |
| 11 2 2 212 1 1 1 2 211 |
| 2 1* 1 2 1 *2 2 |
| 12 2 1 22 1 1 11 |
| 1 1 12 |
| 11 1 21 |
| 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -728.43
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -726.73 -730.19
2 -726.68 -730.08
--------------------------------------
TOTAL -726.71 -730.13
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899747 0.090317 0.392475 1.517546 0.861391 1282.51 1341.41 1.001
r(A<->C){all} 0.160955 0.018051 0.000083 0.428588 0.126316 132.42 147.09 1.003
r(A<->G){all} 0.163183 0.019701 0.000086 0.443836 0.124188 214.46 235.65 1.000
r(A<->T){all} 0.166883 0.021443 0.000004 0.464081 0.126221 202.79 258.30 1.001
r(C<->G){all} 0.162435 0.018894 0.000014 0.440804 0.125714 197.40 254.35 1.000
r(C<->T){all} 0.178287 0.022267 0.000071 0.486684 0.138337 189.31 223.48 1.001
r(G<->T){all} 0.168258 0.019626 0.000047 0.444443 0.135467 174.31 238.73 1.001
pi(A){all} 0.258226 0.000357 0.223111 0.295666 0.258065 1349.94 1425.47 1.000
pi(C){all} 0.313763 0.000404 0.274232 0.352924 0.313669 1178.23 1280.02 1.001
pi(G){all} 0.254291 0.000352 0.218823 0.290992 0.254276 1274.67 1291.50 1.000
pi(T){all} 0.173720 0.000269 0.141415 0.205350 0.173365 1249.28 1318.88 1.001
alpha{1,2} 0.409389 0.214384 0.000181 1.345662 0.245786 1344.13 1376.10 1.000
alpha{3} 0.461981 0.238951 0.000299 1.425750 0.301348 1377.66 1422.40 1.000
pinvar{all} 0.997005 0.000013 0.990138 0.999995 0.998185 1110.31 1237.92 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- .**.**
9 -- .*.***
10 -- .*...*
11 -- .**...
12 -- ...*.*
13 -- .*..*.
14 -- ..**..
15 -- .*.*..
16 -- ..*.*.
17 -- ..****
18 -- .***.*
19 -- ..*..*
20 -- ...**.
21 -- .****.
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 466 0.155230 0.014133 0.145237 0.165223 2
8 459 0.152898 0.013662 0.143238 0.162558 2
9 445 0.148235 0.004240 0.145237 0.151233 2
10 432 0.143904 0.000000 0.143904 0.143904 2
11 431 0.143571 0.008951 0.137242 0.149900 2
12 430 0.143238 0.012248 0.134577 0.151899 2
13 427 0.142239 0.011777 0.133911 0.150566 2
14 426 0.141905 0.017901 0.129247 0.154564 2
15 424 0.141239 0.001884 0.139907 0.142572 2
16 423 0.140906 0.001413 0.139907 0.141905 2
17 421 0.140240 0.002355 0.138574 0.141905 2
18 418 0.139241 0.010364 0.131912 0.146569 2
19 417 0.138907 0.013662 0.129247 0.148568 2
20 402 0.133911 0.011306 0.125916 0.141905 2
21 397 0.132245 0.002355 0.130580 0.133911 2
22 283 0.094270 0.008951 0.087941 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098591 0.009350 0.000003 0.290931 0.069762 1.000 2
length{all}[2] 0.099403 0.009599 0.000013 0.301735 0.071981 1.000 2
length{all}[3] 0.101441 0.010153 0.000016 0.302132 0.072022 1.000 2
length{all}[4] 0.100733 0.010344 0.000029 0.306862 0.068663 1.000 2
length{all}[5] 0.101773 0.010631 0.000026 0.297687 0.070501 1.000 2
length{all}[6] 0.100631 0.009338 0.000146 0.290324 0.071585 1.000 2
length{all}[7] 0.101708 0.009376 0.000133 0.305182 0.073621 1.003 2
length{all}[8] 0.095909 0.008180 0.000049 0.276763 0.069992 1.000 2
length{all}[9] 0.094364 0.009218 0.000078 0.293862 0.061219 0.999 2
length{all}[10] 0.091155 0.007998 0.000066 0.269313 0.062507 0.998 2
