--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:16:00 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2450/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1014.32 -1017.49
2 -1014.34 -1017.60
--------------------------------------
TOTAL -1014.33 -1017.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.905719 0.087922 0.373105 1.474480 0.879212 1501.00 1501.00 1.000
r(A<->C){all} 0.162913 0.020120 0.000178 0.460089 0.121007 151.35 235.56 1.000
r(A<->G){all} 0.171198 0.022876 0.000098 0.489225 0.126825 199.05 242.68 1.001
r(A<->T){all} 0.167486 0.020016 0.000159 0.440580 0.131230 265.93 425.08 1.000
r(C<->G){all} 0.165496 0.019914 0.000030 0.451304 0.127426 289.16 297.74 1.000
r(C<->T){all} 0.161103 0.017794 0.000012 0.428981 0.126170 174.47 218.96 1.001
r(G<->T){all} 0.171804 0.018203 0.000012 0.439484 0.143065 233.62 255.08 1.000
pi(A){all} 0.243196 0.000251 0.212630 0.274769 0.243203 1037.50 1122.24 1.000
pi(C){all} 0.300421 0.000270 0.269159 0.332068 0.299997 1151.04 1238.04 1.000
pi(G){all} 0.248311 0.000253 0.218013 0.279435 0.248364 1374.03 1398.28 1.000
pi(T){all} 0.208072 0.000218 0.179961 0.238491 0.207820 1352.34 1426.67 1.001
alpha{1,2} 0.419156 0.228408 0.000100 1.413318 0.244223 1159.72 1238.17 1.001
alpha{3} 0.464923 0.229214 0.000225 1.421277 0.313509 1353.77 1421.47 1.000
pinvar{all} 0.997884 0.000006 0.993281 1.000000 0.998615 1131.56 1208.46 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -960.276239
Model 2: PositiveSelection -960.276242
Model 0: one-ratio -960.276237
Model 7: beta -960.276241
Model 8: beta&w>1 -960.276241
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 5.999999984851456E-6
Model 8 vs 7 0.0
>C1
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
>C2
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
>C3
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
>C4
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
>C5
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
>C6
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=245
C1 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
C2 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
C3 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
C4 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
C5 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
C6 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
**************************************************
C1 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
C2 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
C3 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
C4 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
C5 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
C6 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
**************************************************
C1 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
C2 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
C3 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
C4 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
C5 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
C6 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
**************************************************
C1 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
C2 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
C3 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
C4 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
C5 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
C6 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
**************************************************
C1 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
C2 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
C3 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
C4 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
C5 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
C6 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
*********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7350]--->[7350]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.492 Mb, Max= 30.797 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
C2 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
C3 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
C4 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
C5 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
C6 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
**************************************************
C1 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
C2 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
C3 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
C4 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
C5 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
C6 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
**************************************************
C1 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
C2 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
C3 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
C4 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
C5 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
C6 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
**************************************************
C1 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
C2 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
C3 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
C4 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
C5 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
C6 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
**************************************************
C1 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
C2 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
C3 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
C4 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
C5 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
C6 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
*********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
C2 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
C3 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
C4 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
C5 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
C6 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
**************************************************
C1 GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
C2 GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
C3 GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
C4 GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
C5 GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
C6 GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
**************************************************
C1 CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
C2 CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
C3 CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
C4 CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
C5 CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
C6 CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
**************************************************
C1 ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
C2 ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
C3 ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
C4 ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
C5 ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
C6 ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
**************************************************
C1 ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
C2 ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
C3 ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
C4 ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
C5 ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
C6 ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
**************************************************
C1 CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
C2 CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
C3 CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
C4 CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
C5 CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
C6 CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
**************************************************
C1 ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
C2 ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
C3 ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
C4 ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
C5 ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
C6 ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
**************************************************
C1 GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
C2 GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
C3 GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
C4 GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
C5 GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
C6 GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
**************************************************
C1 GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
C2 GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
C3 GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
C4 GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
C5 GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
C6 GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
**************************************************
C1 GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
C2 GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
C3 GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
C4 GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
C5 GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
C6 GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
**************************************************
C1 CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
C2 CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
C3 CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
C4 CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
C5 CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
C6 CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
**************************************************
C1 TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
C2 TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
C3 TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
C4 TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
C5 TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
C6 TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
**************************************************
C1 ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
C2 ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
C3 ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
C4 ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
C5 ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
C6 ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
**************************************************
C1 GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
C2 GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
C3 GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
C4 GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
C5 GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
C6 GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
**************************************************
C1 GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
C2 GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
C3 GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
C4 GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
C5 GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
C6 GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
***********************************
>C1
TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
>C2
TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
>C3
TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
>C4
TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
>C5
TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
>C6
TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC
GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG
CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC
ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA
ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG
CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC
ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG
GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG
GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC
GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA
CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC
TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA
ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC
GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA
GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
>C1
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
>C2
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
>C3
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
>C4
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
>C5
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
>C6
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 735 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857283
Setting output file names to "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1212772247
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5532125100
Seed = 50794715
Swapseed = 1579857283
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1644.965242 -- -24.965149
Chain 2 -- -1644.965148 -- -24.965149
Chain 3 -- -1644.965242 -- -24.965149
Chain 4 -- -1644.965148 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1644.965242 -- -24.965149
Chain 2 -- -1644.964991 -- -24.965149
Chain 3 -- -1644.965242 -- -24.965149
Chain 4 -- -1644.965148 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1644.965] (-1644.965) (-1644.965) (-1644.965) * [-1644.965] (-1644.965) (-1644.965) (-1644.965)
500 -- (-1021.963) [-1022.696] (-1021.828) (-1019.836) * (-1027.729) [-1021.892] (-1023.353) (-1022.375) -- 0:33:19
1000 -- (-1025.654) (-1034.212) (-1031.921) [-1019.716] * (-1025.852) (-1026.815) [-1023.513] (-1022.454) -- 0:16:39
1500 -- (-1029.681) [-1025.152] (-1031.663) (-1030.206) * (-1025.072) (-1022.562) [-1023.611] (-1024.091) -- 0:11:05
2000 -- (-1024.385) (-1032.039) [-1020.476] (-1023.462) * [-1019.984] (-1021.436) (-1026.718) (-1034.214) -- 0:08:19
2500 -- (-1021.496) [-1021.326] (-1032.820) (-1023.179) * (-1020.948) (-1021.542) [-1021.096] (-1028.887) -- 0:06:39