length{all}[11] 0.095169 0.009277 0.000055 0.251181 0.068671 0.999 2
length{all}[12] 0.100992 0.009407 0.000033 0.278257 0.073882 1.003 2
length{all}[13] 0.104099 0.009984 0.000466 0.301775 0.074129 0.998 2
length{all}[14] 0.103791 0.010601 0.000014 0.317494 0.075204 0.998 2
length{all}[15] 0.097482 0.007921 0.000065 0.283484 0.071923 1.000 2
length{all}[16] 0.093388 0.008489 0.000075 0.262167 0.065378 1.003 2
length{all}[17] 0.097214 0.008746 0.000058 0.278969 0.067394 1.000 2
length{all}[18] 0.104546 0.012527 0.000138 0.305842 0.069914 0.998 2
length{all}[19] 0.095509 0.009003 0.000002 0.295883 0.062319 0.998 2
length{all}[20] 0.097584 0.010645 0.000054 0.280590 0.069490 0.998 2
length{all}[21] 0.102595 0.010257 0.000028 0.314436 0.067256 1.002 2
length{all}[22] 0.110722 0.014437 0.000346 0.335232 0.071249 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008450
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 531
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 177 / 177 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 177 / 177 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089557 0.098080 0.040211 0.076173 0.010628 0.089776 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -774.532996
Iterating by ming2
Initial: fx= 774.532996
x= 0.08956 0.09808 0.04021 0.07617 0.01063 0.08978 0.30000 1.30000
1 h-m-p 0.0000 0.0001 422.9600 ++ 763.629575 m 0.0001 13 | 1/8
2 h-m-p 0.0011 0.0167 21.2009 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 386.0467 +++ 738.155336 m 0.0002 45 | 2/8
4 h-m-p 0.0039 0.0271 15.2367 ------------.. | 2/8
5 h-m-p 0.0000 0.0002 346.5527 +++ 713.019301 m 0.0002 78 | 3/8
6 h-m-p 0.0065 0.7185 9.6519 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 301.8871 ++ 705.917402 m 0.0001 110 | 4/8
8 h-m-p 0.0019 0.5552 9.9791 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 247.0306 ++ 705.839536 m 0.0000 142 | 5/8
10 h-m-p 0.0015 0.7613 7.5580 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 174.5506 ++ 704.364610 m 0.0000 173 | 6/8
12 h-m-p 0.4951 8.0000 0.0000 Y 704.364610 0 0.4951 184 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 ---C 704.364610 0 0.0061 200
Out..
lnL = -704.364610
201 lfun, 201 eigenQcodon, 1206 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.051508 0.047104 0.030602 0.067826 0.023247 0.046128 0.299993 0.609879 0.168628
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.197984
np = 9
lnL0 = -748.259057
Iterating by ming2
Initial: fx= 748.259057
x= 0.05151 0.04710 0.03060 0.06783 0.02325 0.04613 0.29999 0.60988 0.16863
1 h-m-p 0.0000 0.0001 381.6378 ++ 726.003350 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0003 151.9772 ++ 719.692820 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0000 28007.0073 ++ 709.202054 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 730.5850 ++ 708.672168 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 9274.0003 ++ 707.818228 m 0.0000 62 | 5/9
6 h-m-p 0.0002 0.0010 26.4265 ++ 707.652316 m 0.0010 74 | 6/9
7 h-m-p 0.0064 0.2883 3.1053 ------------.. | 6/9
8 h-m-p 0.0000 0.0001 170.1877 ++ 704.364599 m 0.0001 108 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 704.364599 m 8.0000 120 | 7/9