3000 -- [-1024.719] (-1023.878) (-1024.882) (-1022.749) * [-1020.429] (-1027.040) (-1024.441) (-1032.861) -- 0:05:32
3500 -- (-1036.479) (-1025.103) [-1021.465] (-1024.092) * (-1030.904) (-1019.770) (-1018.671) [-1019.639] -- 0:04:44
4000 -- [-1022.548] (-1028.652) (-1025.516) (-1030.443) * (-1025.216) [-1021.590] (-1020.658) (-1026.182) -- 0:04:09
4500 -- (-1028.747) (-1029.029) [-1024.381] (-1025.493) * (-1028.586) [-1026.631] (-1029.998) (-1023.684) -- 0:03:41
5000 -- (-1024.950) (-1022.932) (-1024.107) [-1016.703] * (-1019.699) [-1021.239] (-1028.734) (-1026.854) -- 0:03:19
Average standard deviation of split frequencies: 0.068319
5500 -- (-1023.028) (-1026.789) [-1031.384] (-1017.842) * (-1022.572) (-1019.385) [-1021.749] (-1031.078) -- 0:03:00
6000 -- (-1018.150) (-1026.719) [-1021.135] (-1016.098) * (-1018.188) [-1027.060] (-1024.498) (-1017.682) -- 0:02:45
6500 -- (-1019.571) (-1022.421) [-1027.079] (-1018.637) * [-1022.865] (-1025.052) (-1029.290) (-1016.265) -- 0:02:32
7000 -- (-1024.636) (-1025.691) [-1025.743] (-1016.200) * (-1025.792) (-1029.039) [-1018.623] (-1015.757) -- 0:02:21
7500 -- (-1029.312) (-1019.539) (-1027.016) [-1014.251] * (-1023.683) (-1029.741) (-1022.156) [-1014.084] -- 0:02:12
8000 -- (-1021.083) (-1024.513) (-1027.391) [-1013.445] * [-1019.253] (-1028.665) (-1021.289) (-1013.202) -- 0:02:04
8500 -- [-1025.737] (-1025.815) (-1025.075) (-1013.066) * (-1023.544) (-1020.719) [-1022.065] (-1013.934) -- 0:01:56
9000 -- [-1021.198] (-1020.900) (-1023.991) (-1013.030) * (-1023.737) (-1030.058) [-1021.620] (-1014.838) -- 0:01:50
9500 -- (-1023.705) [-1024.513] (-1023.237) (-1013.199) * (-1027.886) (-1025.686) [-1020.333] (-1017.406) -- 0:01:44
10000 -- (-1027.962) (-1035.518) [-1021.656] (-1013.761) * [-1023.222] (-1023.874) (-1022.926) (-1015.908) -- 0:01:39
Average standard deviation of split frequencies: 0.062274
10500 -- (-1022.709) (-1019.619) (-1024.325) [-1015.254] * [-1026.445] (-1024.062) (-1023.405) (-1016.988) -- 0:01:34
11000 -- [-1026.595] (-1024.909) (-1032.227) (-1015.669) * (-1020.977) [-1017.695] (-1018.205) (-1018.113) -- 0:01:29
11500 -- (-1022.569) (-1023.303) [-1027.416] (-1016.613) * [-1021.683] (-1030.115) (-1024.328) (-1017.492) -- 0:01:25
12000 -- (-1021.051) [-1021.588] (-1023.249) (-1015.203) * (-1021.134) (-1036.257) [-1020.927] (-1014.628) -- 0:01:22
12500 -- (-1022.495) [-1027.932] (-1031.126) (-1015.123) * [-1021.002] (-1030.430) (-1027.448) (-1016.039) -- 0:01:19
13000 -- [-1019.698] (-1022.553) (-1014.780) (-1017.448) * [-1023.235] (-1029.510) (-1028.794) (-1014.982) -- 0:01:15
13500 -- (-1027.806) [-1026.532] (-1018.372) (-1013.927) * (-1024.226) (-1030.221) [-1023.773] (-1014.867) -- 0:01:13
14000 -- (-1023.367) (-1025.398) (-1015.230) [-1015.297] * (-1013.815) (-1031.856) (-1026.660) [-1013.454] -- 0:01:10
14500 -- (-1028.806) (-1027.121) [-1015.173] (-1015.370) * (-1013.090) (-1023.526) [-1022.814] (-1013.258) -- 0:01:07
15000 -- (-1033.306) (-1022.366) (-1013.445) [-1015.292] * (-1015.989) (-1029.286) [-1029.148] (-1013.314) -- 0:01:05
Average standard deviation of split frequencies: 0.054274
15500 -- (-1025.425) [-1021.902] (-1013.944) (-1014.424) * (-1014.573) (-1023.124) (-1020.916) [-1013.972] -- 0:01:03
16000 -- (-1022.412) [-1019.651] (-1013.715) (-1015.011) * (-1016.947) (-1039.053) [-1023.676] (-1015.806) -- 0:01:01
16500 -- (-1021.338) (-1027.015) (-1013.684) [-1013.600] * [-1015.749] (-1024.595) (-1021.979) (-1016.550) -- 0:01:59
17000 -- (-1024.540) (-1019.135) (-1014.485) [-1014.433] * (-1017.843) (-1013.875) (-1021.735) [-1016.297] -- 0:01:55
17500 -- (-1024.046) (-1025.434) (-1013.632) [-1014.542] * (-1013.170) (-1015.638) [-1017.038] (-1016.077) -- 0:01:52
18000 -- (-1019.304) (-1023.356) [-1014.638] (-1017.187) * (-1014.667) (-1014.603) (-1021.633) [-1015.159] -- 0:01:49
18500 -- (-1025.066) [-1023.780] (-1015.969) (-1015.594) * (-1015.574) [-1014.448] (-1026.899) (-1016.645) -- 0:01:46
19000 -- (-1025.297) (-1025.710) (-1014.147) [-1015.590] * (-1016.136) [-1016.306] (-1026.510) (-1016.450) -- 0:01:43
19500 -- [-1019.273] (-1021.049) (-1014.296) (-1015.903) * [-1017.775] (-1015.051) (-1025.831) (-1013.679) -- 0:01:40
20000 -- (-1013.348) [-1020.613] (-1013.872) (-1017.049) * [-1013.677] (-1016.676) (-1025.031) (-1012.813) -- 0:01:38
Average standard deviation of split frequencies: 0.048303
20500 -- [-1014.488] (-1023.009) (-1014.041) (-1017.179) * (-1013.655) [-1017.886] (-1025.532) (-1013.025) -- 0:01:35
21000 -- (-1014.450) (-1020.858) (-1013.604) [-1015.780] * (-1013.965) (-1019.807) (-1033.216) [-1016.342] -- 0:01:33
21500 -- (-1014.408) [-1024.336] (-1013.604) (-1015.614) * (-1016.262) (-1013.209) [-1017.475] (-1015.172) -- 0:01:31
22000 -- (-1016.201) [-1020.043] (-1014.584) (-1014.050) * (-1021.438) [-1018.928] (-1020.747) (-1015.784) -- 0:01:28
22500 -- (-1016.074) (-1025.062) (-1016.067) [-1013.833] * (-1015.544) (-1013.694) (-1021.634) [-1014.926] -- 0:01:26
23000 -- (-1014.523) (-1030.408) (-1016.686) [-1013.860] * (-1018.453) (-1013.358) (-1019.272) [-1013.622] -- 0:01:24
23500 -- [-1015.742] (-1024.102) (-1017.479) (-1015.856) * [-1016.689] (-1016.185) (-1018.174) (-1014.623) -- 0:01:23
24000 -- (-1015.386) (-1023.022) (-1018.620) [-1014.703] * (-1016.533) [-1015.988] (-1021.190) (-1016.106) -- 0:01:21
24500 -- [-1016.351] (-1036.606) (-1017.931) (-1013.721) * (-1014.125) (-1016.238) (-1025.306) [-1017.421] -- 0:01:19
25000 -- (-1012.959) (-1024.061) [-1013.924] (-1014.905) * [-1014.442] (-1018.463) (-1024.571) (-1013.022) -- 0:01:18
Average standard deviation of split frequencies: 0.034535
25500 -- (-1015.412) [-1026.926] (-1014.436) (-1016.153) * (-1015.229) (-1014.074) (-1021.712) [-1012.965] -- 0:01:16
26000 -- (-1016.095) (-1029.519) [-1014.681] (-1014.750) * [-1014.262] (-1014.072) (-1022.801) (-1014.351) -- 0:01:14
26500 -- (-1019.028) [-1029.887] (-1017.054) (-1016.414) * (-1015.441) [-1015.713] (-1019.040) (-1015.324) -- 0:01:13
27000 -- (-1014.575) [-1018.353] (-1017.934) (-1016.782) * (-1013.576) (-1015.357) [-1027.124] (-1013.758) -- 0:01:12
27500 -- (-1015.796) (-1027.225) (-1014.535) [-1014.449] * (-1015.040) [-1013.501] (-1039.151) (-1014.651) -- 0:01:10
28000 -- (-1014.075) (-1030.911) (-1015.071) [-1013.246] * (-1013.938) [-1015.105] (-1033.791) (-1020.333) -- 0:01:09
28500 -- (-1015.691) [-1023.485] (-1016.234) (-1015.849) * (-1018.011) [-1013.326] (-1015.632) (-1017.907) -- 0:01:08
29000 -- (-1016.854) [-1025.300] (-1015.190) (-1014.426) * (-1016.835) (-1014.372) (-1014.007) [-1014.478] -- 0:01:06
29500 -- (-1013.700) (-1028.390) [-1014.338] (-1018.556) * [-1013.910] (-1013.160) (-1014.313) (-1018.062) -- 0:01:05
30000 -- (-1013.968) (-1021.848) [-1016.604] (-1012.856) * (-1017.066) [-1013.023] (-1014.063) (-1013.959) -- 0:01:04
Average standard deviation of split frequencies: 0.025154
30500 -- (-1013.255) [-1020.605] (-1020.364) (-1013.892) * (-1014.039) [-1012.780] (-1015.130) (-1014.911) -- 0:01:03
31000 -- [-1013.732] (-1024.535) (-1019.203) (-1014.846) * (-1014.691) [-1015.042] (-1015.507) (-1015.006) -- 0:01:02
31500 -- [-1013.577] (-1024.144) (-1018.970) (-1014.891) * [-1016.002] (-1019.569) (-1017.534) (-1013.603) -- 0:01:01
32000 -- (-1013.213) [-1021.793] (-1016.014) (-1014.893) * (-1015.984) (-1016.407) (-1016.817) [-1013.542] -- 0:01:00
32500 -- [-1013.962] (-1027.029) (-1018.822) (-1015.532) * (-1015.573) (-1014.157) (-1017.770) [-1015.591] -- 0:01:29
33000 -- (-1013.850) (-1023.876) (-1016.162) [-1014.631] * (-1015.942) (-1014.823) (-1015.705) [-1015.781] -- 0:01:27
33500 -- [-1014.710] (-1028.866) (-1014.319) (-1015.286) * (-1015.437) (-1013.802) (-1014.218) [-1014.966] -- 0:01:26
34000 -- (-1014.047) (-1034.847) (-1013.216) [-1014.965] * (-1017.182) [-1014.448] (-1016.576) (-1014.747) -- 0:01:25
34500 -- (-1015.940) (-1021.443) [-1014.239] (-1015.379) * (-1013.505) [-1016.935] (-1015.788) (-1015.021) -- 0:01:23
35000 -- (-1018.945) [-1020.708] (-1015.474) (-1014.161) * (-1016.551) (-1016.056) (-1022.931) [-1014.600] -- 0:01:22
Average standard deviation of split frequencies: 0.029307
35500 -- (-1013.902) (-1023.700) [-1015.138] (-1014.951) * [-1014.723] (-1014.890) (-1020.447) (-1016.339) -- 0:01:21
36000 -- (-1018.265) [-1026.841] (-1015.044) (-1013.854) * (-1014.906) (-1017.093) (-1017.441) [-1020.816] -- 0:01:20
36500 -- [-1018.738] (-1032.560) (-1014.218) (-1014.942) * (-1015.718) (-1014.534) (-1024.457) [-1015.071] -- 0:01:19
37000 -- (-1021.124) (-1024.169) (-1013.565) [-1015.170] * (-1013.810) (-1017.167) (-1013.466) [-1014.928] -- 0:01:18
37500 -- (-1015.624) (-1029.771) (-1015.810) [-1014.725] * (-1014.509) (-1015.267) (-1013.876) [-1012.835] -- 0:01:17
38000 -- (-1014.787) (-1021.386) (-1019.248) [-1014.151] * (-1014.635) (-1015.410) (-1013.336) [-1016.453] -- 0:01:15
38500 -- (-1014.496) (-1026.576) [-1016.899] (-1016.312) * (-1014.506) [-1015.377] (-1013.605) (-1019.356) -- 0:01:14
39000 -- [-1014.357] (-1025.162) (-1015.665) (-1013.259) * (-1013.071) [-1013.603] (-1014.162) (-1013.496) -- 0:01:13
39500 -- [-1015.784] (-1028.965) (-1020.106) (-1013.726) * [-1014.281] (-1013.747) (-1014.239) (-1013.654) -- 0:01:12
40000 -- (-1016.837) (-1019.580) [-1016.057] (-1015.891) * [-1016.266] (-1014.057) (-1014.399) (-1013.796) -- 0:01:12
Average standard deviation of split frequencies: 0.037094
40500 -- (-1016.898) (-1023.064) (-1013.512) [-1014.677] * (-1016.680) [-1013.659] (-1012.939) (-1014.024) -- 0:01:11
41000 -- (-1016.806) [-1033.059] (-1017.305) (-1014.054) * (-1018.238) [-1016.356] (-1016.960) (-1018.102) -- 0:01:10
41500 -- [-1014.041] (-1026.511) (-1016.375) (-1014.410) * (-1017.661) [-1013.973] (-1015.082) (-1016.075) -- 0:01:09
42000 -- (-1014.658) (-1031.607) (-1015.874) [-1014.062] * (-1017.629) [-1013.154] (-1014.492) (-1017.021) -- 0:01:08
42500 -- (-1013.584) (-1021.632) [-1017.125] (-1020.392) * (-1014.366) [-1012.793] (-1013.853) (-1018.916) -- 0:01:07
43000 -- (-1014.264) (-1032.591) (-1018.362) [-1016.026] * (-1014.518) (-1013.138) (-1014.844) [-1017.024] -- 0:01:06
43500 -- (-1015.858) [-1016.364] (-1017.141) (-1014.186) * (-1018.548) (-1013.568) [-1015.966] (-1019.280) -- 0:01:05
44000 -- (-1016.912) (-1027.119) (-1016.753) [-1013.961] * [-1013.013] (-1015.754) (-1014.175) (-1018.622) -- 0:01:05
44500 -- (-1022.510) (-1024.812) [-1015.580] (-1016.859) * [-1014.601] (-1013.157) (-1015.827) (-1017.478) -- 0:01:04
45000 -- (-1017.299) (-1021.625) (-1014.636) [-1014.341] * (-1016.616) [-1014.931] (-1016.038) (-1018.902) -- 0:01:03
Average standard deviation of split frequencies: 0.036112
45500 -- (-1017.160) [-1024.498] (-1015.166) (-1015.861) * (-1014.780) (-1018.412) (-1014.188) [-1015.873] -- 0:01:02
46000 -- (-1016.839) [-1023.488] (-1014.093) (-1014.504) * (-1013.916) [-1017.191] (-1015.925) (-1017.862) -- 0:01:02
46500 -- (-1015.826) [-1030.447] (-1014.647) (-1019.133) * (-1016.432) [-1014.415] (-1013.803) (-1017.195) -- 0:01:01
47000 -- [-1014.943] (-1025.340) (-1015.536) (-1015.114) * (-1014.146) [-1015.514] (-1014.682) (-1016.519) -- 0:01:00
47500 -- (-1014.938) (-1019.235) (-1015.884) [-1015.671] * (-1015.083) (-1014.896) (-1015.039) [-1014.603] -- 0:01:00
48000 -- (-1015.694) (-1024.527) (-1016.698) [-1015.265] * (-1014.753) (-1016.840) [-1013.525] (-1018.977) -- 0:00:59
48500 -- (-1014.940) (-1028.181) (-1017.660) [-1015.363] * (-1014.196) (-1016.107) [-1013.863] (-1019.500) -- 0:01:18
49000 -- [-1015.449] (-1030.602) (-1024.372) (-1015.465) * (-1014.061) (-1019.387) [-1013.446] (-1014.377) -- 0:01:17
49500 -- [-1015.122] (-1026.188) (-1026.222) (-1016.897) * (-1017.240) (-1017.044) [-1013.518] (-1013.292) -- 0:01:16
50000 -- (-1014.040) (-1025.319) [-1022.573] (-1020.753) * (-1021.932) (-1016.904) [-1013.427] (-1013.369) -- 0:01:16
Average standard deviation of split frequencies: 0.032564
50500 -- (-1014.413) (-1026.219) (-1016.866) [-1013.744] * (-1015.825) (-1018.845) (-1015.884) [-1015.079] -- 0:01:15
51000 -- (-1013.616) (-1029.283) [-1013.540] (-1013.985) * (-1016.477) (-1017.544) (-1015.598) [-1013.752] -- 0:01:14
51500 -- (-1016.769) (-1026.701) (-1016.804) [-1013.411] * (-1013.684) (-1017.889) (-1015.298) [-1014.946] -- 0:01:13
52000 -- (-1013.655) (-1019.840) (-1013.536) [-1015.065] * (-1013.032) [-1017.731] (-1017.581) (-1014.654) -- 0:01:12
52500 -- (-1018.813) [-1033.638] (-1012.842) (-1013.268) * [-1015.332] (-1017.412) (-1014.441) (-1014.016) -- 0:01:12
53000 -- (-1014.911) (-1028.204) (-1015.495) [-1013.432] * (-1014.618) (-1016.266) (-1014.109) [-1014.407] -- 0:01:11
53500 -- (-1015.868) (-1032.799) [-1014.405] (-1013.051) * (-1014.158) (-1013.330) (-1015.218) [-1013.756] -- 0:01:10
54000 -- (-1016.296) (-1027.639) [-1013.405] (-1013.380) * (-1015.748) (-1013.916) (-1015.987) [-1014.697] -- 0:01:10
54500 -- [-1014.046] (-1020.203) (-1013.834) (-1015.594) * (-1016.621) [-1013.506] (-1015.492) (-1014.195) -- 0:01:09
55000 -- (-1017.054) [-1023.041] (-1015.540) (-1014.551) * (-1017.268) [-1013.707] (-1013.170) (-1018.418) -- 0:01:08
Average standard deviation of split frequencies: 0.038623
55500 -- [-1017.639] (-1025.879) (-1016.615) (-1014.914) * (-1019.221) [-1015.088] (-1018.762) (-1014.638) -- 0:01:08
56000 -- (-1013.333) [-1021.695] (-1013.772) (-1014.914) * (-1016.339) [-1013.094] (-1017.641) (-1016.215) -- 0:01:07
56500 -- (-1014.648) (-1025.384) [-1015.057] (-1014.712) * (-1015.448) (-1013.779) [-1015.252] (-1015.908) -- 0:01:06
57000 -- [-1013.316] (-1028.021) (-1017.245) (-1017.323) * (-1015.577) (-1013.256) (-1014.967) [-1013.509] -- 0:01:06
57500 -- (-1013.425) [-1023.215] (-1020.123) (-1016.394) * [-1015.252] (-1013.070) (-1014.787) (-1014.809) -- 0:01:05
58000 -- [-1013.304] (-1024.610) (-1019.618) (-1014.966) * (-1014.168) (-1013.977) (-1015.183) [-1015.564] -- 0:01:04
58500 -- (-1017.746) (-1024.090) (-1014.969) [-1014.989] * (-1015.653) [-1014.696] (-1014.186) (-1016.180) -- 0:01:04
59000 -- (-1015.623) (-1028.718) [-1013.741] (-1014.672) * (-1016.648) (-1016.162) [-1013.558] (-1015.966) -- 0:01:03
59500 -- [-1013.757] (-1027.184) (-1019.116) (-1015.771) * (-1015.939) [-1018.965] (-1017.431) (-1014.549) -- 0:01:03
60000 -- (-1015.184) (-1023.598) [-1016.275] (-1014.803) * (-1015.078) (-1014.153) (-1015.995) [-1016.128] -- 0:01:02
Average standard deviation of split frequencies: 0.035399
60500 -- (-1014.061) (-1027.304) (-1019.636) [-1014.235] * (-1014.348) [-1013.390] (-1015.554) (-1015.473) -- 0:01:02
61000 -- [-1013.874] (-1026.418) (-1017.130) (-1014.882) * (-1013.932) [-1016.034] (-1015.663) (-1016.540) -- 0:01:01
61500 -- (-1014.437) (-1022.257) (-1015.506) [-1014.501] * (-1015.990) (-1013.964) (-1015.717) [-1015.006] -- 0:01:01
62000 -- [-1014.770] (-1021.089) (-1015.601) (-1018.774) * (-1013.109) (-1016.720) [-1014.161] (-1013.567) -- 0:01:00