10 h-m-p 0.0975 8.0000 0.0002 ----Y 704.364599 0 0.0001 138 | 7/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 704.364599 m 8.0000 155 | 7/9
12 h-m-p 0.0010 0.4899 0.5981 -----C 704.364599 0 0.0000 174 | 7/9
13 h-m-p 0.0160 8.0000 0.0001 --C 704.364599 0 0.0003 190 | 7/9
14 h-m-p 0.0160 8.0000 0.0008 -------------.. | 7/9
15 h-m-p 0.0160 8.0000 0.0000 +++++ 704.364599 m 8.0000 232 | 7/9
16 h-m-p 0.0050 2.4926 0.2685 --------C 704.364599 0 0.0000 254 | 7/9
17 h-m-p 0.0160 8.0000 0.0005 +++++ 704.364599 m 8.0000 271 | 7/9
18 h-m-p 0.0130 2.2226 0.3059 ---------C 704.364599 0 0.0000 294 | 7/9
19 h-m-p 0.0160 8.0000 0.0008 +++++ 704.364598 m 8.0000 311 | 7/9
20 h-m-p 0.0233 2.4387 0.2787 -----------C 704.364598 0 0.0000 336 | 7/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 704.364598 m 8.0000 353 | 7/9
22 h-m-p 0.0048 2.3782 0.2958 -----------N 704.364598 0 0.0000 378 | 7/9
23 h-m-p 0.0160 8.0000 0.0000 +++++ 704.364598 m 8.0000 395 | 7/9
24 h-m-p 0.0033 1.6440 0.5397 ---------Y 704.364598 0 0.0000 418 | 7/9
25 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9
26 h-m-p 0.0160 8.0000 0.0000 +++++ 704.364598 m 8.0000 460 | 7/9
27 h-m-p 0.0054 2.7015 0.2519 ---------C 704.364598 0 0.0000 483 | 7/9
28 h-m-p 0.0160 8.0000 0.0002 +++++ 704.364598 m 8.0000 500 | 7/9
29 h-m-p 0.0047 2.0624 0.3437 ---------Y 704.364598 0 0.0000 523 | 7/9
30 h-m-p 0.0160 8.0000 0.0000 -----C 704.364598 0 0.0000 542 | 7/9
31 h-m-p 0.0160 8.0000 0.0001 +++++ 704.364598 m 8.0000 559 | 7/9
32 h-m-p 0.0044 2.2135 0.3150 ---------Y 704.364598 0 0.0000 582 | 7/9
33 h-m-p 0.0160 8.0000 0.0054 -----------Y 704.364598 0 0.0000 607 | 7/9
34 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
35 h-m-p 0.0160 8.0000 0.0000 +++++ 704.364598 m 8.0000 649 | 7/9
36 h-m-p 0.0056 2.8211 0.2421 --------Y 704.364598 0 0.0000 671 | 7/9
37 h-m-p 0.0160 8.0000 0.0004 +++++ 704.364598 m 8.0000 688 | 7/9
38 h-m-p 0.0130 3.0519 0.2331 ---------Y 704.364598 0 0.0000 711 | 7/9
39 h-m-p 0.0160 8.0000 0.0001 ---C 704.364598 0 0.0001 728 | 7/9
40 h-m-p 0.0160 8.0000 0.0022 +++++ 704.364598 m 8.0000 745 | 7/9
41 h-m-p 0.0733 2.9258 0.2440 ----------C 704.364598 0 0.0000 769 | 7/9
42 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
43 h-m-p 0.0160 8.0000 0.0000 +++++ 704.364598 m 8.0000 811 | 7/9
44 h-m-p 0.0059 2.9710 0.2373 --------C 704.364598 0 0.0000 833 | 7/9
45 h-m-p 0.0160 8.0000 0.0037 +++++ 704.364596 m 8.0000 850 | 7/9
46 h-m-p 0.1109 2.7530 0.2660 ------------C 704.364596 0 0.0000 876 | 7/9
47 h-m-p 0.0160 8.0000 0.0156 -------------.. | 7/9
48 h-m-p 0.0160 8.0000 0.0000 +++++ 704.364596 m 8.0000 918 | 7/9
49 h-m-p 0.0067 3.3422 0.2206 --------C 704.364596 0 0.0000 940 | 7/9
50 h-m-p 0.0160 8.0000 0.0003 +++++ 704.364596 m 8.0000 957 | 7/9
51 h-m-p 0.0123 4.1071 0.2141 ----------Y 704.364596 0 0.0000 981 | 7/9
52 h-m-p 0.0160 8.0000 0.0000 --C 704.364596 0 0.0003 997 | 7/9
53 h-m-p 0.0160 8.0000 0.0000 +++++ 704.364596 m 8.0000 1014 | 7/9
54 h-m-p 0.0004 0.2172 2.2668 +++++ 704.364586 m 0.2172 1031 | 8/9
55 h-m-p 0.2746 1.3728 0.5108 ++ 704.364555 m 1.3728 1043 | 9/9
56 h-m-p 0.0160 8.0000 0.0000 Y 704.364555 0 0.0160 1056
Out..