62500 -- (-1014.233) (-1026.647) [-1017.611] (-1013.008) * [-1015.219] (-1013.383) (-1016.449) (-1013.462) -- 0:01:00
63000 -- (-1013.498) [-1023.960] (-1015.015) (-1015.189) * (-1012.836) (-1015.575) [-1014.345] (-1014.697) -- 0:00:59
63500 -- (-1019.160) [-1028.711] (-1015.187) (-1014.707) * [-1013.269] (-1013.922) (-1013.673) (-1016.420) -- 0:00:58
64000 -- (-1020.054) (-1021.820) (-1013.915) [-1016.065] * (-1016.474) (-1015.174) (-1015.900) [-1013.358] -- 0:01:13
64500 -- (-1018.857) (-1026.769) [-1015.290] (-1017.016) * [-1014.470] (-1013.327) (-1019.656) (-1014.408) -- 0:01:12
65000 -- (-1013.376) [-1018.953] (-1014.068) (-1016.769) * (-1018.442) (-1015.464) [-1014.001] (-1015.368) -- 0:01:11
Average standard deviation of split frequencies: 0.035712
65500 -- (-1018.376) [-1021.981] (-1014.360) (-1014.315) * [-1013.379] (-1014.699) (-1015.808) (-1014.019) -- 0:01:11
66000 -- (-1013.044) (-1042.737) (-1014.333) [-1014.126] * (-1014.456) [-1013.897] (-1015.683) (-1013.827) -- 0:01:10
66500 -- (-1013.121) (-1016.789) [-1015.915] (-1016.623) * [-1013.987] (-1014.581) (-1016.133) (-1012.753) -- 0:01:10
67000 -- [-1015.570] (-1015.716) (-1017.699) (-1016.146) * [-1013.300] (-1013.763) (-1016.689) (-1016.455) -- 0:01:09
67500 -- (-1014.910) (-1016.588) (-1014.014) [-1013.572] * (-1013.386) [-1015.450] (-1016.307) (-1015.156) -- 0:01:09
68000 -- [-1013.839] (-1017.533) (-1017.552) (-1014.908) * (-1013.917) (-1015.610) [-1014.719] (-1016.599) -- 0:01:08
68500 -- (-1013.779) [-1014.720] (-1015.224) (-1018.189) * (-1015.642) [-1019.125] (-1014.846) (-1013.461) -- 0:01:07
69000 -- (-1016.444) (-1014.816) [-1014.475] (-1016.844) * (-1016.080) [-1014.996] (-1014.478) (-1014.022) -- 0:01:07
69500 -- (-1014.893) [-1013.837] (-1013.990) (-1018.892) * [-1016.774] (-1016.292) (-1014.441) (-1016.053) -- 0:01:06
70000 -- [-1014.434] (-1013.946) (-1013.917) (-1014.408) * [-1017.188] (-1015.671) (-1014.936) (-1017.235) -- 0:01:06
Average standard deviation of split frequencies: 0.032301
70500 -- (-1013.356) [-1013.335] (-1014.254) (-1014.145) * (-1016.054) [-1015.150] (-1013.577) (-1014.824) -- 0:01:05
71000 -- [-1015.257] (-1015.936) (-1014.405) (-1015.227) * (-1015.635) (-1014.074) [-1013.566] (-1014.059) -- 0:01:05
71500 -- [-1020.457] (-1016.006) (-1013.039) (-1014.360) * [-1014.476] (-1015.017) (-1013.913) (-1014.120) -- 0:01:04
72000 -- (-1017.721) [-1020.722] (-1014.276) (-1015.786) * (-1016.039) (-1015.850) (-1013.845) [-1014.025] -- 0:01:04
72500 -- (-1015.298) (-1018.004) (-1014.212) [-1015.708] * (-1015.709) (-1015.780) [-1014.259] (-1016.258) -- 0:01:03
73000 -- (-1017.774) (-1015.829) [-1012.955] (-1017.341) * (-1016.641) (-1017.479) (-1016.373) [-1015.504] -- 0:01:03
73500 -- (-1015.837) (-1015.144) [-1013.955] (-1015.275) * (-1015.371) (-1013.959) [-1013.848] (-1021.406) -- 0:01:03
74000 -- (-1015.353) [-1014.447] (-1014.170) (-1016.499) * (-1014.634) (-1013.634) (-1014.319) [-1015.697] -- 0:01:02
74500 -- (-1015.886) [-1013.663] (-1017.353) (-1017.583) * (-1013.727) [-1013.237] (-1016.535) (-1014.912) -- 0:01:02
75000 -- (-1016.101) [-1015.497] (-1013.383) (-1017.116) * (-1014.776) (-1013.717) [-1014.579] (-1015.009) -- 0:01:01
Average standard deviation of split frequencies: 0.035257
75500 -- (-1015.508) [-1014.512] (-1019.173) (-1013.244) * (-1014.663) [-1013.043] (-1013.431) (-1015.322) -- 0:01:01
76000 -- [-1018.414] (-1016.228) (-1013.921) (-1013.629) * (-1016.154) (-1015.308) (-1013.468) [-1015.865] -- 0:01:00
76500 -- [-1017.491] (-1016.630) (-1016.394) (-1016.804) * (-1015.914) (-1016.866) [-1013.346] (-1015.332) -- 0:01:00
77000 -- [-1013.534] (-1013.781) (-1016.948) (-1016.741) * (-1015.093) (-1016.022) (-1017.851) [-1016.524] -- 0:00:59
77500 -- [-1014.703] (-1014.839) (-1016.398) (-1015.977) * (-1018.492) (-1016.221) [-1013.996] (-1013.732) -- 0:00:59
78000 -- (-1014.909) [-1013.926] (-1018.568) (-1015.015) * (-1015.473) (-1013.949) (-1014.280) [-1015.239] -- 0:00:59
78500 -- (-1016.162) (-1016.279) [-1014.809] (-1014.475) * (-1016.937) (-1013.930) [-1014.497] (-1014.677) -- 0:00:58
79000 -- (-1017.137) [-1013.858] (-1015.193) (-1020.566) * [-1015.707] (-1014.123) (-1015.178) (-1014.799) -- 0:00:58
79500 -- (-1014.114) (-1013.846) (-1015.108) [-1017.233] * (-1016.296) (-1016.125) [-1014.890] (-1018.240) -- 0:00:57
80000 -- [-1017.006] (-1016.121) (-1017.181) (-1014.529) * (-1014.912) (-1013.792) (-1020.895) [-1015.552] -- 0:00:57
Average standard deviation of split frequencies: 0.030450
80500 -- (-1014.153) (-1014.816) [-1015.148] (-1016.868) * (-1013.789) (-1015.422) (-1017.005) [-1018.177] -- 0:01:08
81000 -- [-1015.212] (-1015.745) (-1015.172) (-1013.948) * (-1016.068) (-1018.197) (-1016.701) [-1015.238] -- 0:01:08
81500 -- (-1018.161) [-1017.323] (-1014.911) (-1014.568) * [-1014.849] (-1015.092) (-1015.083) (-1013.919) -- 0:01:07
82000 -- (-1015.608) (-1017.821) [-1014.887] (-1014.677) * (-1014.476) (-1014.258) [-1016.236] (-1017.094) -- 0:01:07
82500 -- [-1015.855] (-1016.415) (-1013.996) (-1017.630) * (-1016.981) (-1013.827) (-1014.960) [-1015.526] -- 0:01:06
83000 -- (-1020.303) (-1015.350) (-1014.378) [-1015.911] * (-1018.421) [-1014.011] (-1018.385) (-1013.724) -- 0:01:06
83500 -- [-1014.883] (-1017.598) (-1017.664) (-1013.704) * (-1014.038) [-1016.544] (-1015.772) (-1014.491) -- 0:01:05
84000 -- (-1016.897) (-1019.133) (-1015.133) [-1015.641] * (-1014.189) [-1016.501] (-1014.598) (-1017.302) -- 0:01:05
84500 -- (-1019.118) [-1018.067] (-1015.589) (-1014.432) * (-1013.877) (-1017.163) [-1014.957] (-1020.064) -- 0:01:05
85000 -- (-1016.580) [-1020.550] (-1015.692) (-1014.736) * [-1015.010] (-1018.319) (-1013.845) (-1018.621) -- 0:01:04
Average standard deviation of split frequencies: 0.027407
85500 -- (-1016.175) (-1016.528) [-1013.596] (-1015.969) * (-1013.715) (-1015.558) [-1014.711] (-1019.256) -- 0:01:04
86000 -- (-1016.353) [-1018.841] (-1015.754) (-1015.460) * (-1013.633) [-1013.529] (-1014.469) (-1016.393) -- 0:01:03
86500 -- [-1017.684] (-1017.385) (-1015.678) (-1018.496) * (-1015.584) (-1014.769) [-1014.527] (-1015.095) -- 0:01:03
87000 -- (-1017.008) (-1017.639) [-1013.780] (-1015.054) * (-1015.907) (-1015.154) [-1013.917] (-1019.477) -- 0:01:02
87500 -- [-1015.286] (-1016.838) (-1013.999) (-1013.788) * (-1015.739) (-1013.866) [-1014.895] (-1014.269) -- 0:01:02
88000 -- (-1015.145) (-1014.039) [-1014.869] (-1013.794) * (-1017.045) (-1013.726) [-1013.382] (-1014.356) -- 0:01:02
88500 -- [-1017.055] (-1015.603) (-1014.255) (-1014.511) * (-1015.300) (-1019.407) [-1013.426] (-1016.740) -- 0:01:01
89000 -- (-1016.400) (-1016.831) (-1013.371) [-1014.513] * (-1014.628) (-1015.396) (-1013.333) [-1015.839] -- 0:01:01
89500 -- (-1024.159) (-1017.833) [-1014.375] (-1016.064) * (-1014.585) [-1017.141] (-1014.280) (-1016.430) -- 0:01:01
90000 -- (-1020.850) [-1017.229] (-1014.132) (-1013.927) * (-1015.831) (-1015.517) [-1013.028] (-1013.074) -- 0:01:00
Average standard deviation of split frequencies: 0.026739
90500 -- (-1015.538) (-1016.626) [-1013.926] (-1017.274) * (-1016.027) (-1013.521) [-1013.267] (-1013.420) -- 0:01:00
91000 -- (-1016.858) [-1014.299] (-1014.389) (-1019.439) * (-1018.443) (-1016.184) [-1014.268] (-1015.448) -- 0:00:59
91500 -- (-1016.908) (-1014.294) [-1014.939] (-1014.750) * (-1015.533) [-1014.473] (-1014.590) (-1025.354) -- 0:00:59
92000 -- (-1013.534) (-1016.061) (-1016.261) [-1014.337] * [-1016.154] (-1014.801) (-1013.663) (-1017.892) -- 0:00:59
92500 -- [-1013.798] (-1015.002) (-1015.767) (-1017.363) * (-1016.344) (-1015.605) [-1014.774] (-1016.968) -- 0:00:58
93000 -- (-1014.794) (-1015.400) (-1017.226) [-1014.578] * (-1014.910) [-1013.745] (-1016.948) (-1014.476) -- 0:00:58
93500 -- (-1013.496) (-1014.485) [-1015.540] (-1016.476) * (-1017.595) [-1015.944] (-1014.756) (-1014.413) -- 0:00:58
94000 -- (-1015.637) (-1017.075) (-1017.531) [-1016.480] * (-1017.626) [-1013.438] (-1015.045) (-1014.029) -- 0:00:57
94500 -- [-1014.352] (-1015.865) (-1016.333) (-1014.673) * (-1019.692) [-1015.521] (-1014.298) (-1018.267) -- 0:00:57
95000 -- (-1015.543) (-1013.577) [-1021.966] (-1016.197) * (-1021.186) (-1016.529) [-1013.299] (-1013.908) -- 0:00:57
Average standard deviation of split frequencies: 0.027137
95500 -- [-1015.179] (-1013.517) (-1017.076) (-1015.363) * (-1015.643) [-1017.270] (-1014.267) (-1014.547) -- 0:00:56
96000 -- (-1016.399) [-1014.216] (-1015.621) (-1016.608) * [-1020.426] (-1015.246) (-1014.118) (-1017.571) -- 0:01:05
96500 -- [-1019.508] (-1017.773) (-1018.508) (-1017.286) * [-1017.923] (-1016.738) (-1013.708) (-1016.674) -- 0:01:05
97000 -- (-1013.510) (-1015.426) (-1015.002) [-1015.866] * (-1016.304) (-1015.379) (-1017.524) [-1016.170] -- 0:01:05
97500 -- (-1014.359) (-1014.686) [-1016.299] (-1017.628) * (-1016.254) [-1013.833] (-1014.929) (-1016.309) -- 0:01:04
98000 -- (-1013.816) (-1016.506) [-1015.734] (-1014.629) * (-1014.183) [-1015.185] (-1015.533) (-1014.878) -- 0:01:04
98500 -- (-1013.912) [-1016.343] (-1015.166) (-1013.407) * (-1014.636) [-1017.138] (-1015.395) (-1014.352) -- 0:01:04
99000 -- (-1014.244) [-1014.868] (-1016.500) (-1013.992) * [-1015.001] (-1015.938) (-1015.088) (-1016.714) -- 0:01:03
99500 -- (-1015.085) (-1017.933) [-1015.620] (-1016.057) * (-1014.753) [-1016.084] (-1017.033) (-1018.132) -- 0:01:03
100000 -- (-1016.276) (-1017.171) (-1015.366) [-1014.426] * (-1015.722) [-1013.635] (-1015.871) (-1015.242) -- 0:01:02
Average standard deviation of split frequencies: 0.023180
100500 -- (-1016.708) (-1017.893) [-1016.526] (-1015.011) * (-1018.218) [-1013.088] (-1019.370) (-1016.263) -- 0:01:02
101000 -- (-1015.048) (-1015.877) [-1018.673] (-1015.823) * [-1015.693] (-1016.299) (-1018.304) (-1014.401) -- 0:01:02
101500 -- (-1014.867) (-1018.674) [-1018.657] (-1015.431) * (-1014.198) [-1015.592] (-1016.671) (-1014.241) -- 0:01:01
102000 -- (-1013.590) (-1016.359) [-1013.362] (-1014.877) * (-1015.713) [-1015.549] (-1015.859) (-1016.643) -- 0:01:01
102500 -- (-1015.929) [-1016.986] (-1014.148) (-1014.643) * [-1014.346] (-1016.469) (-1015.166) (-1013.291) -- 0:01:01
103000 -- (-1016.811) (-1014.872) [-1019.340] (-1017.842) * [-1013.180] (-1014.172) (-1015.140) (-1017.092) -- 0:01:00
103500 -- [-1018.173] (-1015.614) (-1015.401) (-1014.416) * (-1015.040) (-1013.329) (-1014.684) [-1014.637] -- 0:01:00
104000 -- (-1015.871) [-1016.397] (-1019.727) (-1016.572) * [-1015.120] (-1015.102) (-1016.115) (-1015.111) -- 0:01:00
104500 -- (-1016.617) (-1016.885) (-1017.778) [-1014.564] * (-1016.910) (-1013.624) (-1015.946) [-1017.094] -- 0:00:59
105000 -- [-1016.992] (-1016.442) (-1016.224) (-1013.457) * (-1016.493) (-1016.264) [-1017.204] (-1013.960) -- 0:00:59
Average standard deviation of split frequencies: 0.022903
105500 -- (-1014.295) (-1016.512) (-1015.592) [-1014.454] * (-1017.917) [-1014.972] (-1014.905) (-1016.704) -- 0:00:59
106000 -- [-1015.745] (-1014.133) (-1017.413) (-1014.327) * (-1015.764) (-1014.821) [-1013.874] (-1016.750) -- 0:00:59
106500 -- (-1014.918) [-1014.047] (-1015.826) (-1014.983) * (-1014.208) [-1014.213] (-1014.041) (-1014.442) -- 0:00:58
107000 -- [-1014.953] (-1016.093) (-1019.632) (-1014.593) * (-1018.194) [-1016.967] (-1016.051) (-1014.344) -- 0:00:58
107500 -- (-1016.130) (-1014.666) (-1016.052) [-1014.074] * (-1014.592) [-1016.635] (-1016.131) (-1017.566) -- 0:00:58
108000 -- (-1015.489) (-1016.017) (-1013.989) [-1014.325] * (-1016.139) (-1016.666) [-1015.518] (-1014.792) -- 0:00:57
108500 -- (-1014.783) (-1014.097) [-1016.923] (-1019.490) * [-1013.653] (-1013.408) (-1013.470) (-1013.214) -- 0:00:57
109000 -- (-1013.884) (-1014.099) [-1016.579] (-1018.689) * (-1013.882) [-1016.955] (-1014.669) (-1016.720) -- 0:00:57
109500 -- [-1013.557] (-1013.332) (-1019.418) (-1014.718) * [-1013.467] (-1015.100) (-1014.579) (-1014.787) -- 0:00:56
110000 -- (-1014.487) (-1013.095) [-1013.827] (-1014.785) * (-1014.757) (-1016.575) (-1014.803) [-1013.722] -- 0:00:56
Average standard deviation of split frequencies: 0.020872
110500 -- (-1013.515) (-1013.277) [-1015.541] (-1013.990) * (-1013.964) [-1013.378] (-1013.397) (-1015.499) -- 0:00:56
111000 -- (-1014.140) (-1019.098) [-1013.652] (-1013.713) * (-1015.014) (-1013.540) (-1013.458) [-1013.552] -- 0:00:56
111500 -- (-1014.687) (-1016.347) [-1014.125] (-1013.520) * (-1014.985) (-1016.483) [-1014.394] (-1013.856) -- 0:00:55
112000 -- [-1014.687] (-1015.846) (-1014.888) (-1013.360) * (-1014.990) (-1013.473) (-1017.473) [-1012.817] -- 0:01:03
112500 -- (-1013.907) (-1015.783) (-1013.992) [-1014.576] * (-1016.615) (-1015.213) (-1015.601) [-1013.221] -- 0:01:03
113000 -- (-1018.245) (-1015.784) (-1013.549) [-1013.610] * (-1014.271) [-1015.689] (-1014.594) (-1013.066) -- 0:01:02
113500 -- (-1013.939) (-1015.027) (-1014.730) [-1019.747] * (-1013.659) [-1014.929] (-1016.569) (-1012.935) -- 0:01:02
114000 -- (-1013.992) [-1017.415] (-1016.210) (-1016.102) * (-1013.660) (-1014.608) [-1018.727] (-1013.671) -- 0:01:02
114500 -- [-1014.412] (-1014.852) (-1016.142) (-1017.776) * (-1013.575) (-1016.260) [-1015.577] (-1014.400) -- 0:01:01
115000 -- [-1016.596] (-1012.958) (-1017.881) (-1016.295) * (-1015.295) (-1015.059) [-1014.147] (-1015.515) -- 0:01:01
Average standard deviation of split frequencies: 0.020929
115500 -- (-1016.568) (-1013.027) (-1015.248) [-1016.803] * (-1015.166) (-1022.070) [-1020.081] (-1014.833) -- 0:01:01
116000 -- (-1015.458) [-1013.040] (-1016.344) (-1020.829) * (-1014.818) (-1016.779) [-1015.533] (-1016.015) -- 0:01:00
116500 -- [-1016.479] (-1013.034) (-1015.862) (-1015.149) * (-1018.161) [-1012.878] (-1016.304) (-1017.298) -- 0:01:00
117000 -- (-1015.901) (-1013.688) (-1014.335) [-1017.105] * (-1018.070) (-1014.197) [-1015.948] (-1013.566) -- 0:01:00
117500 -- (-1015.266) (-1013.363) [-1014.217] (-1017.509) * (-1014.872) (-1014.433) (-1017.621) [-1014.708] -- 0:01:00
118000 -- (-1015.431) [-1013.398] (-1013.980) (-1016.961) * (-1013.986) [-1016.542] (-1018.678) (-1015.149) -- 0:00:59
118500 -- (-1015.344) (-1013.230) [-1015.040] (-1013.983) * (-1017.316) (-1016.583) (-1016.778) [-1017.309] -- 0:00:59
119000 -- (-1014.860) (-1014.287) (-1018.510) [-1015.532] * (-1014.628) [-1013.083] (-1015.281) (-1017.726) -- 0:00:59
119500 -- (-1014.858) (-1016.567) [-1018.309] (-1019.080) * (-1013.439) (-1014.179) (-1013.642) [-1017.760] -- 0:00:58
120000 -- (-1014.092) (-1014.810) [-1014.613] (-1013.663) * (-1013.547) (-1014.741) (-1013.966) [-1014.941] -- 0:00:58
Average standard deviation of split frequencies: 0.018505
120500 -- [-1016.678] (-1015.920) (-1016.691) (-1016.938) * (-1014.099) (-1016.475) [-1014.164] (-1015.981) -- 0:00:58
121000 -- [-1014.939] (-1016.135) (-1016.032) (-1015.089) * (-1016.143) (-1014.498) [-1013.303] (-1015.879) -- 0:00:58
121500 -- (-1014.874) (-1013.352) [-1013.733] (-1013.718) * [-1015.003] (-1015.770) (-1016.528) (-1013.188) -- 0:00:57
122000 -- (-1014.144) (-1017.208) (-1018.528) [-1013.694] * [-1013.291] (-1017.121) (-1016.506) (-1013.742) -- 0:00:57