lnL = -704.364555
1057 lfun, 3171 eigenQcodon, 12684 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.025692 0.025130 0.097862 0.054988 0.075372 0.057257 0.000100 1.500643 0.459694 0.287490 1.380507
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 13.218942
np = 11
lnL0 = -759.393071
Iterating by ming2
Initial: fx= 759.393071
x= 0.02569 0.02513 0.09786 0.05499 0.07537 0.05726 0.00011 1.50064 0.45969 0.28749 1.38051
1 h-m-p 0.0000 0.0000 377.7827 ++ 758.734405 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 249.3266 +++ 734.437912 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0000 283.2679 ++ 734.046320 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0010 154.9839 ++++ 716.063452 m 0.0010 61 | 4/11
5 h-m-p 0.0000 0.0000 9340.7413 ++ 714.952940 m 0.0000 75 | 5/11
6 h-m-p 0.0000 0.0000 2776.2682 ++ 713.553911 m 0.0000 89 | 6/11
7 h-m-p 0.0002 0.0017 33.2673 ++ 712.364547 m 0.0017 103 | 7/11
8 h-m-p 0.0089 0.4986 4.4795 -------------.. | 7/11
9 h-m-p 0.0000 0.0003 162.0063 +++ 704.364601 m 0.0003 143 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 704.364601 m 8.0000 157 | 8/11
11 h-m-p 0.0160 8.0000 0.0132 +++++ 704.364600 m 8.0000 177 | 8/11
12 h-m-p 0.0490 8.0000 2.1547 -----------C 704.364600 0 0.0000 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 704.364600 m 8.0000 222 | 8/11
14 h-m-p 0.0047 2.3546 0.2597 +++++ 704.364597 m 2.3546 242 | 9/11
15 h-m-p 0.2395 8.0000 2.1614 +++ 704.364571 m 8.0000 260 | 9/11
16 h-m-p 1.6000 8.0000 7.4923 ++ 704.364555 m 8.0000 274 | 9/11
17 h-m-p 1.6000 8.0000 0.1244 ++ 704.364555 m 8.0000 288 | 9/11
18 h-m-p 0.7319 8.0000 1.3602 --------Y 704.364555 0 0.0000 312 | 9/11
19 h-m-p 0.5047 8.0000 0.0000 C 704.364555 0 0.1875 326 | 9/11
20 h-m-p 0.3277 8.0000 0.0000 Y 704.364555 0 0.0819 342
Out..
lnL = -704.364555
343 lfun, 1372 eigenQcodon, 6174 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -704.419787 S = -704.365669 -0.020931
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:05
did 20 / 52 patterns 0:05
did 30 / 52 patterns 0:05
did 40 / 52 patterns 0:05
did 50 / 52 patterns 0:05
did 52 / 52 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.050764 0.054253 0.017584 0.033671 0.012716 0.020673 0.000100 1.000810 1.158814
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.034945
np = 9
lnL0 = -736.610080
Iterating by ming2
Initial: fx= 736.610080
x= 0.05076 0.05425 0.01758 0.03367 0.01272 0.02067 0.00011 1.00081 1.15881
1 h-m-p 0.0000 0.0000 406.6074 ++ 734.170542 m 0.0000 14 | 1/9
2 h-m-p 0.0002 0.0353 29.2366 ++++ 726.760652 m 0.0353 28 | 2/9
3 h-m-p 0.0001 0.0006 402.9413 ++ 721.348510 m 0.0006 40 | 3/9
4 h-m-p 0.0001 0.0004 358.0115 ++ 718.500092 m 0.0004 52 | 4/9
5 h-m-p 0.0000 0.0002 106.4477 ++ 716.974616 m 0.0002 64 | 5/9
6 h-m-p 0.0000 0.0000 250.7568 ++ 716.410885 m 0.0000 76 | 6/9
7 h-m-p 0.0000 0.0081 186.6058 +++
QuantileBeta(0.15, 0.00500, 3.02117) = 8.114264e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
+ 711.162083 m 0.0081 91
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.288278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008691e-161 2000 rounds
| 7/9
8 h-m-p 0.0119 0.7566 126.8168
QuantileBeta(0.15, 0.00500, 4.56038) = 5.059773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.43124) = 6.991453e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.14895) = 7.727753e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.07838) = 7.936574e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.06073) = 7.990544e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05632) = 8.004151e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05522) = 8.007560e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05494) = 8.008413e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05488) = 8.008626e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05486) = 8.008679e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008692e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008696e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.288278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008691e-161 2000 rounds
| 7/9
9 h-m-p 0.0000 0.0002 164.8246
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
+ 704.364555 m 0.0002 127
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.288278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008691e-161 2000 rounds
| 8/9
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
N 704.364555 0 1.6000 139
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.288278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05500) = 8.008255e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05471) = 8.009139e-161 2000 rounds
| 8/9
11 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
N 704.364555 0 0.0080 152
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
Out..