122500 -- (-1013.037) (-1016.055) (-1014.791) [-1014.188] * (-1014.402) (-1015.137) [-1015.402] (-1016.514) -- 0:00:57
123000 -- [-1017.496] (-1014.299) (-1016.297) (-1013.511) * [-1014.024] (-1014.571) (-1016.430) (-1016.822) -- 0:00:57
123500 -- [-1013.081] (-1013.706) (-1013.958) (-1013.018) * [-1016.259] (-1013.562) (-1016.762) (-1014.562) -- 0:00:56
124000 -- (-1016.648) (-1013.707) [-1015.247] (-1012.973) * (-1017.430) [-1015.040] (-1016.166) (-1015.657) -- 0:00:56
124500 -- (-1017.377) (-1016.606) (-1016.819) [-1014.829] * (-1018.324) [-1013.236] (-1018.271) (-1015.729) -- 0:00:56
125000 -- (-1019.621) (-1013.670) (-1015.244) [-1015.596] * (-1016.489) (-1014.093) (-1017.526) [-1014.566] -- 0:00:56
Average standard deviation of split frequencies: 0.016344
125500 -- (-1018.970) (-1014.315) [-1015.586] (-1013.148) * [-1013.808] (-1016.311) (-1016.678) (-1017.129) -- 0:00:55
126000 -- (-1017.287) [-1018.795] (-1016.079) (-1013.036) * (-1016.089) (-1015.331) [-1012.975] (-1013.903) -- 0:00:55
126500 -- (-1015.743) (-1018.233) [-1017.017] (-1019.542) * (-1013.419) (-1015.561) [-1014.628] (-1013.685) -- 0:00:55
127000 -- (-1014.795) [-1014.100] (-1016.012) (-1014.581) * (-1016.440) (-1013.828) [-1015.745] (-1014.069) -- 0:00:54
127500 -- [-1014.860] (-1013.836) (-1020.711) (-1016.216) * (-1022.827) (-1016.940) [-1016.314] (-1015.381) -- 0:00:54
128000 -- (-1013.555) [-1013.489] (-1020.411) (-1013.945) * (-1018.112) [-1015.797] (-1015.573) (-1016.586) -- 0:01:01
128500 -- (-1014.141) [-1014.374] (-1013.224) (-1013.646) * (-1018.326) (-1016.542) [-1015.742] (-1016.472) -- 0:01:01
129000 -- [-1012.868] (-1013.201) (-1016.887) (-1014.360) * (-1021.135) (-1017.401) [-1013.995] (-1015.148) -- 0:01:00
129500 -- (-1014.508) (-1014.907) (-1013.176) [-1014.704] * (-1015.230) (-1017.801) [-1015.140] (-1014.493) -- 0:01:00
130000 -- (-1014.578) [-1015.914] (-1015.436) (-1015.988) * (-1013.586) [-1017.650] (-1015.560) (-1015.542) -- 0:01:00
Average standard deviation of split frequencies: 0.015570
130500 -- (-1017.031) (-1012.772) (-1015.386) [-1014.509] * (-1013.493) (-1015.066) [-1017.173] (-1014.499) -- 0:00:59
131000 -- [-1018.920] (-1015.025) (-1013.202) (-1013.361) * (-1015.740) [-1015.825] (-1020.574) (-1015.318) -- 0:00:59
131500 -- (-1016.333) (-1013.356) [-1013.614] (-1013.868) * (-1014.847) [-1013.565] (-1019.408) (-1015.274) -- 0:00:59
132000 -- [-1013.315] (-1013.304) (-1013.614) (-1013.439) * (-1014.655) (-1015.627) (-1016.326) [-1016.185] -- 0:00:59
132500 -- [-1013.610] (-1015.041) (-1013.907) (-1014.109) * (-1013.942) [-1015.952] (-1017.971) (-1015.317) -- 0:00:58
133000 -- (-1017.901) (-1015.262) (-1016.117) [-1016.251] * [-1014.901] (-1018.701) (-1017.814) (-1015.091) -- 0:00:58
133500 -- (-1014.634) (-1014.025) (-1013.641) [-1014.260] * [-1015.822] (-1015.539) (-1016.942) (-1016.797) -- 0:00:58
134000 -- (-1015.682) (-1015.708) [-1013.128] (-1015.202) * (-1017.416) (-1014.603) (-1016.774) [-1014.275] -- 0:00:58
134500 -- (-1014.515) [-1015.175] (-1013.249) (-1014.893) * [-1013.992] (-1013.984) (-1013.868) (-1014.214) -- 0:00:57
135000 -- [-1013.749] (-1015.104) (-1014.689) (-1013.232) * (-1016.533) (-1013.966) (-1015.691) [-1014.884] -- 0:00:57
Average standard deviation of split frequencies: 0.013095
135500 -- (-1016.294) [-1015.050] (-1015.207) (-1013.106) * (-1013.434) [-1015.156] (-1017.585) (-1016.296) -- 0:00:57
136000 -- [-1014.628] (-1016.822) (-1013.127) (-1015.114) * [-1015.009] (-1016.697) (-1017.097) (-1013.300) -- 0:00:57
136500 -- [-1017.377] (-1015.250) (-1014.342) (-1014.489) * (-1015.774) (-1015.024) [-1016.713] (-1015.196) -- 0:00:56
137000 -- (-1016.052) [-1020.628] (-1016.174) (-1015.482) * (-1015.331) [-1013.687] (-1017.966) (-1014.026) -- 0:00:56
137500 -- (-1017.100) (-1019.184) (-1017.241) [-1016.619] * (-1016.356) [-1013.121] (-1015.502) (-1016.571) -- 0:00:56
138000 -- [-1014.314] (-1016.637) (-1015.652) (-1014.403) * (-1013.007) [-1012.990] (-1014.440) (-1019.084) -- 0:00:56
138500 -- (-1014.490) (-1015.858) (-1019.095) [-1015.639] * (-1015.660) [-1012.990] (-1014.203) (-1015.397) -- 0:00:55
139000 -- (-1013.331) [-1013.981] (-1013.990) (-1017.174) * (-1017.805) (-1012.954) (-1013.191) [-1015.280] -- 0:00:55
139500 -- (-1013.637) (-1014.207) [-1013.403] (-1014.477) * [-1017.718] (-1015.805) (-1014.981) (-1016.548) -- 0:00:55
140000 -- (-1018.537) (-1013.165) (-1013.713) [-1019.824] * (-1016.741) (-1016.273) [-1013.118] (-1017.660) -- 0:00:55
Average standard deviation of split frequencies: 0.013799
140500 -- (-1013.560) (-1013.665) [-1013.639] (-1016.544) * (-1016.124) (-1019.391) (-1018.403) [-1016.745] -- 0:00:55
141000 -- (-1014.687) (-1015.905) (-1016.241) [-1013.532] * (-1014.448) (-1015.345) (-1018.454) [-1016.387] -- 0:00:54
141500 -- (-1016.190) (-1017.580) (-1015.765) [-1015.096] * (-1015.186) [-1016.726] (-1018.440) (-1016.114) -- 0:00:54
142000 -- (-1015.467) [-1015.831] (-1015.183) (-1013.385) * [-1015.026] (-1014.782) (-1014.698) (-1017.300) -- 0:00:54
142500 -- (-1017.101) (-1015.037) [-1015.795] (-1015.237) * (-1019.788) (-1017.959) (-1018.101) [-1014.279] -- 0:00:54
143000 -- [-1013.231] (-1015.098) (-1013.993) (-1013.163) * [-1018.572] (-1016.262) (-1019.003) (-1016.301) -- 0:00:53
143500 -- (-1014.350) [-1014.768] (-1014.936) (-1013.802) * (-1016.271) (-1014.157) [-1021.080] (-1017.065) -- 0:00:53
144000 -- (-1015.511) [-1014.862] (-1014.830) (-1013.823) * [-1017.365] (-1016.241) (-1016.056) (-1014.926) -- 0:00:59
144500 -- (-1016.970) (-1013.041) (-1013.083) [-1013.734] * (-1016.477) [-1016.810] (-1014.047) (-1014.616) -- 0:00:59
145000 -- (-1017.923) (-1014.610) (-1014.554) [-1014.386] * (-1016.396) (-1014.008) [-1013.593] (-1017.975) -- 0:00:58
Average standard deviation of split frequencies: 0.014275
145500 -- (-1013.986) (-1016.029) [-1016.252] (-1015.205) * (-1015.123) (-1013.261) [-1015.590] (-1015.696) -- 0:00:58
146000 -- (-1014.181) [-1015.804] (-1013.434) (-1014.671) * (-1014.968) [-1013.543] (-1013.186) (-1015.423) -- 0:00:58
146500 -- (-1016.198) [-1014.953] (-1013.156) (-1015.882) * [-1013.279] (-1013.423) (-1021.892) (-1016.998) -- 0:00:58
147000 -- (-1015.328) [-1014.555] (-1014.694) (-1014.609) * (-1015.368) (-1013.696) [-1014.536] (-1017.132) -- 0:00:58
147500 -- [-1014.992] (-1014.554) (-1013.662) (-1014.609) * (-1013.999) [-1014.456] (-1017.588) (-1018.172) -- 0:00:57
148000 -- (-1017.472) (-1016.938) [-1013.966] (-1013.871) * (-1013.588) (-1015.521) (-1018.352) [-1016.450] -- 0:00:57
148500 -- [-1014.594] (-1015.423) (-1014.074) (-1019.407) * [-1015.286] (-1014.228) (-1014.972) (-1017.391) -- 0:00:57
149000 -- (-1016.318) [-1016.855] (-1014.261) (-1014.859) * (-1014.630) (-1014.622) [-1016.394] (-1021.013) -- 0:00:57
149500 -- [-1014.342] (-1015.706) (-1014.758) (-1019.394) * (-1014.700) [-1014.513] (-1014.741) (-1019.266) -- 0:00:56
150000 -- (-1014.000) (-1016.287) [-1016.262] (-1016.915) * [-1015.057] (-1013.588) (-1015.874) (-1015.489) -- 0:00:56
Average standard deviation of split frequencies: 0.014908
150500 -- (-1015.066) (-1013.534) (-1015.984) [-1015.721] * (-1013.952) (-1015.977) [-1015.057] (-1013.772) -- 0:00:56
151000 -- (-1019.773) [-1015.513] (-1013.002) (-1014.393) * (-1013.829) (-1013.289) [-1014.411] (-1013.599) -- 0:00:56
151500 -- (-1017.478) (-1014.171) (-1014.203) [-1015.041] * [-1015.083] (-1017.128) (-1016.447) (-1014.176) -- 0:00:56
152000 -- (-1017.938) (-1014.120) [-1015.018] (-1017.761) * (-1015.179) [-1013.000] (-1017.076) (-1013.526) -- 0:00:55
152500 -- (-1015.346) [-1014.583] (-1013.823) (-1016.020) * [-1014.028] (-1015.631) (-1023.058) (-1013.502) -- 0:00:55
153000 -- (-1017.049) (-1017.609) (-1018.166) [-1017.130] * (-1020.934) (-1014.362) [-1015.141] (-1012.883) -- 0:00:55
153500 -- (-1014.191) (-1014.798) (-1015.203) [-1015.186] * [-1016.174] (-1017.075) (-1013.673) (-1013.035) -- 0:00:55
154000 -- (-1015.277) (-1014.524) (-1014.444) [-1015.518] * (-1014.795) (-1014.503) [-1018.255] (-1016.864) -- 0:00:54
154500 -- (-1015.130) [-1016.379] (-1013.558) (-1017.663) * (-1016.003) (-1014.183) (-1014.883) [-1014.180] -- 0:00:54
155000 -- (-1015.464) (-1014.475) [-1015.677] (-1017.965) * (-1014.115) (-1015.232) [-1015.946] (-1013.493) -- 0:00:54
Average standard deviation of split frequencies: 0.013865
155500 -- (-1017.826) (-1013.210) [-1014.222] (-1017.930) * (-1013.700) [-1014.263] (-1016.088) (-1014.437) -- 0:00:54
156000 -- (-1017.568) [-1013.747] (-1014.046) (-1017.663) * (-1016.213) (-1015.737) [-1016.415] (-1014.907) -- 0:00:54
156500 -- (-1013.991) (-1013.533) [-1013.753] (-1017.251) * (-1015.107) [-1013.943] (-1015.294) (-1019.047) -- 0:00:53
157000 -- [-1013.609] (-1017.357) (-1014.216) (-1014.153) * [-1014.133] (-1017.951) (-1015.379) (-1016.811) -- 0:00:53
157500 -- [-1015.128] (-1014.645) (-1017.647) (-1014.578) * (-1015.337) (-1014.616) [-1017.581] (-1015.366) -- 0:00:53
158000 -- [-1013.196] (-1015.725) (-1016.065) (-1018.246) * (-1017.149) [-1013.743] (-1013.168) (-1017.363) -- 0:00:53
158500 -- (-1012.962) (-1014.273) (-1015.867) [-1014.990] * (-1016.695) [-1013.539] (-1012.820) (-1015.258) -- 0:00:53
159000 -- (-1013.350) [-1012.958] (-1015.338) (-1014.877) * [-1016.281] (-1020.494) (-1016.144) (-1013.175) -- 0:00:52
159500 -- (-1013.685) (-1014.692) [-1019.681] (-1015.401) * (-1015.115) (-1019.482) [-1013.764] (-1013.226) -- 0:00:52
160000 -- (-1016.661) (-1014.410) (-1015.874) [-1015.440] * [-1014.224] (-1019.111) (-1014.869) (-1013.125) -- 0:00:57
Average standard deviation of split frequencies: 0.013980
160500 -- (-1016.127) [-1013.403] (-1016.731) (-1014.396) * (-1020.137) (-1014.248) (-1015.544) [-1013.972] -- 0:00:57
161000 -- (-1014.930) (-1014.023) (-1016.972) [-1015.419] * (-1015.685) (-1015.799) (-1015.521) [-1013.742] -- 0:00:57
161500 -- (-1015.781) (-1015.673) (-1015.238) [-1014.345] * (-1015.330) (-1014.752) (-1013.700) [-1014.238] -- 0:00:57
162000 -- (-1015.635) [-1012.937] (-1013.683) (-1016.486) * [-1016.934] (-1014.153) (-1017.931) (-1014.213) -- 0:00:56
162500 -- [-1012.793] (-1020.847) (-1021.852) (-1014.524) * (-1013.156) (-1015.687) [-1015.205] (-1013.875) -- 0:00:56
163000 -- (-1014.182) (-1019.095) [-1015.657] (-1017.192) * (-1014.565) (-1015.880) [-1015.584] (-1013.170) -- 0:00:56
163500 -- (-1013.755) (-1013.416) [-1015.627] (-1014.006) * (-1012.905) (-1019.643) (-1014.214) [-1014.032] -- 0:00:56
164000 -- (-1013.491) (-1015.848) (-1015.755) [-1013.825] * (-1015.572) [-1018.290] (-1019.162) (-1013.757) -- 0:00:56
164500 -- (-1014.319) (-1013.559) [-1013.464] (-1013.570) * (-1013.354) (-1014.266) [-1018.048] (-1014.373) -- 0:00:55
165000 -- (-1014.120) (-1013.218) [-1014.145] (-1013.701) * (-1015.435) [-1015.163] (-1015.039) (-1014.475) -- 0:00:55
Average standard deviation of split frequencies: 0.014199
165500 -- [-1014.930] (-1013.805) (-1014.931) (-1013.299) * (-1016.146) (-1014.502) (-1014.736) [-1014.867] -- 0:00:55
166000 -- (-1015.676) (-1014.804) [-1014.056] (-1016.280) * [-1017.341] (-1014.917) (-1015.072) (-1013.408) -- 0:00:55
166500 -- (-1013.107) (-1015.372) [-1014.832] (-1018.913) * (-1013.967) (-1013.343) (-1014.243) [-1014.814] -- 0:00:55
167000 -- (-1014.327) [-1015.529] (-1013.423) (-1018.202) * (-1014.503) (-1014.392) (-1016.000) [-1013.549] -- 0:00:54
167500 -- [-1016.680] (-1019.704) (-1014.215) (-1016.769) * (-1013.896) (-1019.804) (-1013.921) [-1013.449] -- 0:00:54
168000 -- (-1016.598) (-1017.417) (-1013.950) [-1015.915] * [-1014.629] (-1017.698) (-1013.934) (-1015.701) -- 0:00:54
168500 -- (-1015.749) (-1015.144) [-1014.241] (-1013.854) * (-1016.802) (-1014.308) [-1014.656] (-1015.818) -- 0:00:54
169000 -- (-1014.810) (-1014.352) [-1013.412] (-1017.058) * (-1014.470) (-1016.255) (-1014.236) [-1014.320] -- 0:00:54
169500 -- (-1013.405) (-1016.532) (-1014.810) [-1014.487] * [-1014.977] (-1014.846) (-1015.408) (-1013.164) -- 0:00:53
170000 -- (-1016.860) (-1019.427) (-1014.824) [-1014.172] * (-1015.389) (-1014.680) [-1014.315] (-1013.268) -- 0:00:53
Average standard deviation of split frequencies: 0.015598
170500 -- (-1015.217) (-1019.657) [-1013.987] (-1015.251) * (-1018.144) (-1014.973) (-1016.227) [-1012.854] -- 0:00:53
171000 -- (-1017.999) [-1019.455] (-1013.771) (-1018.530) * (-1024.043) (-1014.414) [-1014.724] (-1012.645) -- 0:00:53
171500 -- (-1015.686) (-1017.903) (-1014.128) [-1015.067] * (-1014.488) [-1014.303] (-1016.379) (-1014.084) -- 0:00:53
172000 -- (-1015.483) (-1015.247) [-1015.852] (-1015.468) * (-1020.659) (-1017.904) [-1014.753] (-1014.564) -- 0:00:52
172500 -- (-1015.330) (-1013.929) [-1018.507] (-1015.469) * (-1014.565) (-1017.445) [-1014.386] (-1017.353) -- 0:00:52
173000 -- (-1013.433) [-1014.539] (-1013.051) (-1015.952) * (-1014.504) (-1016.053) [-1015.445] (-1017.885) -- 0:00:52
173500 -- [-1014.428] (-1015.769) (-1019.405) (-1014.781) * [-1024.133] (-1014.245) (-1014.393) (-1014.581) -- 0:00:52
174000 -- [-1013.964] (-1015.839) (-1016.183) (-1015.015) * [-1014.898] (-1013.225) (-1014.885) (-1015.824) -- 0:00:52
174500 -- (-1014.344) (-1013.692) (-1014.752) [-1015.917] * (-1016.542) [-1014.150] (-1014.699) (-1024.024) -- 0:00:52
175000 -- (-1019.525) (-1013.520) (-1016.268) [-1013.742] * (-1014.018) (-1016.334) (-1017.017) [-1015.649] -- 0:00:51
Average standard deviation of split frequencies: 0.014434
175500 -- (-1014.302) [-1012.990] (-1016.555) (-1013.767) * [-1013.441] (-1016.402) (-1015.486) (-1014.859) -- 0:00:51
176000 -- (-1013.660) (-1012.980) (-1017.294) [-1015.232] * (-1014.829) [-1019.187] (-1013.432) (-1016.331) -- 0:00:51
176500 -- (-1015.027) (-1017.825) (-1017.079) [-1017.126] * (-1012.867) [-1015.753] (-1013.432) (-1014.025) -- 0:00:55
177000 -- (-1014.017) (-1016.785) [-1015.688] (-1017.520) * (-1017.597) (-1015.438) (-1014.424) [-1015.433] -- 0:00:55
177500 -- (-1018.320) (-1013.409) (-1014.657) [-1013.143] * (-1013.913) (-1015.156) [-1013.399] (-1014.792) -- 0:00:55
178000 -- (-1016.822) [-1014.099] (-1015.305) (-1014.564) * (-1017.121) (-1014.654) (-1013.750) [-1013.480] -- 0:00:55
178500 -- (-1015.594) (-1015.952) [-1013.913] (-1013.343) * (-1014.468) (-1014.824) (-1012.832) [-1016.832] -- 0:00:55
179000 -- (-1013.665) (-1017.453) [-1014.449] (-1013.403) * (-1015.885) (-1013.611) [-1014.392] (-1018.143) -- 0:00:55
179500 -- (-1013.940) [-1013.953] (-1015.514) (-1014.575) * (-1017.476) (-1015.631) (-1015.796) [-1015.027] -- 0:00:54
180000 -- (-1013.829) (-1014.354) (-1018.240) [-1015.434] * (-1016.661) (-1015.303) [-1015.696] (-1018.967) -- 0:00:54
Average standard deviation of split frequencies: 0.015511
180500 -- (-1014.561) (-1014.443) (-1014.872) [-1012.960] * (-1018.084) [-1014.839] (-1014.264) (-1013.301) -- 0:00:54
181000 -- (-1013.218) (-1013.674) (-1017.062) [-1014.141] * (-1018.881) [-1014.086] (-1015.214) (-1017.453) -- 0:00:54