lnL = -704.364555
153 lfun, 1683 eigenQcodon, 9180 P(t)
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05485) = 8.008697e-161 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.025512 0.010353 0.071828 0.041858 0.026643 0.049256 0.000100 0.900000 0.768999 1.176293 1.299990
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.511453
np = 11
lnL0 = -741.832102
Iterating by ming2
Initial: fx= 741.832102
x= 0.02551 0.01035 0.07183 0.04186 0.02664 0.04926 0.00011 0.90000 0.76900 1.17629 1.29999
1 h-m-p 0.0000 0.0000 389.0659 ++ 740.660811 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0029 67.1032 ++++ 729.083525 m 0.0029 32 | 2/11
3 h-m-p 0.0001 0.0003 302.7759 ++ 716.980262 m 0.0003 46 | 3/11
4 h-m-p 0.0001 0.0004 75.4362 ++ 716.234026 m 0.0004 60 | 4/11
5 h-m-p 0.0000 0.0001 3620.8464 ++ 709.709066 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0000 3597.3967 ++ 707.525762 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0000 3582681.7125 ++ 705.270200 m 0.0000 102 | 7/11
8 h-m-p 0.0124 0.0621 15.3122 -------------.. | 7/11
9 h-m-p 0.0000 0.0000 172.9571 ++ 704.364606 m 0.0000 141 | 8/11
10 h-m-p 0.1052 8.0000 0.0000 ++++ 704.364606 m 8.0000 157 | 8/11
11 h-m-p 0.0440 8.0000 0.0011 --------N 704.364606 0 0.0000 182 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 704.364606 m 8.0000 202 | 8/11
13 h-m-p 0.0098 4.9135 0.2450 ++++
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
+ 704.364599 m 4.9135 222
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.112120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39428) = 1.074536e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39402) = 1.074677e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39415) = 1.074606e-160 2000 rounds
| 9/11
14 h-m-p 0.0788 0.3940 6.0652 +Y 704.364598 0 0.3152 240 | 9/11
15 h-m-p 0.0042 0.0209 22.8466 C 704.364597 0 0.0042 254 | 9/11
16 h-m-p 0.1979 8.0000 0.4830 ---------C 704.364597 0 0.0000 277 | 9/11
17 h-m-p 0.0160 8.0000 0.0000 --Y 704.364597 0 0.0003 295
Out..
lnL = -704.364597
296 lfun, 3552 eigenQcodon, 19536 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -704.388968 S = -704.362378 -0.011714
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:13
did 20 / 52 patterns 0:13
did 30 / 52 patterns 0:13
did 40 / 52 patterns 0:14
did 50 / 52 patterns 0:14
did 52 / 52 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=177
NC_011896_1_WP_010909010_1_2831_MLBR_RS13475 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
NC_002677_1_NP_302691_1_1563_ML2647 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
NZ_CP029543_1_WP_010909010_1_2863_msrA MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
NZ_AP014567_1_WP_010909010_1_2930_msrA MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG
**************************************************
NC_011896_1_WP_010909010_1_2831_MLBR_RS13475 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
NC_002677_1_NP_302691_1_1563_ML2647 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635 MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
NZ_CP029543_1_WP_010909010_1_2863_msrA MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
NZ_AP014567_1_WP_010909010_1_2930_msrA MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY
**************************************************
NC_011896_1_WP_010909010_1_2831_MLBR_RS13475 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
NC_002677_1_NP_302691_1_1563_ML2647 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635 LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
NZ_CP029543_1_WP_010909010_1_2863_msrA LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
NZ_AP014567_1_WP_010909010_1_2930_msrA LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY
**************************************************
NC_011896_1_WP_010909010_1_2831_MLBR_RS13475 PNGYTCHFVRPNWKLPRRAPADAKADS
NC_002677_1_NP_302691_1_1563_ML2647 PNGYTCHFVRPNWKLPRRAPADAKADS
NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205 PNGYTCHFVRPNWKLPRRAPADAKADS
NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635 PNGYTCHFVRPNWKLPRRAPADAKADS
NZ_CP029543_1_WP_010909010_1_2863_msrA PNGYTCHFVRPNWKLPRRAPADAKADS