181500 -- (-1015.990) (-1015.289) (-1016.521) [-1014.640] * [-1015.445] (-1013.228) (-1017.906) (-1016.982) -- 0:00:54
182000 -- (-1016.316) (-1015.264) (-1017.226) [-1015.482] * (-1019.024) [-1014.021] (-1013.986) (-1013.538) -- 0:00:53
182500 -- (-1014.765) [-1013.869] (-1014.602) (-1014.372) * (-1015.662) (-1017.877) (-1016.477) [-1014.167] -- 0:00:53
183000 -- [-1015.181] (-1014.050) (-1017.072) (-1014.685) * (-1013.730) (-1018.756) (-1017.117) [-1016.036] -- 0:00:53
183500 -- (-1015.412) [-1014.336] (-1016.767) (-1014.918) * (-1015.070) [-1015.379] (-1016.001) (-1016.701) -- 0:00:53
184000 -- (-1016.741) (-1018.680) (-1014.712) [-1014.939] * (-1014.489) (-1015.725) (-1015.846) [-1014.496] -- 0:00:53
184500 -- [-1015.204] (-1016.822) (-1015.151) (-1014.444) * (-1014.642) (-1021.374) (-1013.728) [-1014.879] -- 0:00:53
185000 -- (-1013.549) (-1016.131) (-1014.539) [-1013.005] * [-1014.766] (-1014.584) (-1015.631) (-1015.712) -- 0:00:52
Average standard deviation of split frequencies: 0.015207
185500 -- (-1013.769) (-1015.154) [-1015.580] (-1013.513) * (-1014.805) (-1014.132) [-1014.412] (-1014.485) -- 0:00:52
186000 -- (-1016.482) [-1014.235] (-1014.685) (-1014.215) * (-1013.540) (-1013.499) [-1013.599] (-1013.260) -- 0:00:52
186500 -- [-1014.118] (-1017.047) (-1015.240) (-1015.627) * (-1017.309) (-1015.178) (-1016.340) [-1013.862] -- 0:00:52
187000 -- (-1014.059) (-1019.573) (-1015.475) [-1016.472] * (-1015.943) [-1017.926] (-1015.700) (-1015.249) -- 0:00:52
187500 -- (-1014.092) [-1017.593] (-1015.380) (-1013.651) * (-1014.593) (-1018.602) (-1016.602) [-1014.121] -- 0:00:52
188000 -- (-1013.994) [-1014.756] (-1016.862) (-1014.664) * (-1013.418) [-1015.864] (-1014.947) (-1015.514) -- 0:00:51
188500 -- [-1015.781] (-1015.001) (-1017.129) (-1021.172) * [-1013.851] (-1013.796) (-1015.758) (-1017.393) -- 0:00:51
189000 -- [-1014.504] (-1014.864) (-1014.606) (-1013.090) * (-1019.450) [-1015.722] (-1013.769) (-1013.596) -- 0:00:51
189500 -- (-1014.103) [-1012.947] (-1018.865) (-1016.671) * (-1017.936) (-1014.993) (-1012.951) [-1015.588] -- 0:00:51
190000 -- (-1014.017) (-1013.293) (-1014.776) [-1017.687] * (-1016.609) [-1016.737] (-1016.590) (-1017.390) -- 0:00:51
Average standard deviation of split frequencies: 0.014965
190500 -- (-1014.017) [-1014.875] (-1014.507) (-1015.140) * [-1014.390] (-1014.521) (-1016.222) (-1013.477) -- 0:00:50
191000 -- (-1014.871) [-1014.299] (-1014.811) (-1015.540) * (-1014.197) (-1015.699) (-1015.656) [-1014.730] -- 0:00:50
191500 -- (-1014.454) (-1017.478) [-1016.576] (-1014.570) * (-1014.585) [-1018.506] (-1014.207) (-1014.464) -- 0:00:50
192000 -- (-1015.131) (-1015.375) (-1017.619) [-1015.552] * (-1015.099) (-1014.707) (-1015.507) [-1015.565] -- 0:00:50
192500 -- (-1015.275) (-1017.773) (-1015.665) [-1014.835] * (-1014.244) (-1016.663) (-1015.800) [-1015.558] -- 0:00:50
193000 -- (-1012.988) (-1014.695) [-1016.959] (-1016.425) * (-1013.870) [-1015.669] (-1015.667) (-1014.438) -- 0:00:54
193500 -- (-1012.972) (-1015.887) (-1013.872) [-1020.856] * (-1017.826) (-1015.293) (-1013.553) [-1014.635] -- 0:00:54
194000 -- (-1014.789) (-1017.196) (-1016.700) [-1017.166] * [-1015.734] (-1014.302) (-1013.349) (-1019.579) -- 0:00:54
194500 -- (-1015.974) (-1015.023) (-1016.566) [-1017.271] * (-1016.467) (-1015.692) (-1014.089) [-1021.828] -- 0:00:53
195000 -- [-1017.021] (-1013.654) (-1018.777) (-1018.103) * (-1014.154) (-1018.274) [-1015.309] (-1017.994) -- 0:00:53
Average standard deviation of split frequencies: 0.016456
195500 -- [-1013.827] (-1013.120) (-1014.538) (-1016.078) * [-1015.229] (-1017.864) (-1014.457) (-1013.858) -- 0:00:53
196000 -- [-1013.816] (-1018.426) (-1015.123) (-1018.600) * (-1014.720) (-1016.766) [-1014.282] (-1014.385) -- 0:00:53
196500 -- [-1014.459] (-1016.122) (-1018.842) (-1018.156) * [-1015.732] (-1016.677) (-1015.304) (-1015.704) -- 0:00:53
197000 -- (-1014.992) (-1013.070) [-1015.492] (-1017.548) * [-1015.164] (-1015.580) (-1015.651) (-1014.323) -- 0:00:52
197500 -- [-1013.808] (-1014.522) (-1015.277) (-1022.668) * (-1015.520) (-1016.256) [-1013.665] (-1013.828) -- 0:00:52
198000 -- (-1013.620) (-1015.149) (-1017.094) [-1016.508] * (-1015.028) (-1013.983) [-1013.144] (-1017.859) -- 0:00:52
198500 -- [-1016.638] (-1015.620) (-1021.235) (-1018.057) * (-1020.263) [-1014.337] (-1016.982) (-1016.224) -- 0:00:52
199000 -- (-1016.177) [-1015.514] (-1015.751) (-1014.706) * (-1017.122) (-1013.737) (-1016.642) [-1016.055] -- 0:00:52
199500 -- [-1016.262] (-1019.105) (-1013.638) (-1013.525) * (-1019.652) (-1013.676) (-1014.948) [-1016.781] -- 0:00:52
200000 -- (-1014.615) [-1014.021] (-1013.531) (-1014.342) * [-1014.639] (-1013.059) (-1017.550) (-1018.186) -- 0:00:51
Average standard deviation of split frequencies: 0.014713
200500 -- [-1014.268] (-1017.390) (-1014.600) (-1014.495) * (-1013.896) [-1012.969] (-1014.803) (-1016.859) -- 0:00:51
201000 -- (-1016.441) [-1013.517] (-1015.733) (-1014.861) * (-1016.506) [-1013.087] (-1015.122) (-1013.736) -- 0:00:51
201500 -- [-1014.536] (-1013.684) (-1014.626) (-1013.795) * (-1016.293) [-1012.878] (-1016.089) (-1015.024) -- 0:00:51
202000 -- (-1013.663) [-1013.290] (-1020.652) (-1014.924) * (-1017.508) [-1013.507] (-1015.879) (-1015.651) -- 0:00:51
202500 -- (-1013.591) (-1014.202) [-1016.525] (-1014.550) * [-1018.741] (-1017.742) (-1017.049) (-1013.713) -- 0:00:51
203000 -- (-1015.106) (-1014.647) [-1015.096] (-1013.388) * (-1020.847) [-1014.764] (-1016.191) (-1015.965) -- 0:00:51
203500 -- (-1014.256) [-1014.313] (-1016.242) (-1013.381) * (-1021.155) (-1016.157) (-1015.438) [-1013.368] -- 0:00:50
204000 -- (-1016.438) (-1013.409) (-1013.856) [-1013.618] * (-1018.766) (-1014.158) [-1014.477] (-1014.012) -- 0:00:50
204500 -- (-1017.621) (-1014.341) (-1013.768) [-1014.619] * (-1017.607) (-1015.570) (-1015.495) [-1015.662] -- 0:00:50
205000 -- (-1013.530) [-1014.773] (-1014.300) (-1013.820) * (-1019.915) (-1017.104) [-1013.820] (-1013.416) -- 0:00:50
Average standard deviation of split frequencies: 0.013489
205500 -- (-1017.756) [-1014.849] (-1013.777) (-1014.400) * (-1015.021) [-1017.276] (-1014.604) (-1013.445) -- 0:00:50
206000 -- (-1015.793) (-1014.714) [-1017.517] (-1012.955) * (-1015.154) (-1015.783) [-1014.395] (-1014.816) -- 0:00:50
206500 -- [-1015.390] (-1016.208) (-1014.836) (-1015.206) * [-1018.804] (-1012.907) (-1014.406) (-1014.200) -- 0:00:49
207000 -- (-1014.945) [-1014.352] (-1014.731) (-1014.811) * [-1016.906] (-1016.145) (-1013.400) (-1014.987) -- 0:00:49
207500 -- (-1019.483) (-1014.575) (-1015.174) [-1016.239] * [-1015.177] (-1013.945) (-1014.117) (-1018.440) -- 0:00:49
208000 -- (-1016.276) [-1014.276] (-1015.694) (-1016.873) * (-1015.237) [-1013.633] (-1013.623) (-1014.684) -- 0:00:49
208500 -- [-1020.929] (-1016.244) (-1018.093) (-1014.217) * (-1016.018) (-1013.221) [-1013.253] (-1013.419) -- 0:00:49
209000 -- [-1017.553] (-1013.780) (-1015.568) (-1016.712) * (-1016.975) (-1012.918) [-1015.919] (-1013.783) -- 0:00:52
209500 -- (-1017.251) [-1014.841] (-1014.019) (-1016.093) * (-1021.042) [-1013.103] (-1014.323) (-1013.030) -- 0:00:52
210000 -- (-1013.233) [-1015.974] (-1013.976) (-1017.172) * (-1017.065) (-1013.165) [-1013.355] (-1015.739) -- 0:00:52
Average standard deviation of split frequencies: 0.014296
210500 -- (-1015.187) (-1016.087) [-1015.324] (-1015.771) * (-1014.438) (-1014.147) (-1014.235) [-1017.492] -- 0:00:52
211000 -- (-1016.711) (-1014.169) (-1015.833) [-1020.208] * [-1013.443] (-1013.120) (-1014.575) (-1015.039) -- 0:00:52
211500 -- (-1014.137) [-1014.539] (-1018.789) (-1018.488) * (-1013.655) [-1017.265] (-1014.576) (-1013.212) -- 0:00:52
212000 -- (-1014.630) (-1015.802) (-1015.665) [-1016.623] * (-1014.341) (-1017.409) [-1014.390] (-1016.376) -- 0:00:52
212500 -- (-1016.165) [-1014.339] (-1013.172) (-1016.947) * (-1013.754) (-1015.331) [-1013.665] (-1015.183) -- 0:00:51
213000 -- (-1013.073) (-1014.074) [-1013.090] (-1015.334) * (-1014.140) (-1015.875) [-1013.681] (-1012.939) -- 0:00:51
213500 -- (-1022.686) (-1014.308) (-1013.743) [-1013.793] * (-1015.015) (-1014.050) [-1014.494] (-1013.023) -- 0:00:51
214000 -- (-1015.236) [-1016.681] (-1013.604) (-1013.911) * (-1013.740) (-1014.122) [-1019.233] (-1017.210) -- 0:00:51
214500 -- (-1016.157) [-1019.818] (-1016.083) (-1014.556) * [-1014.358] (-1013.498) (-1014.952) (-1015.184) -- 0:00:51
215000 -- (-1015.690) (-1017.698) (-1020.349) [-1013.241] * [-1013.782] (-1013.832) (-1015.437) (-1018.193) -- 0:00:51
Average standard deviation of split frequencies: 0.014671
215500 -- [-1015.792] (-1014.607) (-1016.819) (-1014.406) * (-1015.155) (-1013.023) [-1016.654] (-1016.653) -- 0:00:50
216000 -- (-1014.737) [-1016.009] (-1018.645) (-1016.677) * (-1016.508) (-1013.188) (-1015.921) [-1018.241] -- 0:00:50
216500 -- [-1014.809] (-1015.240) (-1018.721) (-1016.770) * (-1013.614) [-1014.065] (-1014.206) (-1020.795) -- 0:00:50
217000 -- (-1015.616) [-1014.259] (-1015.509) (-1016.589) * (-1013.864) (-1015.214) [-1013.016] (-1016.956) -- 0:00:50
217500 -- [-1014.253] (-1014.542) (-1014.750) (-1019.163) * (-1015.304) [-1014.377] (-1013.211) (-1019.478) -- 0:00:50
218000 -- (-1015.279) (-1014.940) (-1014.590) [-1017.283] * [-1014.295] (-1013.434) (-1018.117) (-1015.162) -- 0:00:50
218500 -- (-1013.387) (-1014.685) [-1014.034] (-1016.672) * (-1014.996) [-1013.438] (-1017.504) (-1015.176) -- 0:00:50
219000 -- [-1015.159] (-1014.118) (-1014.016) (-1018.133) * (-1014.959) (-1015.592) (-1014.161) [-1016.125] -- 0:00:49
219500 -- (-1015.380) [-1018.927] (-1020.141) (-1015.621) * (-1016.876) (-1014.999) (-1015.958) [-1014.861] -- 0:00:49
220000 -- (-1017.530) [-1013.682] (-1018.998) (-1017.720) * (-1013.589) [-1013.598] (-1015.776) (-1017.391) -- 0:00:49
Average standard deviation of split frequencies: 0.015429
220500 -- (-1015.414) (-1013.129) [-1015.984] (-1017.248) * (-1012.918) [-1013.181] (-1015.184) (-1016.191) -- 0:00:49
221000 -- (-1012.869) (-1013.704) [-1015.518] (-1015.046) * (-1014.357) (-1014.362) [-1014.865] (-1018.657) -- 0:00:49
221500 -- (-1015.547) [-1014.568] (-1017.234) (-1015.761) * [-1014.826] (-1014.579) (-1016.077) (-1016.228) -- 0:00:49
222000 -- [-1013.984] (-1017.419) (-1015.489) (-1015.140) * (-1013.441) [-1017.348] (-1013.532) (-1019.123) -- 0:00:49
222500 -- (-1018.489) (-1014.370) (-1014.135) [-1013.912] * (-1013.126) (-1014.272) (-1014.187) [-1014.512] -- 0:00:48
223000 -- (-1014.853) (-1019.136) [-1013.492] (-1017.241) * (-1015.645) [-1015.528] (-1013.287) (-1016.476) -- 0:00:48
223500 -- (-1015.922) (-1014.151) (-1015.322) [-1013.664] * [-1016.730] (-1019.473) (-1014.427) (-1016.738) -- 0:00:48
224000 -- (-1015.857) (-1014.008) (-1017.379) [-1013.407] * (-1019.290) (-1018.778) (-1015.153) [-1016.206] -- 0:00:48
224500 -- (-1015.628) (-1018.842) (-1013.183) [-1014.416] * (-1019.724) (-1018.969) (-1013.685) [-1016.602] -- 0:00:51
225000 -- [-1014.338] (-1013.061) (-1013.305) (-1014.395) * (-1017.249) (-1014.335) [-1013.934] (-1014.071) -- 0:00:51
Average standard deviation of split frequencies: 0.015528
225500 -- [-1014.073] (-1015.094) (-1015.947) (-1017.471) * (-1016.980) (-1015.631) [-1014.253] (-1013.806) -- 0:00:51
226000 -- (-1013.734) (-1017.766) (-1014.299) [-1017.408] * (-1017.851) (-1013.601) [-1016.300] (-1013.829) -- 0:00:51
226500 -- [-1014.236] (-1017.996) (-1013.295) (-1016.804) * (-1018.315) (-1014.586) [-1017.268] (-1013.772) -- 0:00:51
227000 -- (-1013.428) (-1017.804) [-1012.860] (-1017.446) * (-1017.591) (-1016.310) [-1018.029] (-1015.716) -- 0:00:51
227500 -- [-1013.304] (-1015.080) (-1015.729) (-1018.562) * [-1013.443] (-1014.081) (-1015.216) (-1015.291) -- 0:00:50
228000 -- (-1015.608) [-1015.642] (-1012.982) (-1024.886) * (-1013.181) [-1014.367] (-1017.518) (-1014.518) -- 0:00:50
228500 -- (-1014.554) (-1018.964) (-1014.937) [-1014.477] * (-1014.131) [-1014.019] (-1014.762) (-1015.021) -- 0:00:50
229000 -- [-1015.545] (-1018.017) (-1017.045) (-1013.624) * (-1018.642) [-1014.897] (-1014.285) (-1021.635) -- 0:00:50
229500 -- (-1018.611) [-1014.479] (-1020.090) (-1013.995) * (-1014.830) (-1014.342) (-1014.889) [-1016.726] -- 0:00:50
230000 -- (-1016.991) (-1013.893) [-1015.195] (-1014.682) * (-1013.892) (-1014.647) [-1014.017] (-1013.836) -- 0:00:50
Average standard deviation of split frequencies: 0.014646
230500 -- (-1016.001) (-1016.905) [-1014.245] (-1015.574) * (-1014.555) (-1017.477) (-1014.874) [-1014.466] -- 0:00:50
231000 -- (-1014.809) (-1016.246) [-1016.026] (-1015.180) * (-1015.772) (-1015.721) (-1015.326) [-1012.982] -- 0:00:49
231500 -- (-1017.486) [-1013.695] (-1019.924) (-1013.607) * (-1014.058) (-1019.604) [-1012.860] (-1017.061) -- 0:00:49
232000 -- (-1016.090) (-1014.509) (-1014.909) [-1014.099] * [-1016.177] (-1019.779) (-1017.537) (-1013.803) -- 0:00:49
232500 -- (-1017.072) (-1016.127) [-1016.798] (-1015.470) * (-1013.631) (-1016.567) (-1015.335) [-1013.372] -- 0:00:49
233000 -- (-1017.380) [-1015.877] (-1017.698) (-1015.212) * (-1014.046) [-1014.616] (-1017.477) (-1013.243) -- 0:00:49
233500 -- (-1015.126) (-1016.069) [-1014.021] (-1016.334) * [-1014.293] (-1015.404) (-1018.305) (-1013.864) -- 0:00:49
234000 -- (-1014.975) [-1014.783] (-1018.197) (-1015.150) * [-1012.914] (-1016.120) (-1018.924) (-1012.892) -- 0:00:49
234500 -- [-1016.893] (-1013.517) (-1016.949) (-1019.809) * (-1013.064) [-1017.003] (-1017.037) (-1013.176) -- 0:00:48
235000 -- (-1015.647) [-1015.667] (-1016.207) (-1014.357) * (-1013.071) (-1014.510) (-1014.619) [-1015.460] -- 0:00:48
Average standard deviation of split frequencies: 0.013317
235500 -- (-1018.815) [-1016.193] (-1013.506) (-1013.188) * (-1014.084) [-1015.121] (-1014.895) (-1015.389) -- 0:00:48
236000 -- (-1015.215) [-1016.836] (-1013.529) (-1020.610) * [-1014.583] (-1015.740) (-1014.407) (-1013.529) -- 0:00:48
236500 -- (-1016.638) (-1015.738) (-1013.123) [-1015.005] * (-1015.014) [-1015.650] (-1013.981) (-1015.650) -- 0:00:48
237000 -- (-1014.656) [-1013.982] (-1014.133) (-1017.425) * (-1015.464) (-1019.453) [-1014.144] (-1016.760) -- 0:00:48
237500 -- (-1018.241) (-1013.515) (-1013.948) [-1014.201] * (-1014.470) (-1021.998) [-1013.351] (-1015.012) -- 0:00:48
238000 -- (-1015.016) (-1015.365) (-1015.713) [-1015.003] * (-1017.261) (-1021.089) (-1019.279) [-1015.666] -- 0:00:48
238500 -- (-1014.757) (-1017.472) [-1015.049] (-1015.796) * (-1015.497) (-1016.084) (-1013.052) [-1015.247] -- 0:00:47
239000 -- (-1014.990) (-1015.462) [-1015.932] (-1017.541) * (-1015.151) [-1015.262] (-1013.686) (-1014.988) -- 0:00:47
239500 -- [-1014.786] (-1016.227) (-1018.126) (-1013.093) * (-1016.361) (-1013.647) [-1013.263] (-1016.290) -- 0:00:47
240000 -- (-1014.624) (-1022.201) [-1014.067] (-1017.245) * [-1015.046] (-1013.809) (-1014.535) (-1015.724) -- 0:00:47
Average standard deviation of split frequencies: 0.013058
240500 -- (-1014.682) (-1016.950) [-1015.452] (-1017.937) * (-1014.155) (-1014.277) (-1013.300) [-1015.164] -- 0:00:47
241000 -- [-1013.981] (-1017.937) (-1013.475) (-1015.077) * (-1015.306) (-1017.192) (-1013.353) [-1013.899] -- 0:00:50
241500 -- (-1013.983) (-1016.238) [-1013.879] (-1016.860) * (-1016.043) (-1013.884) (-1015.650) [-1018.266] -- 0:00:50
242000 -- (-1014.408) (-1015.530) (-1015.029) [-1015.235] * (-1015.471) [-1017.047] (-1013.109) (-1012.909) -- 0:00:50
242500 -- (-1018.706) [-1014.244] (-1018.289) (-1013.664) * (-1013.560) (-1017.143) [-1012.948] (-1013.828) -- 0:00:49
243000 -- [-1014.949] (-1014.639) (-1017.827) (-1016.319) * (-1013.133) [-1014.154] (-1014.141) (-1014.536) -- 0:00:49
243500 -- (-1017.479) (-1013.505) (-1014.818) [-1013.606] * (-1016.318) (-1014.713) (-1015.709) [-1014.444] -- 0:00:49
244000 -- (-1016.944) (-1022.664) (-1013.922) [-1013.833] * (-1013.611) [-1015.733] (-1018.406) (-1016.074) -- 0:00:49
244500 -- (-1024.003) (-1016.932) [-1013.928] (-1014.224) * (-1013.492) (-1021.854) (-1018.659) [-1015.137] -- 0:00:49
245000 -- (-1023.699) (-1015.395) [-1015.025] (-1014.633) * [-1015.514] (-1020.030) (-1015.306) (-1017.505) -- 0:00:49
Average standard deviation of split frequencies: 0.015011
245500 -- (-1017.741) (-1014.191) [-1013.165] (-1015.323) * (-1014.432) (-1018.313) [-1015.562] (-1013.685) -- 0:00:49
246000 -- (-1016.426) (-1015.709) [-1013.531] (-1014.156) * (-1013.827) (-1021.177) (-1014.774) [-1016.649] -- 0:00:49
246500 -- (-1015.362) [-1017.404] (-1014.672) (-1012.714) * (-1013.509) [-1013.909] (-1014.589) (-1017.571) -- 0:00:48
247000 -- (-1015.891) (-1015.219) [-1013.937] (-1015.488) * (-1013.737) (-1013.346) (-1015.630) [-1014.551] -- 0:00:48
247500 -- (-1015.746) (-1013.392) (-1014.083) [-1016.168] * [-1013.736] (-1014.040) (-1013.819) (-1013.852) -- 0:00:48
248000 -- [-1014.349] (-1016.489) (-1013.935) (-1013.994) * [-1013.799] (-1013.022) (-1014.228) (-1019.714) -- 0:00:48
248500 -- [-1017.760] (-1017.411) (-1014.207) (-1015.297) * (-1017.282) (-1014.785) (-1014.153) [-1014.182] -- 0:00:48
249000 -- (-1015.647) (-1016.000) [-1015.248] (-1018.466) * [-1018.060] (-1013.523) (-1014.626) (-1017.777) -- 0:00:48
249500 -- (-1014.782) (-1013.597) [-1013.307] (-1017.306) * (-1015.014) [-1013.420] (-1017.171) (-1015.550) -- 0:00:48
250000 -- (-1013.911) (-1014.548) (-1016.634) [-1015.696] * (-1017.478) [-1015.466] (-1013.642) (-1014.523) -- 0:00:48
Average standard deviation of split frequencies: 0.015342
250500 -- (-1013.903) [-1016.299] (-1013.475) (-1018.249) * [-1013.015] (-1016.614) (-1015.348) (-1014.840) -- 0:00:47
251000 -- (-1013.503) (-1014.851) [-1014.269] (-1016.331) * (-1015.376) [-1016.386] (-1016.380) (-1015.129) -- 0:00:47
251500 -- (-1013.530) (-1015.182) (-1013.695) [-1020.566] * (-1014.844) [-1015.527] (-1016.611) (-1014.423) -- 0:00:47
252000 -- [-1013.709] (-1014.791) (-1013.649) (-1021.612) * [-1014.392] (-1015.095) (-1014.425) (-1014.777) -- 0:00:47
252500 -- (-1013.796) (-1014.748) [-1015.788] (-1013.927) * [-1021.539] (-1013.614) (-1014.427) (-1014.651) -- 0:00:47
253000 -- [-1018.632] (-1015.881) (-1016.594) (-1013.100) * (-1015.501) (-1016.292) [-1013.732] (-1020.852) -- 0:00:47
253500 -- [-1014.626] (-1018.806) (-1013.675) (-1013.308) * [-1013.904] (-1017.114) (-1014.984) (-1018.864) -- 0:00:47
254000 -- [-1014.372] (-1017.973) (-1018.649) (-1013.371) * [-1014.692] (-1014.319) (-1014.480) (-1015.827) -- 0:00:46
254500 -- (-1014.859) [-1017.744] (-1015.602) (-1014.532) * (-1017.200) (-1014.570) (-1012.746) [-1014.667] -- 0:00:46
255000 -- (-1013.406) [-1015.240] (-1013.875) (-1015.462) * (-1014.063) (-1015.806) (-1014.101) [-1014.831] -- 0:00:46
Average standard deviation of split frequencies: 0.015507
255500 -- (-1013.725) [-1015.578] (-1013.875) (-1016.397) * (-1014.504) (-1017.179) [-1014.545] (-1014.160) -- 0:00:46
256000 -- (-1015.025) [-1015.521] (-1013.477) (-1015.883) * (-1013.035) (-1019.566) (-1016.318) [-1014.373] -- 0:00:46
256500 -- [-1013.956] (-1016.351) (-1013.561) (-1014.300) * [-1014.667] (-1016.406) (-1016.186) (-1013.731) -- 0:00:46
257000 -- [-1018.650] (-1018.604) (-1013.630) (-1017.476) * [-1013.549] (-1014.627) (-1014.001) (-1014.469) -- 0:00:46
257500 -- (-1021.313) (-1014.796) [-1012.892] (-1018.774) * (-1014.904) [-1015.428] (-1014.572) (-1013.845) -- 0:00:49
258000 -- (-1013.424) (-1015.618) [-1018.075] (-1012.823) * [-1017.991] (-1014.500) (-1014.450) (-1016.957) -- 0:00:48
258500 -- (-1014.529) (-1018.279) (-1016.942) [-1015.074] * (-1021.174) (-1013.190) [-1015.261] (-1015.879) -- 0:00:48
259000 -- [-1013.847] (-1013.845) (-1015.528) (-1013.700) * (-1020.532) [-1013.140] (-1016.470) (-1016.371) -- 0:00:48
259500 -- [-1016.049] (-1013.424) (-1016.461) (-1016.260) * (-1015.799) [-1015.062] (-1013.408) (-1014.934) -- 0:00:48
260000 -- [-1015.601] (-1013.638) (-1021.062) (-1013.182) * (-1015.133) (-1018.069) [-1015.137] (-1016.010) -- 0:00:48
Average standard deviation of split frequencies: 0.016847
260500 -- (-1016.774) (-1014.232) (-1015.758) [-1014.961] * (-1016.122) [-1015.744] (-1013.176) (-1018.344) -- 0:00:48
261000 -- (-1013.781) [-1015.139] (-1014.745) (-1017.868) * [-1014.139] (-1016.856) (-1012.926) (-1016.360) -- 0:00:48
261500 -- (-1014.739) (-1014.664) [-1015.512] (-1012.835) * (-1018.487) (-1020.352) [-1013.661] (-1014.178) -- 0:00:48
262000 -- (-1019.526) (-1014.894) (-1015.348) [-1013.318] * (-1014.432) (-1014.720) [-1013.590] (-1017.004) -- 0:00:47
262500 -- [-1015.189] (-1016.608) (-1016.350) (-1013.842) * (-1017.025) [-1014.425] (-1016.640) (-1016.094) -- 0:00:47
263000 -- (-1015.082) (-1013.970) [-1013.708] (-1013.245) * [-1015.804] (-1015.519) (-1017.422) (-1017.900) -- 0:00:47
263500 -- (-1016.057) (-1016.877) (-1015.672) [-1013.770] * (-1015.198) [-1014.723] (-1016.695) (-1015.988) -- 0:00:47
264000 -- (-1015.180) [-1018.263] (-1014.467) (-1013.897) * (-1015.076) (-1018.164) [-1013.742] (-1013.844) -- 0:00:47
264500 -- [-1013.845] (-1015.532) (-1014.467) (-1013.878) * (-1015.851) (-1016.717) [-1013.605] (-1014.264) -- 0:00:47
265000 -- (-1016.113) [-1013.407] (-1014.091) (-1015.019) * [-1015.886] (-1024.266) (-1013.252) (-1014.098) -- 0:00:47
Average standard deviation of split frequencies: 0.016976
265500 -- (-1015.929) (-1014.843) [-1013.084] (-1013.670) * [-1016.035] (-1012.954) (-1016.086) (-1014.097) -- 0:00:47
266000 -- [-1016.463] (-1013.897) (-1014.173) (-1015.137) * (-1020.125) [-1016.884] (-1019.866) (-1013.526) -- 0:00:46
266500 -- (-1016.114) (-1015.032) [-1013.978] (-1016.198) * (-1014.018) [-1014.717] (-1016.131) (-1013.191) -- 0:00:46
267000 -- (-1015.204) [-1017.054] (-1014.109) (-1013.841) * (-1015.465) [-1015.724] (-1017.052) (-1015.338) -- 0:00:46
267500 -- (-1017.573) (-1014.930) [-1014.926] (-1015.487) * (-1017.286) (-1015.832) (-1019.595) [-1013.480] -- 0:00:46
268000 -- (-1018.665) [-1014.779] (-1017.970) (-1015.519) * (-1014.777) (-1016.152) [-1019.758] (-1019.538) -- 0:00:46
268500 -- (-1024.124) (-1015.077) [-1019.479] (-1016.317) * [-1014.413] (-1016.120) (-1016.922) (-1015.562) -- 0:00:46
269000 -- (-1018.841) (-1015.052) (-1014.337) [-1013.030] * (-1015.158) (-1014.235) (-1013.512) [-1017.452] -- 0:00:46
269500 -- (-1017.788) (-1015.821) [-1012.818] (-1013.060) * [-1015.217] (-1014.849) (-1016.406) (-1014.301) -- 0:00:46
270000 -- [-1014.808] (-1024.660) (-1017.580) (-1013.056) * (-1016.560) (-1016.104) [-1020.393] (-1014.042) -- 0:00:45
Average standard deviation of split frequencies: 0.018058
270500 -- (-1015.746) [-1014.042] (-1015.256) (-1013.083) * (-1014.154) [-1014.619] (-1018.673) (-1014.675) -- 0:00:45
271000 -- (-1016.101) [-1013.459] (-1014.346) (-1013.351) * (-1016.930) (-1014.009) (-1013.613) [-1014.555] -- 0:00:45
271500 -- (-1016.030) [-1013.948] (-1017.977) (-1013.219) * (-1016.146) (-1017.313) [-1013.390] (-1014.132) -- 0:00:45
272000 -- (-1016.092) (-1014.301) (-1013.846) [-1014.689] * (-1014.803) (-1022.251) [-1013.355] (-1015.317) -- 0:00:45
272500 -- (-1015.955) [-1012.897] (-1013.097) (-1014.112) * [-1016.085] (-1018.002) (-1014.871) (-1015.146) -- 0:00:45
273000 -- (-1015.740) [-1012.897] (-1014.164) (-1014.198) * [-1013.627] (-1013.878) (-1015.578) (-1014.017) -- 0:00:45
273500 -- (-1014.717) (-1015.897) (-1013.895) [-1013.404] * (-1012.878) [-1014.807] (-1013.101) (-1016.508) -- 0:00:45
274000 -- [-1014.286] (-1015.470) (-1013.119) (-1015.591) * (-1015.443) (-1016.316) (-1016.190) [-1013.517] -- 0:00:47
274500 -- (-1014.548) (-1014.088) (-1013.786) [-1015.960] * (-1020.733) (-1014.994) (-1017.816) [-1013.196] -- 0:00:47
275000 -- [-1014.367] (-1014.309) (-1015.597) (-1022.589) * (-1014.868) (-1012.775) [-1016.619] (-1013.917) -- 0:00:47
Average standard deviation of split frequencies: 0.017799
275500 -- (-1014.542) [-1014.440] (-1023.653) (-1017.883) * (-1014.350) (-1013.009) [-1013.122] (-1013.092) -- 0:00:47
276000 -- [-1016.381] (-1014.851) (-1017.404) (-1014.131) * (-1015.252) [-1012.816] (-1013.714) (-1014.039) -- 0:00:47
276500 -- (-1014.998) (-1014.442) (-1017.243) [-1016.522] * (-1017.095) (-1013.883) (-1019.053) [-1013.516] -- 0:00:47
277000 -- (-1015.169) [-1014.985] (-1014.727) (-1015.725) * [-1013.846] (-1015.691) (-1014.053) (-1014.287) -- 0:00:46
277500 -- (-1016.854) (-1015.504) (-1014.351) [-1014.215] * (-1014.506) [-1014.537] (-1016.045) (-1015.803) -- 0:00:46
278000 -- [-1016.311] (-1014.931) (-1015.243) (-1014.555) * (-1014.975) (-1015.646) [-1014.069] (-1014.001) -- 0:00:46
278500 -- [-1015.348] (-1015.376) (-1015.661) (-1013.754) * (-1014.030) (-1014.418) [-1015.913] (-1014.217) -- 0:00:46
279000 -- [-1014.551] (-1017.334) (-1017.050) (-1016.262) * [-1014.023] (-1017.147) (-1015.600) (-1015.625) -- 0:00:46
279500 -- (-1015.816) (-1017.145) [-1013.434] (-1019.237) * (-1013.906) (-1017.865) (-1012.859) [-1014.629] -- 0:00:46
280000 -- (-1022.706) (-1016.553) (-1013.562) [-1014.147] * (-1015.889) (-1015.877) (-1016.384) [-1014.360] -- 0:00:46
Average standard deviation of split frequencies: 0.017415
280500 -- [-1013.558] (-1018.256) (-1012.908) (-1013.604) * (-1015.097) [-1016.164] (-1019.853) (-1018.495) -- 0:00:46
281000 -- [-1015.230] (-1013.517) (-1018.812) (-1013.758) * (-1015.885) (-1017.181) [-1016.590] (-1013.444) -- 0:00:46
281500 -- (-1013.867) (-1013.999) [-1017.132] (-1015.534) * (-1014.906) (-1016.989) (-1014.660) [-1014.800] -- 0:00:45
282000 -- (-1016.872) [-1013.663] (-1015.555) (-1013.509) * (-1017.026) (-1015.387) (-1016.866) [-1014.887] -- 0:00:45
282500 -- (-1016.124) (-1014.077) (-1015.624) [-1013.569] * (-1016.974) (-1015.531) (-1016.752) [-1015.110] -- 0:00:45
283000 -- (-1014.434) (-1013.956) (-1015.285) [-1013.845] * (-1014.466) (-1013.525) (-1013.403) [-1013.231] -- 0:00:45
283500 -- [-1013.938] (-1014.355) (-1014.612) (-1015.034) * [-1015.912] (-1013.885) (-1015.030) (-1013.862) -- 0:00:45
284000 -- (-1014.591) [-1014.260] (-1015.932) (-1015.321) * [-1015.736] (-1013.740) (-1015.808) (-1014.015) -- 0:00:45
284500 -- (-1017.488) (-1014.370) [-1014.015] (-1014.951) * [-1015.800] (-1015.414) (-1014.960) (-1015.238) -- 0:00:45
285000 -- [-1013.188] (-1015.954) (-1014.633) (-1014.573) * (-1013.665) [-1015.981] (-1018.214) (-1015.574) -- 0:00:45
Average standard deviation of split frequencies: 0.016830
285500 -- (-1014.133) (-1013.380) (-1013.459) [-1013.526] * [-1013.909] (-1013.570) (-1014.093) (-1016.399) -- 0:00:45
286000 -- (-1013.611) (-1014.737) [-1013.430] (-1012.905) * (-1013.966) (-1016.784) [-1014.860] (-1014.760) -- 0:00:44
286500 -- (-1014.212) [-1014.773] (-1014.889) (-1013.622) * (-1015.821) (-1016.111) [-1017.298] (-1015.958) -- 0:00:44
287000 -- (-1013.997) [-1016.545] (-1014.205) (-1019.504) * (-1024.942) (-1015.127) [-1015.615] (-1015.797) -- 0:00:44
287500 -- (-1014.873) (-1020.398) (-1013.293) [-1019.506] * (-1015.566) (-1013.934) [-1017.154] (-1016.942) -- 0:00:44
288000 -- (-1013.944) [-1013.751] (-1016.241) (-1014.006) * (-1015.587) [-1014.441] (-1017.349) (-1016.313) -- 0:00:44
288500 -- [-1014.739] (-1014.878) (-1015.387) (-1014.610) * [-1014.868] (-1015.862) (-1014.107) (-1016.719) -- 0:00:44
289000 -- [-1016.754] (-1018.214) (-1015.714) (-1015.697) * (-1014.082) (-1016.595) [-1015.406] (-1019.831) -- 0:00:44
289500 -- [-1013.305] (-1014.023) (-1013.751) (-1014.860) * (-1015.283) [-1017.682] (-1013.859) (-1015.157) -- 0:00:44
290000 -- (-1013.993) (-1013.241) [-1013.478] (-1016.898) * (-1014.024) [-1014.452] (-1012.943) (-1017.982) -- 0:00:46
Average standard deviation of split frequencies: 0.017584
290500 -- (-1014.801) (-1014.268) [-1015.519] (-1019.279) * [-1014.405] (-1017.026) (-1015.417) (-1020.695) -- 0:00:46
291000 -- (-1016.463) [-1015.672] (-1014.550) (-1013.596) * (-1017.721) [-1016.628] (-1016.979) (-1014.534) -- 0:00:46
291500 -- (-1015.875) (-1013.389) [-1013.467] (-1014.149) * (-1016.076) [-1014.183] (-1017.569) (-1016.283) -- 0:00:46
292000 -- (-1022.322) (-1013.370) (-1013.075) [-1016.958] * (-1013.977) [-1015.182] (-1018.701) (-1014.171) -- 0:00:46
292500 -- [-1014.223] (-1015.235) (-1013.119) (-1015.360) * (-1013.873) (-1013.758) (-1016.117) [-1014.863] -- 0:00:45
293000 -- (-1015.423) (-1020.374) (-1015.020) [-1014.964] * [-1017.446] (-1015.566) (-1014.885) (-1014.083) -- 0:00:45
293500 -- (-1020.443) (-1014.295) (-1015.302) [-1015.811] * (-1016.936) (-1016.645) (-1016.101) [-1012.928] -- 0:00:45
294000 -- (-1017.906) (-1019.668) (-1017.432) [-1014.953] * [-1015.691] (-1016.298) (-1012.603) (-1014.236) -- 0:00:45
294500 -- [-1017.973] (-1016.083) (-1013.872) (-1013.894) * (-1012.927) [-1017.796] (-1013.874) (-1013.653) -- 0:00:45
295000 -- (-1017.998) (-1014.690) [-1015.432] (-1014.937) * (-1014.851) (-1019.099) (-1013.597) [-1014.241] -- 0:00:45
Average standard deviation of split frequencies: 0.017518
295500 -- (-1018.575) [-1014.184] (-1015.906) (-1013.785) * (-1014.772) (-1015.091) (-1015.657) [-1014.351] -- 0:00:45
296000 -- [-1015.641] (-1013.415) (-1013.529) (-1013.229) * (-1013.098) (-1013.674) [-1013.648] (-1017.612) -- 0:00:45
296500 -- (-1014.993) (-1015.885) [-1014.052] (-1015.944) * (-1015.358) (-1014.394) (-1014.512) [-1015.856] -- 0:00:45
297000 -- (-1014.393) (-1015.915) (-1015.066) [-1013.924] * (-1014.056) (-1017.512) [-1014.763] (-1016.327) -- 0:00:44
297500 -- (-1014.122) (-1014.728) (-1015.226) [-1016.087] * (-1014.046) (-1015.047) (-1016.826) [-1015.430] -- 0:00:44
298000 -- (-1014.835) (-1018.314) (-1021.205) [-1014.241] * (-1015.826) [-1015.235] (-1014.930) (-1013.786) -- 0:00:44
298500 -- [-1013.869] (-1014.467) (-1014.179) (-1014.893) * (-1014.145) (-1014.361) [-1017.328] (-1015.462) -- 0:00:44
299000 -- (-1016.643) [-1015.554] (-1017.392) (-1014.276) * (-1013.631) (-1016.507) (-1016.325) [-1015.365] -- 0:00:44
299500 -- (-1014.121) (-1014.317) (-1013.718) [-1013.705] * (-1013.706) [-1015.419] (-1014.466) (-1015.877) -- 0:00:44