NZ_AP014567_1_WP_010909010_1_2930_msrA PNGYTCHFVRPNWKLPRRAPADAKADS
***************************
>NC_011896_1_WP_010909010_1_2831_MLBR_RS13475 ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG ACGAGCCCCCGCAGACGCAAAAGCCGACAGC >NC_002677_1_NP_302691_1_1563_ML2647 ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG ACGAGCCCCCGCAGACGCAAAAGCCGACAGC >NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205 ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG ACGAGCCCCCGCAGACGCAAAAGCCGACAGC >NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635 ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG ACGAGCCCCCGCAGACGCAAAAGCCGACAGC >NZ_CP029543_1_WP_010909010_1_2863_msrA ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG ACGAGCCCCCGCAGACGCAAAAGCCGACAGC >NZ_AP014567_1_WP_010909010_1_2930_msrA ATGGCAAGGACAAACACCCGAAAAGCGATCCTCGCCGGCGGCTGTTTCTG GGGAATCCAAAATTTGTTCCGCCGACAACCCGGTGTGATATCGACCCGGG TTGGCTATACTGGCGGCGGCACACCCAACGCGACATACCGTAATCACGGC ATGCACGCCGAGGCGGTCGAAATCATCTATGACCCAGCGATCACTGATTA TCGCACACTATTGGAATTTTTCTTCCAAATCCACGATCCGACAACACGAA ATCGGCAAGGAAACGACCAGGGTACCAGCTACCGGTCGGCCATCTTCTAC CTCGACGACGAACAAAAGAAAGTTGCGCTGGACACCATAGCCGCCGTCGA GGCTTCCAGCCTATGGCCTGGCAAAGTAGTGACCGAGGTCAGCCTCGCTG AGGACTTCTGGGAGGCCGAGCCTGAGCACCAGGATTACCTGCAGCACTAT CCCAACGGGTACACCTGCCACTTCGTTCGTCCCAACTGGAAGTTGCCACG ACGAGCCCCCGCAGACGCAAAAGCCGACAGC
>NC_011896_1_WP_010909010_1_2831_MLBR_RS13475 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY PNGYTCHFVRPNWKLPRRAPADAKADS >NC_002677_1_NP_302691_1_1563_ML2647 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY PNGYTCHFVRPNWKLPRRAPADAKADS >NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY PNGYTCHFVRPNWKLPRRAPADAKADS >NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635 MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY PNGYTCHFVRPNWKLPRRAPADAKADS >NZ_CP029543_1_WP_010909010_1_2863_msrA MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY PNGYTCHFVRPNWKLPRRAPADAKADS >NZ_AP014567_1_WP_010909010_1_2930_msrA MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHG MHAEAVEIIYDPAITDYRTLLEFFFQIHDPTTRNRQGNDQGTSYRSAIFY LDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHY PNGYTCHFVRPNWKLPRRAPADAKADS
#NEXUS
[ID: 5607162996]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010909010_1_2831_MLBR_RS13475
NC_002677_1_NP_302691_1_1563_ML2647
NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205
NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635
NZ_CP029543_1_WP_010909010_1_2863_msrA
NZ_AP014567_1_WP_010909010_1_2930_msrA
;
end;
begin trees;
translate
1 NC_011896_1_WP_010909010_1_2831_MLBR_RS13475,
2 NC_002677_1_NP_302691_1_1563_ML2647,
3 NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205,
4 NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635,
5 NZ_CP029543_1_WP_010909010_1_2863_msrA,
6 NZ_AP014567_1_WP_010909010_1_2930_msrA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06976222,2:0.07198063,3:0.07202199,4:0.06866293,5:0.07050097,6:0.07158456);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06976222,2:0.07198063,3:0.07202199,4:0.06866293,5:0.07050097,6:0.07158456);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -726.73 -730.19
2 -726.68 -730.08
--------------------------------------
TOTAL -726.71 -730.13
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2647/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899747 0.090317 0.392475 1.517546 0.861391 1282.51 1341.41 1.001
r(A<->C){all} 0.160955 0.018051 0.000083 0.428588 0.126316 132.42 147.09 1.003
r(A<->G){all} 0.163183 0.019701 0.000086 0.443836 0.124188 214.46 235.65 1.000
r(A<->T){all} 0.166883 0.021443 0.000004 0.464081 0.126221 202.79 258.30 1.001
r(C<->G){all} 0.162435 0.018894 0.000014 0.440804 0.125714 197.40 254.35 1.000
r(C<->T){all} 0.178287 0.022267 0.000071 0.486684 0.138337 189.31 223.48 1.001
r(G<->T){all} 0.168258 0.019626 0.000047 0.444443 0.135467 174.31 238.73 1.001
pi(A){all} 0.258226 0.000357 0.223111 0.295666 0.258065 1349.94 1425.47 1.000
pi(C){all} 0.313763 0.000404 0.274232 0.352924 0.313669 1178.23 1280.02 1.001
pi(G){all} 0.254291 0.000352 0.218823 0.290992 0.254276 1274.67 1291.50 1.000