300000 -- (-1014.159) (-1013.413) (-1013.870) [-1016.345] * (-1013.588) (-1015.184) (-1015.865) [-1014.375] -- 0:00:44
Average standard deviation of split frequencies: 0.017329
300500 -- (-1014.375) (-1014.011) [-1013.373] (-1015.427) * [-1014.012] (-1017.056) (-1017.872) (-1013.809) -- 0:00:44
301000 -- [-1014.015] (-1014.488) (-1013.437) (-1015.343) * (-1017.189) (-1013.361) [-1013.865] (-1017.276) -- 0:00:44
301500 -- (-1013.337) (-1013.356) (-1021.080) [-1015.575] * [-1016.511] (-1013.911) (-1016.206) (-1016.642) -- 0:00:44
302000 -- (-1013.443) [-1014.114] (-1016.355) (-1015.514) * (-1018.447) (-1015.625) (-1013.751) [-1015.123] -- 0:00:43
302500 -- (-1013.426) (-1017.017) [-1016.849] (-1016.921) * (-1015.603) [-1013.152] (-1017.531) (-1018.023) -- 0:00:43
303000 -- [-1017.387] (-1013.506) (-1017.365) (-1014.872) * (-1016.054) (-1015.997) [-1014.414] (-1016.090) -- 0:00:43
303500 -- [-1016.744] (-1017.175) (-1014.706) (-1013.943) * (-1012.950) (-1015.004) [-1014.459] (-1017.429) -- 0:00:43
304000 -- [-1015.007] (-1015.426) (-1013.437) (-1013.649) * (-1012.934) [-1019.213] (-1014.756) (-1013.751) -- 0:00:43
304500 -- [-1015.149] (-1013.667) (-1014.873) (-1014.779) * (-1013.709) (-1021.529) [-1014.910] (-1015.504) -- 0:00:43
305000 -- (-1016.397) (-1016.712) (-1015.916) [-1013.426] * (-1012.846) (-1020.773) [-1014.349] (-1014.738) -- 0:00:43
Average standard deviation of split frequencies: 0.018486
305500 -- (-1017.974) (-1013.880) [-1014.247] (-1021.828) * (-1014.832) (-1014.271) [-1013.115] (-1015.519) -- 0:00:43
306000 -- (-1014.861) [-1013.148] (-1013.999) (-1014.117) * (-1015.831) (-1018.047) (-1012.951) [-1015.266] -- 0:00:45
306500 -- (-1014.746) (-1016.598) (-1013.255) [-1020.756] * (-1016.105) (-1017.477) [-1012.949] (-1014.160) -- 0:00:45
307000 -- (-1013.641) (-1016.687) [-1014.292] (-1016.405) * (-1019.281) (-1015.674) [-1012.857] (-1014.552) -- 0:00:45
307500 -- [-1013.389] (-1017.456) (-1018.300) (-1015.271) * (-1016.407) (-1014.193) [-1012.857] (-1015.181) -- 0:00:45
308000 -- (-1014.399) [-1014.355] (-1015.324) (-1015.189) * [-1015.369] (-1014.680) (-1012.861) (-1015.603) -- 0:00:44
308500 -- (-1014.187) (-1013.985) (-1014.402) [-1014.584] * (-1019.148) (-1017.543) (-1012.994) [-1013.884] -- 0:00:44
309000 -- [-1013.270] (-1013.356) (-1016.720) (-1015.952) * (-1018.680) [-1014.277] (-1012.698) (-1013.968) -- 0:00:44
309500 -- (-1014.248) (-1014.950) [-1015.565] (-1019.041) * (-1018.178) [-1013.314] (-1014.836) (-1014.789) -- 0:00:44
310000 -- (-1017.120) [-1015.677] (-1016.856) (-1016.805) * (-1013.999) [-1015.714] (-1019.700) (-1013.073) -- 0:00:44
Average standard deviation of split frequencies: 0.018129
310500 -- (-1016.679) (-1014.921) [-1013.678] (-1014.019) * (-1014.485) [-1015.900] (-1013.488) (-1014.144) -- 0:00:44
311000 -- (-1015.542) [-1014.123] (-1013.253) (-1014.448) * (-1018.602) [-1015.695] (-1017.725) (-1015.487) -- 0:00:44
311500 -- [-1014.445] (-1015.108) (-1013.499) (-1014.138) * [-1015.776] (-1016.945) (-1013.232) (-1016.745) -- 0:00:44
312000 -- (-1014.529) (-1024.602) [-1013.798] (-1016.044) * (-1015.976) (-1016.939) (-1014.445) [-1017.821] -- 0:00:44
312500 -- [-1015.163] (-1016.601) (-1015.093) (-1025.307) * (-1019.809) [-1016.306] (-1014.313) (-1015.965) -- 0:00:44
313000 -- [-1018.063] (-1016.817) (-1014.103) (-1016.030) * (-1022.914) (-1016.728) [-1014.658] (-1014.662) -- 0:00:43
313500 -- (-1015.401) (-1022.604) [-1015.367] (-1015.205) * (-1018.030) (-1015.255) (-1015.285) [-1015.133] -- 0:00:43
314000 -- (-1013.370) (-1018.290) (-1016.093) [-1014.542] * (-1016.188) (-1015.140) (-1022.761) [-1015.336] -- 0:00:43
314500 -- (-1013.846) (-1013.868) [-1015.000] (-1014.542) * (-1015.429) (-1014.979) (-1014.217) [-1013.960] -- 0:00:43
315000 -- [-1018.251] (-1020.400) (-1015.643) (-1013.227) * (-1017.650) (-1013.235) (-1015.461) [-1012.997] -- 0:00:43
Average standard deviation of split frequencies: 0.017819
315500 -- (-1019.797) [-1013.449] (-1018.005) (-1013.233) * (-1019.015) (-1015.621) (-1015.614) [-1016.572] -- 0:00:43
316000 -- (-1015.842) (-1013.021) (-1017.607) [-1014.011] * [-1013.908] (-1015.639) (-1014.055) (-1014.636) -- 0:00:43
316500 -- (-1015.961) [-1015.126] (-1015.002) (-1018.056) * (-1013.869) (-1015.338) [-1013.128] (-1014.226) -- 0:00:43
317000 -- (-1018.989) (-1015.172) (-1015.349) [-1015.763] * (-1013.504) [-1013.113] (-1015.517) (-1015.386) -- 0:00:43
317500 -- (-1014.172) (-1013.744) (-1016.243) [-1015.104] * [-1015.759] (-1016.467) (-1015.314) (-1017.681) -- 0:00:42
318000 -- [-1016.459] (-1013.348) (-1015.149) (-1015.135) * (-1013.044) [-1015.182] (-1015.665) (-1016.762) -- 0:00:42
318500 -- (-1019.507) [-1014.990] (-1014.871) (-1014.577) * [-1018.115] (-1015.907) (-1018.619) (-1018.179) -- 0:00:42
319000 -- (-1017.682) [-1015.730] (-1013.817) (-1017.486) * (-1017.966) [-1014.536] (-1016.775) (-1018.119) -- 0:00:42
319500 -- (-1015.257) [-1014.166] (-1013.647) (-1014.168) * [-1016.030] (-1017.293) (-1018.740) (-1018.291) -- 0:00:42
320000 -- (-1015.046) (-1017.969) [-1013.911] (-1014.554) * (-1014.835) [-1014.342] (-1016.171) (-1019.523) -- 0:00:42
Average standard deviation of split frequencies: 0.016949
320500 -- [-1015.463] (-1016.184) (-1015.598) (-1013.920) * (-1016.110) [-1013.725] (-1014.682) (-1014.861) -- 0:00:42
321000 -- (-1015.624) (-1016.016) (-1015.343) [-1013.893] * (-1013.547) (-1013.685) (-1014.022) [-1015.074] -- 0:00:42
321500 -- [-1017.759] (-1017.507) (-1015.259) (-1016.876) * (-1015.334) (-1014.275) [-1016.759] (-1016.300) -- 0:00:42
322000 -- (-1016.320) [-1014.836] (-1013.601) (-1019.620) * [-1015.980] (-1014.245) (-1015.815) (-1014.049) -- 0:00:42
322500 -- (-1015.165) (-1016.393) (-1017.155) [-1016.066] * (-1015.634) [-1014.284] (-1015.638) (-1013.559) -- 0:00:44
323000 -- (-1017.212) [-1016.160] (-1018.716) (-1013.691) * (-1016.350) [-1014.573] (-1017.025) (-1015.696) -- 0:00:44
323500 -- (-1016.989) (-1013.403) (-1014.400) [-1014.395] * [-1014.592] (-1014.439) (-1016.783) (-1014.419) -- 0:00:43
324000 -- [-1013.879] (-1013.293) (-1014.319) (-1014.749) * (-1015.265) [-1015.413] (-1019.148) (-1014.761) -- 0:00:43
324500 -- [-1013.788] (-1012.846) (-1016.969) (-1016.144) * (-1014.799) (-1017.621) (-1014.688) [-1017.273] -- 0:00:43
325000 -- (-1013.254) [-1014.528] (-1019.974) (-1015.986) * (-1015.216) (-1016.828) (-1015.230) [-1014.386] -- 0:00:43
Average standard deviation of split frequencies: 0.015906
325500 -- (-1013.578) [-1015.032] (-1021.680) (-1016.340) * (-1017.045) (-1013.787) [-1016.362] (-1015.942) -- 0:00:43
326000 -- (-1014.545) [-1015.022] (-1014.090) (-1013.254) * (-1016.233) (-1017.252) [-1013.488] (-1017.965) -- 0:00:43
326500 -- (-1012.708) (-1015.295) [-1015.485] (-1013.715) * [-1014.529] (-1014.500) (-1013.013) (-1014.616) -- 0:00:43
327000 -- (-1014.022) [-1015.304] (-1019.484) (-1016.774) * (-1016.124) (-1016.292) (-1013.013) [-1014.842] -- 0:00:43
327500 -- [-1013.249] (-1013.060) (-1015.705) (-1016.850) * (-1016.880) (-1016.812) (-1013.192) [-1014.864] -- 0:00:43
328000 -- [-1014.922] (-1016.616) (-1015.735) (-1013.833) * (-1013.044) [-1014.333] (-1016.295) (-1016.124) -- 0:00:43
328500 -- (-1014.311) (-1013.354) (-1016.511) [-1012.900] * (-1014.312) (-1013.715) (-1015.460) [-1016.509] -- 0:00:42
329000 -- [-1015.891] (-1013.421) (-1015.592) (-1013.397) * (-1014.812) (-1012.955) (-1017.688) [-1015.695] -- 0:00:42
329500 -- (-1013.826) (-1017.335) (-1015.061) [-1014.516] * [-1015.940] (-1014.452) (-1017.367) (-1013.428) -- 0:00:42
330000 -- [-1014.235] (-1017.695) (-1016.386) (-1015.647) * (-1015.323) (-1015.003) [-1018.344] (-1017.646) -- 0:00:42
Average standard deviation of split frequencies: 0.016353
330500 -- (-1015.056) (-1014.927) (-1016.514) [-1016.138] * (-1016.363) (-1015.704) (-1014.489) [-1014.465] -- 0:00:42
331000 -- (-1013.663) (-1015.912) [-1016.004] (-1014.400) * (-1014.902) (-1013.667) (-1014.203) [-1012.898] -- 0:00:42
331500 -- (-1014.592) [-1016.102] (-1015.570) (-1014.326) * (-1014.712) (-1017.305) (-1014.326) [-1014.628] -- 0:00:42
332000 -- (-1017.434) (-1017.069) (-1016.474) [-1014.237] * (-1014.204) [-1014.419] (-1018.205) (-1013.810) -- 0:00:42
332500 -- (-1018.356) [-1017.327] (-1014.579) (-1013.527) * (-1015.896) (-1014.339) (-1015.045) [-1013.579] -- 0:00:42
333000 -- (-1016.270) (-1015.504) (-1014.372) [-1014.466] * (-1015.939) (-1014.207) [-1014.353] (-1013.189) -- 0:00:42
333500 -- (-1013.492) [-1015.862] (-1015.263) (-1014.524) * (-1014.631) (-1014.397) [-1015.972] (-1016.464) -- 0:00:41
334000 -- [-1013.528] (-1016.302) (-1016.738) (-1014.955) * (-1017.389) (-1013.095) [-1015.587] (-1015.102) -- 0:00:41
334500 -- (-1014.936) (-1016.371) [-1013.603] (-1017.790) * (-1014.100) [-1014.015] (-1017.016) (-1016.367) -- 0:00:41
335000 -- (-1015.693) (-1016.265) (-1015.695) [-1013.401] * (-1018.399) [-1013.480] (-1017.369) (-1016.230) -- 0:00:41
Average standard deviation of split frequencies: 0.017166
335500 -- (-1018.744) (-1015.375) [-1017.626] (-1015.090) * (-1016.183) [-1013.913] (-1015.404) (-1018.554) -- 0:00:41
336000 -- (-1017.070) (-1017.829) [-1015.249] (-1015.540) * (-1016.495) [-1013.944] (-1015.312) (-1015.364) -- 0:00:41
336500 -- (-1012.753) (-1015.845) (-1018.257) [-1016.228] * (-1015.452) (-1012.798) (-1016.195) [-1014.731] -- 0:00:41
337000 -- (-1015.754) (-1018.010) (-1016.777) [-1015.008] * (-1016.162) (-1013.350) [-1014.643] (-1015.336) -- 0:00:41
337500 -- [-1015.100] (-1016.599) (-1013.464) (-1017.029) * (-1014.063) [-1013.663] (-1013.023) (-1014.188) -- 0:00:41
338000 -- (-1015.214) [-1013.703] (-1014.731) (-1014.387) * (-1014.985) (-1014.339) (-1013.003) [-1013.024] -- 0:00:41
338500 -- (-1015.585) (-1015.568) [-1013.928] (-1013.838) * (-1013.966) [-1015.483] (-1013.249) (-1014.947) -- 0:00:41
339000 -- (-1014.057) (-1013.382) (-1014.432) [-1013.339] * (-1017.288) (-1015.483) [-1013.041] (-1013.950) -- 0:00:42
339500 -- (-1013.734) [-1015.559] (-1017.388) (-1016.865) * [-1016.343] (-1015.666) (-1013.221) (-1015.021) -- 0:00:42
340000 -- [-1013.164] (-1014.448) (-1014.571) (-1013.101) * [-1016.882] (-1015.610) (-1013.242) (-1016.179) -- 0:00:42
Average standard deviation of split frequencies: 0.016768
340500 -- (-1019.071) (-1016.899) [-1014.625] (-1014.136) * (-1016.632) (-1016.721) [-1014.587] (-1015.899) -- 0:00:42
341000 -- [-1014.510] (-1013.404) (-1014.027) (-1013.883) * (-1012.675) (-1017.230) (-1014.255) [-1013.978] -- 0:00:42
341500 -- (-1015.619) (-1013.787) (-1016.649) [-1015.712] * (-1017.030) [-1015.314] (-1013.328) (-1013.854) -- 0:00:42
342000 -- (-1017.405) (-1017.569) (-1015.680) [-1013.671] * [-1015.638] (-1017.511) (-1018.307) (-1016.270) -- 0:00:42
342500 -- [-1020.050] (-1016.686) (-1014.371) (-1016.077) * (-1015.343) [-1014.025] (-1015.175) (-1014.817) -- 0:00:42
343000 -- (-1015.287) [-1017.020] (-1014.150) (-1016.500) * (-1015.327) [-1014.908] (-1013.197) (-1013.713) -- 0:00:42
343500 -- (-1014.380) (-1015.680) (-1014.241) [-1013.452] * (-1013.646) (-1014.007) (-1014.520) [-1013.859] -- 0:00:42
344000 -- (-1015.722) (-1022.436) [-1014.166] (-1016.072) * (-1016.046) (-1013.133) (-1014.522) [-1014.414] -- 0:00:41
344500 -- (-1015.062) [-1015.017] (-1013.794) (-1014.429) * (-1019.933) [-1014.494] (-1014.277) (-1015.115) -- 0:00:41
345000 -- (-1016.978) (-1017.875) [-1015.740] (-1013.874) * [-1013.164] (-1015.144) (-1014.081) (-1019.838) -- 0:00:41
Average standard deviation of split frequencies: 0.017151
345500 -- (-1017.536) [-1016.152] (-1013.840) (-1013.614) * (-1015.351) [-1015.827] (-1015.565) (-1018.569) -- 0:00:41
346000 -- (-1014.909) (-1021.736) (-1013.971) [-1017.664] * (-1014.628) [-1014.953] (-1014.193) (-1013.918) -- 0:00:41
346500 -- (-1017.953) (-1015.765) [-1015.125] (-1014.382) * (-1013.616) (-1015.103) (-1014.655) [-1016.808] -- 0:00:41
347000 -- (-1014.825) (-1017.710) (-1015.112) [-1015.605] * (-1016.013) (-1018.338) (-1020.155) [-1014.443] -- 0:00:41
347500 -- (-1015.539) (-1018.668) [-1013.928] (-1015.467) * (-1013.790) [-1016.654] (-1019.454) (-1014.709) -- 0:00:41
348000 -- (-1015.881) (-1014.458) [-1014.115] (-1015.516) * (-1013.483) [-1015.301] (-1019.349) (-1015.030) -- 0:00:41
348500 -- (-1014.564) (-1019.977) (-1015.789) [-1015.081] * [-1018.051] (-1015.008) (-1016.569) (-1014.899) -- 0:00:41
349000 -- [-1016.037] (-1017.364) (-1016.513) (-1013.578) * [-1013.644] (-1016.193) (-1015.189) (-1016.424) -- 0:00:41
349500 -- (-1014.177) (-1015.621) [-1017.788] (-1015.531) * (-1014.285) (-1017.152) [-1015.902] (-1013.903) -- 0:00:40
350000 -- [-1013.241] (-1016.489) (-1015.442) (-1015.532) * (-1014.551) [-1018.049] (-1013.911) (-1015.642) -- 0:00:40
Average standard deviation of split frequencies: 0.017871
350500 -- [-1014.063] (-1013.889) (-1015.453) (-1016.456) * [-1015.499] (-1014.851) (-1018.042) (-1017.301) -- 0:00:40
351000 -- (-1015.550) [-1014.401] (-1016.100) (-1014.120) * (-1015.630) [-1014.474] (-1016.282) (-1013.690) -- 0:00:40
351500 -- (-1014.758) (-1016.773) [-1018.256] (-1016.501) * [-1013.952] (-1016.798) (-1016.820) (-1015.652) -- 0:00:40
352000 -- (-1015.178) (-1013.514) [-1017.511] (-1015.619) * (-1014.481) (-1016.741) [-1016.315] (-1015.356) -- 0:00:40
352500 -- (-1018.315) [-1014.017] (-1013.261) (-1014.207) * [-1014.621] (-1014.872) (-1013.374) (-1015.275) -- 0:00:40
353000 -- (-1017.074) (-1013.252) (-1013.687) [-1016.118] * (-1014.462) (-1016.472) [-1013.901] (-1017.697) -- 0:00:40
353500 -- (-1014.685) [-1014.802] (-1015.299) (-1018.083) * (-1015.571) [-1015.621] (-1015.577) (-1014.777) -- 0:00:40
354000 -- (-1017.052) (-1017.277) [-1013.051] (-1015.608) * (-1026.560) [-1017.747] (-1015.097) (-1015.001) -- 0:00:40
354500 -- (-1013.882) (-1014.151) (-1013.671) [-1016.902] * [-1015.344] (-1013.948) (-1013.878) (-1018.465) -- 0:00:40
355000 -- (-1014.210) (-1015.997) [-1013.057] (-1013.453) * (-1017.118) (-1013.660) (-1015.547) [-1016.663] -- 0:00:39
Average standard deviation of split frequencies: 0.017526
355500 -- (-1017.410) (-1017.261) [-1013.993] (-1013.484) * (-1014.827) (-1015.024) (-1014.415) [-1017.450] -- 0:00:41
356000 -- (-1014.209) (-1012.976) [-1013.325] (-1014.338) * [-1013.612] (-1015.705) (-1019.905) (-1015.248) -- 0:00:41
356500 -- (-1017.383) (-1013.159) (-1013.265) [-1014.562] * [-1013.757] (-1015.737) (-1014.527) (-1014.446) -- 0:00:41
357000 -- (-1015.116) [-1013.860] (-1015.452) (-1015.533) * (-1015.200) (-1017.759) [-1014.832] (-1014.031) -- 0:00:41
357500 -- (-1016.749) (-1013.265) [-1014.026] (-1013.188) * (-1014.327) [-1014.259] (-1018.288) (-1015.283) -- 0:00:41
358000 -- [-1017.204] (-1014.859) (-1013.954) (-1015.599) * [-1013.255] (-1014.202) (-1018.769) (-1014.258) -- 0:00:41
358500 -- [-1016.051] (-1014.698) (-1016.240) (-1016.782) * [-1012.837] (-1014.370) (-1013.790) (-1015.752) -- 0:00:41
359000 -- (-1014.012) (-1014.554) (-1013.434) [-1016.153] * (-1013.374) (-1015.173) [-1015.304] (-1013.991) -- 0:00:41