pi(T){all} 0.173720 0.000269 0.141415 0.205350 0.173365 1249.28 1318.88 1.001
alpha{1,2} 0.409389 0.214384 0.000181 1.345662 0.245786 1344.13 1376.10 1.000
alpha{3} 0.461981 0.238951 0.000299 1.425750 0.301348 1377.66 1422.40 1.000
pinvar{all} 0.997005 0.000013 0.990138 0.999995 0.998185 1110.31 1237.92 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2647/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 177
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 1 1 1 1 1 1
TTC 7 7 7 7 7 7 | TCC 1 1 1 1 1 1 | TAC 5 5 5 5 5 5 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 3 3 3 3 3 3 | CCC 5 5 5 5 5 5 | CAC 6 6 6 6 6 6 | CGC 2 2 2 2 2 2
CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 5 5 5 5 5 5 | CGA 5 5 5 5 5 5
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 3 3 3 3 3 3 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 2 2 2 2 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 7 7 7 7 7 7 | ACC 6 6 6 6 6 6 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 4
ATA 2 2 2 2 2 2 | ACA 6 6 6 6 6 6 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 0 0 0 0 0 0 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 3 3 3 3 3 3 | Gly GGT 2 2 2 2 2 2
GTC 3 3 3 3 3 3 | GCC 8 8 8 8 8 8 | GAC 8 8 8 8 8 8 | GGC 8 8 8 8 8 8
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 2 2 2 2 2 2 | GCG 5 5 5 5 5 5 | GAG 7 7 7 7 7 7 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909010_1_2831_MLBR_RS13475
position 1: T:0.16384 C:0.24294 A:0.24859 G:0.34463
position 2: T:0.21469 C:0.25424 A:0.32768 G:0.20339
position 3: T:0.14124 C:0.44633 A:0.19774 G:0.21469
Average T:0.17326 C:0.31450 A:0.25800 G:0.25424
#2: NC_002677_1_NP_302691_1_1563_ML2647
position 1: T:0.16384 C:0.24294 A:0.24859 G:0.34463
position 2: T:0.21469 C:0.25424 A:0.32768 G:0.20339
position 3: T:0.14124 C:0.44633 A:0.19774 G:0.21469
Average T:0.17326 C:0.31450 A:0.25800 G:0.25424
#3: NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205
position 1: T:0.16384 C:0.24294 A:0.24859 G:0.34463
position 2: T:0.21469 C:0.25424 A:0.32768 G:0.20339
position 3: T:0.14124 C:0.44633 A:0.19774 G:0.21469
Average T:0.17326 C:0.31450 A:0.25800 G:0.25424
#4: NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635
position 1: T:0.16384 C:0.24294 A:0.24859 G:0.34463
position 2: T:0.21469 C:0.25424 A:0.32768 G:0.20339
position 3: T:0.14124 C:0.44633 A:0.19774 G:0.21469
Average T:0.17326 C:0.31450 A:0.25800 G:0.25424
#5: NZ_CP029543_1_WP_010909010_1_2863_msrA
position 1: T:0.16384 C:0.24294 A:0.24859 G:0.34463
position 2: T:0.21469 C:0.25424 A:0.32768 G:0.20339
position 3: T:0.14124 C:0.44633 A:0.19774 G:0.21469
Average T:0.17326 C:0.31450 A:0.25800 G:0.25424
#6: NZ_AP014567_1_WP_010909010_1_2930_msrA
position 1: T:0.16384 C:0.24294 A:0.24859 G:0.34463
position 2: T:0.21469 C:0.25424 A:0.32768 G:0.20339
position 3: T:0.14124 C:0.44633 A:0.19774 G:0.21469
Average T:0.17326 C:0.31450 A:0.25800 G:0.25424
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 24 | Cys C TGT 6
TTC 42 | TCC 6 | TAC 30 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 12
CTC 18 | CCC 30 | CAC 36 | CGC 12
CTA 12 | CCA 12 | Gln Q CAA 30 | CGA 30
CTG 12 | CCG 6 | CAG 18 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 12 | Asn N AAT 18 | Ser S AGT 0
ATC 42 | ACC 36 | AAC 30 | AGC 24
ATA 12 | ACA 36 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 12 | ACG 0 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 18 | Gly G GGT 12
GTC 18 | GCC 48 | GAC 48 | GGC 48
GTA 6 | GCA 18 | Glu E GAA 18 | GGA 12
GTG 12 | GCG 30 | GAG 42 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16384 C:0.24294 A:0.24859 G:0.34463
position 2: T:0.21469 C:0.25424 A:0.32768 G:0.20339
position 3: T:0.14124 C:0.44633 A:0.19774 G:0.21469
Average T:0.17326 C:0.31450 A:0.25800 G:0.25424
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -704.364610 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299993 1.299990
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909010_1_2831_MLBR_RS13475: 0.000004, NC_002677_1_NP_302691_1_1563_ML2647: 0.000004, NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205: 0.000004, NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635: 0.000004, NZ_CP029543_1_WP_010909010_1_2863_msrA: 0.000004, NZ_AP014567_1_WP_010909010_1_2930_msrA: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29999
omega (dN/dS) = 1.29999
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.3 91.7 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 439.3 91.7 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 439.3 91.7 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 439.3 91.7 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 439.3 91.7 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 439.3 91.7 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -704.364555 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909010_1_2831_MLBR_RS13475: 0.000004, NC_002677_1_NP_302691_1_1563_ML2647: 0.000004, NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205: 0.000004, NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635: 0.000004, NZ_CP029543_1_WP_010909010_1_2863_msrA: 0.000004, NZ_AP014567_1_WP_010909010_1_2930_msrA: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -704.364555 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999763 0.000237 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909010_1_2831_MLBR_RS13475: 0.000004, NC_002677_1_NP_302691_1_1563_ML2647: 0.000004, NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205: 0.000004, NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635: 0.000004, NZ_CP029543_1_WP_010909010_1_2863_msrA: 0.000004, NZ_AP014567_1_WP_010909010_1_2930_msrA: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99976 0.00024 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 447.1 83.9 0.0002 0.0000 0.0000 0.0 0.0
7..2 0.000 447.1 83.9 0.0002 0.0000 0.0000 0.0 0.0
7..3 0.000 447.1 83.9 0.0002 0.0000 0.0000 0.0 0.0
7..4 0.000 447.1 83.9 0.0002 0.0000 0.0000 0.0 0.0
7..5 0.000 447.1 83.9 0.0002 0.0000 0.0000 0.0 0.0
7..6 0.000 447.1 83.9 0.0002 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909010_1_2831_MLBR_RS13475)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -704.364555 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 3.054853
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909010_1_2831_MLBR_RS13475: 0.000004, NC_002677_1_NP_302691_1_1563_ML2647: 0.000004, NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205: 0.000004, NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635: 0.000004, NZ_CP029543_1_WP_010909010_1_2863_msrA: 0.000004, NZ_AP014567_1_WP_010909010_1_2930_msrA: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 3.05485
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 447.1 83.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -704.364597 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.684779 0.005000 0.387264 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909010_1_2831_MLBR_RS13475: 0.000004, NC_002677_1_NP_302691_1_1563_ML2647: 0.000004, NZ_LVXE01000015_1_WP_010909010_1_542_A3216_RS06205: 0.000004, NZ_LYPH01000020_1_WP_010909010_1_765_A8144_RS03635: 0.000004, NZ_CP029543_1_WP_010909010_1_2863_msrA: 0.000004, NZ_AP014567_1_WP_010909010_1_2930_msrA: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.68478 p = 0.00500 q = 0.38726
(p1 = 0.31522) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.06848 0.06848 0.06848 0.06848 0.06848 0.06848 0.06848 0.06848 0.06848 0.06848 0.31522
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00028 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 447.1 83.9 0.3152 0.0000 0.0000 0.0 0.0
7..2 0.000 447.1 83.9 0.3152 0.0000 0.0000 0.0 0.0
7..3 0.000 447.1 83.9 0.3152 0.0000 0.0000 0.0 0.0
7..4 0.000 447.1 83.9 0.3152 0.0000 0.0000 0.0 0.0
7..5 0.000 447.1 83.9 0.3152 0.0000 0.0000 0.0 0.0
7..6 0.000 447.1 83.9 0.3152 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909010_1_2831_MLBR_RS13475)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:14
Model 1: NearlyNeutral -704.364555 Model 2: PositiveSelection -704.364555 Model 0: one-ratio -704.36461 Model 7: beta -704.364555 Model 8: beta&w>1 -704.364597 Model 0 vs 1 1.0999999994965037E-4 Model 2 vs 1 0.0 Model 8 vs 7 8.400000001529406E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