359500 -- [-1016.640] (-1014.718) (-1018.361) (-1014.545) * (-1014.157) [-1015.094] (-1014.100) (-1013.730) -- 0:00:40
360000 -- (-1013.268) [-1015.663] (-1014.028) (-1017.409) * (-1013.997) [-1013.365] (-1015.218) (-1013.883) -- 0:00:40
Average standard deviation of split frequencies: 0.018529
360500 -- (-1017.218) (-1014.013) [-1013.490] (-1016.527) * (-1015.202) (-1014.413) [-1015.213] (-1013.200) -- 0:00:40
361000 -- (-1016.254) (-1015.871) [-1013.680] (-1013.642) * [-1014.406] (-1016.456) (-1016.836) (-1013.185) -- 0:00:40
361500 -- (-1014.905) [-1019.033] (-1015.327) (-1015.012) * (-1016.181) (-1014.097) (-1015.869) [-1014.872] -- 0:00:40
362000 -- [-1013.930] (-1015.655) (-1014.980) (-1014.780) * (-1016.052) [-1013.692] (-1015.077) (-1013.627) -- 0:00:40
362500 -- [-1014.825] (-1014.519) (-1016.228) (-1014.927) * (-1019.029) [-1015.583] (-1014.921) (-1016.326) -- 0:00:40
363000 -- [-1015.439] (-1015.211) (-1014.453) (-1012.955) * [-1014.034] (-1015.751) (-1014.941) (-1019.380) -- 0:00:40
363500 -- [-1013.991] (-1014.578) (-1013.434) (-1014.112) * (-1014.539) (-1016.696) (-1013.586) [-1013.797] -- 0:00:40
364000 -- (-1015.836) (-1013.693) (-1015.070) [-1012.829] * (-1017.359) (-1019.296) (-1017.362) [-1014.244] -- 0:00:40
364500 -- (-1016.700) [-1014.855] (-1016.466) (-1013.501) * (-1013.916) [-1014.673] (-1017.301) (-1016.152) -- 0:00:40
365000 -- (-1013.167) (-1015.322) [-1015.545] (-1016.106) * (-1014.156) (-1016.909) (-1014.592) [-1013.440] -- 0:00:40
Average standard deviation of split frequencies: 0.018032
365500 -- (-1013.637) (-1014.546) [-1016.416] (-1015.636) * [-1014.398] (-1013.288) (-1013.562) (-1013.886) -- 0:00:39
366000 -- (-1014.309) [-1014.373] (-1014.585) (-1014.623) * (-1014.284) (-1019.339) (-1014.726) [-1015.264] -- 0:00:39
366500 -- (-1014.980) (-1017.290) [-1016.623] (-1013.868) * [-1014.220] (-1014.427) (-1016.002) (-1013.478) -- 0:00:39
367000 -- (-1015.390) [-1015.168] (-1015.166) (-1015.250) * (-1014.778) [-1015.295] (-1014.274) (-1013.082) -- 0:00:39
367500 -- [-1014.550] (-1013.655) (-1015.672) (-1016.237) * [-1015.618] (-1015.001) (-1013.692) (-1014.433) -- 0:00:39
368000 -- (-1015.213) (-1013.518) [-1015.034] (-1016.322) * (-1015.312) (-1013.655) [-1013.730] (-1012.748) -- 0:00:39
368500 -- (-1016.135) (-1018.017) (-1017.715) [-1015.657] * [-1013.598] (-1013.560) (-1015.905) (-1017.029) -- 0:00:39
369000 -- [-1014.151] (-1014.377) (-1015.976) (-1018.871) * (-1019.915) [-1018.444] (-1015.283) (-1017.168) -- 0:00:39
369500 -- (-1015.087) [-1015.825] (-1016.287) (-1017.424) * (-1014.717) [-1015.726] (-1016.604) (-1014.353) -- 0:00:39
370000 -- [-1017.180] (-1014.779) (-1016.028) (-1013.924) * (-1014.070) (-1015.346) [-1015.720] (-1016.544) -- 0:00:39
Average standard deviation of split frequencies: 0.017954
370500 -- [-1017.091] (-1016.452) (-1013.713) (-1014.605) * (-1013.447) (-1018.691) [-1014.116] (-1015.528) -- 0:00:39
371000 -- [-1013.810] (-1015.631) (-1018.226) (-1015.425) * [-1013.619] (-1016.412) (-1014.200) (-1017.278) -- 0:00:38
371500 -- (-1013.235) [-1013.963] (-1018.538) (-1014.919) * (-1013.056) (-1015.808) [-1014.505] (-1013.514) -- 0:00:40
372000 -- (-1016.593) [-1017.158] (-1016.104) (-1013.207) * (-1014.963) (-1016.189) (-1016.298) [-1013.582] -- 0:00:40
372500 -- (-1015.546) (-1015.111) [-1016.453] (-1022.577) * (-1019.082) (-1014.352) [-1015.345] (-1014.205) -- 0:00:40
373000 -- (-1014.123) [-1013.531] (-1016.456) (-1019.167) * (-1013.881) [-1013.910] (-1014.633) (-1016.398) -- 0:00:40
373500 -- (-1014.654) (-1015.620) [-1013.947] (-1020.085) * (-1013.520) (-1014.544) (-1013.706) [-1015.740] -- 0:00:40
374000 -- [-1013.195] (-1013.505) (-1018.047) (-1016.862) * (-1014.830) (-1015.389) [-1013.950] (-1015.050) -- 0:00:40
374500 -- (-1013.571) [-1013.506] (-1017.199) (-1017.239) * (-1014.857) (-1015.906) [-1018.813] (-1015.722) -- 0:00:40
375000 -- (-1013.469) (-1015.615) (-1017.429) [-1014.851] * (-1015.813) (-1015.840) [-1015.764] (-1016.459) -- 0:00:40
Average standard deviation of split frequencies: 0.018659
375500 -- (-1013.111) (-1017.014) (-1027.967) [-1014.747] * (-1015.082) (-1014.967) (-1016.462) [-1012.792] -- 0:00:39
376000 -- (-1014.174) (-1014.859) [-1015.251] (-1015.101) * (-1014.336) (-1015.677) [-1014.280] (-1013.460) -- 0:00:39
376500 -- (-1016.263) (-1013.701) [-1015.222] (-1017.571) * (-1013.689) [-1014.456] (-1015.710) (-1013.057) -- 0:00:39
377000 -- (-1016.810) [-1015.924] (-1014.302) (-1014.580) * (-1015.061) (-1014.768) [-1014.725] (-1013.603) -- 0:00:39
377500 -- (-1014.476) [-1013.814] (-1015.781) (-1015.164) * (-1015.994) [-1020.131] (-1020.105) (-1013.858) -- 0:00:39
378000 -- (-1013.101) (-1013.178) [-1013.604] (-1014.185) * (-1017.236) (-1023.211) (-1017.341) [-1014.657] -- 0:00:39
378500 -- (-1013.976) [-1016.235] (-1014.414) (-1016.687) * (-1014.347) (-1016.935) (-1013.103) [-1013.585] -- 0:00:39
379000 -- (-1013.004) [-1015.292] (-1014.416) (-1016.285) * (-1015.503) (-1017.875) [-1013.123] (-1013.985) -- 0:00:39
379500 -- (-1016.839) (-1015.562) (-1014.133) [-1015.613] * (-1016.575) (-1012.965) [-1014.772] (-1014.957) -- 0:00:39
380000 -- [-1014.706] (-1013.262) (-1016.012) (-1018.907) * [-1015.271] (-1015.567) (-1017.230) (-1014.499) -- 0:00:39
Average standard deviation of split frequencies: 0.017701
380500 -- (-1013.831) [-1013.783] (-1014.506) (-1017.171) * (-1015.330) [-1013.737] (-1015.890) (-1014.391) -- 0:00:39
381000 -- (-1014.911) [-1015.913] (-1013.767) (-1013.811) * (-1013.953) [-1013.252] (-1016.929) (-1015.445) -- 0:00:38
381500 -- (-1014.835) [-1015.495] (-1013.815) (-1014.671) * (-1014.126) (-1020.147) [-1015.618] (-1014.924) -- 0:00:38
382000 -- (-1016.439) (-1014.920) (-1013.152) [-1014.321] * (-1014.451) (-1017.408) (-1014.925) [-1015.249] -- 0:00:38
382500 -- (-1016.053) (-1016.407) [-1017.569] (-1013.094) * (-1015.246) [-1015.254] (-1015.837) (-1016.043) -- 0:00:38
383000 -- (-1014.665) [-1018.258] (-1019.543) (-1013.769) * [-1014.284] (-1018.396) (-1016.778) (-1020.987) -- 0:00:38
383500 -- (-1014.086) (-1014.292) [-1015.295] (-1015.092) * (-1014.773) [-1014.347] (-1016.087) (-1015.588) -- 0:00:38
384000 -- (-1014.433) [-1014.101] (-1014.677) (-1015.040) * (-1015.454) (-1014.260) [-1015.468] (-1016.456) -- 0:00:38
384500 -- (-1015.283) [-1014.272] (-1016.015) (-1013.267) * [-1014.009] (-1015.819) (-1013.306) (-1016.631) -- 0:00:38
385000 -- [-1016.207] (-1014.686) (-1016.443) (-1013.201) * (-1013.803) (-1015.438) [-1014.308] (-1017.196) -- 0:00:38
Average standard deviation of split frequencies: 0.016810
385500 -- [-1014.556] (-1014.809) (-1014.192) (-1014.174) * (-1014.563) (-1015.289) [-1014.420] (-1013.785) -- 0:00:38
386000 -- (-1013.015) (-1016.075) (-1014.044) [-1014.119] * (-1014.506) (-1018.064) [-1015.756] (-1015.989) -- 0:00:38
386500 -- [-1013.480] (-1013.192) (-1017.688) (-1015.014) * (-1013.403) (-1020.946) (-1015.366) [-1014.647] -- 0:00:38
387000 -- (-1021.455) (-1013.068) [-1017.471] (-1013.420) * (-1012.844) [-1015.680] (-1015.555) (-1015.275) -- 0:00:38
387500 -- (-1016.048) (-1014.225) (-1015.624) [-1015.694] * [-1013.765] (-1021.275) (-1016.595) (-1015.259) -- 0:00:39
388000 -- [-1013.570] (-1013.430) (-1017.585) (-1016.114) * [-1015.089] (-1017.987) (-1018.354) (-1014.170) -- 0:00:39
388500 -- (-1017.000) (-1013.121) (-1016.517) [-1013.781] * (-1014.092) (-1014.238) (-1014.272) [-1014.538] -- 0:00:39
389000 -- (-1014.665) (-1014.224) [-1013.148] (-1015.995) * (-1015.795) (-1019.026) (-1013.745) [-1017.746] -- 0:00:39
389500 -- (-1014.664) (-1016.212) [-1015.750] (-1017.228) * [-1016.270] (-1017.542) (-1017.468) (-1016.222) -- 0:00:39
390000 -- (-1015.375) (-1016.034) (-1015.191) [-1014.074] * (-1014.411) (-1017.076) (-1015.140) [-1013.041] -- 0:00:39
Average standard deviation of split frequencies: 0.017106
390500 -- (-1014.901) (-1017.180) (-1014.335) [-1014.655] * [-1015.220] (-1017.697) (-1016.259) (-1014.762) -- 0:00:39
391000 -- [-1014.351] (-1014.501) (-1015.652) (-1021.931) * (-1013.719) [-1015.118] (-1014.951) (-1014.727) -- 0:00:38
391500 -- (-1015.017) (-1013.716) (-1016.040) [-1017.060] * [-1013.146] (-1016.823) (-1017.651) (-1015.884) -- 0:00:38
392000 -- (-1014.010) [-1014.061] (-1018.427) (-1013.753) * (-1020.306) [-1014.801] (-1015.246) (-1014.653) -- 0:00:38
392500 -- (-1015.873) (-1015.749) [-1014.782] (-1016.253) * (-1021.706) [-1016.670] (-1012.811) (-1015.962) -- 0:00:38
393000 -- (-1016.758) (-1015.741) (-1016.323) [-1013.724] * (-1017.669) (-1016.301) (-1013.072) [-1015.373] -- 0:00:38
393500 -- (-1017.880) (-1014.789) (-1016.817) [-1013.092] * [-1015.173] (-1016.314) (-1016.291) (-1016.500) -- 0:00:38
394000 -- (-1016.543) (-1014.080) (-1015.493) [-1013.635] * (-1013.137) (-1016.929) (-1013.196) [-1013.079] -- 0:00:38
394500 -- (-1017.081) [-1013.432] (-1015.156) (-1013.301) * (-1012.864) (-1014.496) [-1014.142] (-1015.671) -- 0:00:38
395000 -- (-1017.407) (-1014.966) (-1019.978) [-1013.446] * [-1013.410] (-1017.066) (-1013.548) (-1018.439) -- 0:00:38
Average standard deviation of split frequencies: 0.016815
395500 -- (-1015.895) (-1013.433) [-1013.596] (-1013.298) * (-1012.839) (-1022.029) [-1016.503] (-1018.414) -- 0:00:38
396000 -- (-1014.409) (-1017.161) [-1013.185] (-1014.483) * (-1013.691) [-1017.755] (-1014.025) (-1015.733) -- 0:00:38
396500 -- [-1014.214] (-1014.484) (-1014.761) (-1013.736) * [-1013.123] (-1014.606) (-1016.232) (-1015.714) -- 0:00:38
397000 -- (-1014.297) (-1015.040) (-1016.999) [-1016.904] * (-1014.373) [-1015.085] (-1015.369) (-1015.990) -- 0:00:37
397500 -- (-1014.663) (-1014.139) [-1013.325] (-1019.450) * [-1014.088] (-1015.227) (-1016.011) (-1019.263) -- 0:00:37
398000 -- [-1014.244] (-1015.967) (-1015.000) (-1015.579) * (-1016.109) (-1014.927) (-1014.134) [-1016.870] -- 0:00:37
398500 -- (-1014.332) (-1014.712) [-1013.507] (-1015.637) * [-1013.358] (-1016.377) (-1017.723) (-1014.252) -- 0:00:37
399000 -- [-1013.626] (-1015.926) (-1013.769) (-1016.565) * (-1014.518) (-1016.544) [-1013.392] (-1014.596) -- 0:00:37
399500 -- [-1017.124] (-1014.383) (-1014.268) (-1014.054) * (-1014.935) [-1013.738] (-1014.197) (-1014.677) -- 0:00:37
400000 -- (-1013.389) (-1015.497) [-1014.914] (-1019.711) * [-1015.115] (-1015.953) (-1016.132) (-1013.798) -- 0:00:37
Average standard deviation of split frequencies: 0.015641
400500 -- (-1015.798) (-1014.019) [-1017.585] (-1016.160) * (-1017.448) [-1015.079] (-1016.956) (-1013.491) -- 0:00:37
401000 -- (-1012.975) (-1014.363) [-1015.364] (-1012.980) * (-1014.396) [-1014.682] (-1013.315) (-1013.876) -- 0:00:37
401500 -- (-1018.752) (-1015.516) (-1013.717) [-1015.320] * [-1014.665] (-1016.281) (-1014.085) (-1014.236) -- 0:00:37
402000 -- (-1015.461) [-1015.262] (-1013.798) (-1018.882) * (-1013.956) (-1014.419) (-1015.811) [-1019.466] -- 0:00:37
402500 -- [-1021.398] (-1017.768) (-1014.715) (-1014.670) * (-1013.741) (-1015.699) [-1014.899] (-1015.317) -- 0:00:37
403000 -- (-1013.623) (-1020.953) (-1015.116) [-1013.798] * [-1014.081] (-1016.164) (-1018.499) (-1013.585) -- 0:00:37
403500 -- (-1018.002) (-1013.789) (-1014.152) [-1013.448] * (-1015.482) (-1015.325) (-1015.048) [-1014.037] -- 0:00:36
404000 -- (-1013.901) [-1014.366] (-1017.729) (-1016.296) * (-1013.839) (-1017.081) [-1014.464] (-1015.417) -- 0:00:38
404500 -- (-1014.443) [-1017.137] (-1013.501) (-1016.760) * [-1014.040] (-1016.676) (-1015.114) (-1015.316) -- 0:00:38
405000 -- (-1015.063) (-1013.639) (-1014.050) [-1014.223] * (-1014.006) [-1016.292] (-1013.821) (-1013.079) -- 0:00:38
Average standard deviation of split frequencies: 0.015546
405500 -- (-1014.422) (-1015.713) [-1012.947] (-1017.198) * (-1020.727) (-1013.364) (-1014.188) [-1014.683] -- 0:00:38
406000 -- (-1013.643) [-1013.885] (-1013.163) (-1013.970) * (-1024.522) [-1013.194] (-1014.596) (-1013.559) -- 0:00:38
406500 -- (-1013.550) (-1018.525) (-1015.674) [-1014.308] * [-1014.753] (-1013.780) (-1015.862) (-1013.492) -- 0:00:37
407000 -- [-1013.372] (-1013.370) (-1022.111) (-1017.393) * [-1013.677] (-1014.359) (-1015.517) (-1015.499) -- 0:00:37
407500 -- (-1015.989) (-1012.892) [-1013.061] (-1017.234) * (-1015.156) (-1018.311) (-1014.467) [-1015.946] -- 0:00:37
408000 -- [-1015.120] (-1015.263) (-1014.905) (-1014.471) * (-1015.706) (-1014.406) [-1013.399] (-1014.838) -- 0:00:37
408500 -- [-1014.582] (-1024.884) (-1013.485) (-1016.881) * (-1015.823) (-1014.055) (-1014.967) [-1016.020] -- 0:00:37
409000 -- (-1016.132) [-1016.660] (-1013.131) (-1015.208) * (-1015.842) (-1015.586) [-1013.921] (-1013.503) -- 0:00:37
409500 -- (-1019.676) (-1018.002) (-1013.251) [-1016.247] * [-1014.619] (-1016.025) (-1014.069) (-1015.983) -- 0:00:37
410000 -- (-1014.598) [-1014.702] (-1013.692) (-1016.539) * [-1015.173] (-1014.456) (-1016.315) (-1013.992) -- 0:00:37
Average standard deviation of split frequencies: 0.015665
410500 -- (-1014.334) [-1013.984] (-1016.589) (-1014.591) * (-1014.299) (-1014.545) [-1016.180] (-1016.570) -- 0:00:37
411000 -- (-1019.270) (-1016.267) [-1015.111] (-1017.176) * (-1016.372) [-1015.348] (-1017.942) (-1013.792) -- 0:00:37
411500 -- (-1021.917) [-1014.700] (-1017.833) (-1014.808) * [-1013.359] (-1018.563) (-1014.788) (-1013.514) -- 0:00:37
412000 -- (-1018.404) [-1015.381] (-1015.918) (-1015.566) * [-1012.855] (-1021.395) (-1014.201) (-1014.141) -- 0:00:37
412500 -- [-1015.243] (-1014.283) (-1017.218) (-1020.946) * (-1013.269) (-1018.624) [-1014.065] (-1013.280) -- 0:00:37
413000 -- (-1015.118) (-1016.324) (-1015.487) [-1013.306] * (-1015.010) (-1019.001) [-1013.977] (-1016.385) -- 0:00:36
413500 -- (-1016.226) [-1017.741] (-1015.102) (-1012.951) * (-1016.488) [-1015.949] (-1015.162) (-1019.397) -- 0:00:36
414000 -- (-1014.983) (-1013.563) (-1013.544) [-1013.493] * [-1015.830] (-1014.111) (-1016.098) (-1013.355) -- 0:00:36
414500 -- (-1014.455) [-1014.706] (-1013.620) (-1014.083) * (-1014.420) [-1013.994] (-1014.484) (-1013.461) -- 0:00:36
415000 -- (-1015.454) (-1018.117) [-1014.932] (-1013.520) * (-1015.327) (-1014.993) (-1014.464) [-1017.083] -- 0:00:36
Average standard deviation of split frequencies: 0.016131
415500 -- (-1014.250) (-1013.308) (-1013.891) [-1013.362] * (-1015.599) (-1016.022) (-1015.524) [-1020.440] -- 0:00:36
416000 -- (-1014.939) [-1015.027] (-1016.892) (-1015.790) * (-1015.274) (-1015.278) (-1013.633) [-1017.803] -- 0:00:36
416500 -- (-1019.451) [-1012.752] (-1018.060) (-1017.884) * (-1013.354) [-1014.407] (-1015.869) (-1012.829) -- 0:00:36
417000 -- (-1013.401) [-1013.765] (-1016.587) (-1014.930) * (-1013.130) [-1015.482] (-1015.165) (-1013.731) -- 0:00:36
417500 -- (-1014.057) [-1013.523] (-1014.582) (-1014.171) * [-1017.293] (-1014.012) (-1020.826) (-1016.031) -- 0:00:36
418000 -- (-1013.249) (-1017.318) [-1012.935] (-1013.784) * [-1016.933] (-1014.243) (-1013.391) (-1013.692) -- 0:00:36
418500 -- [-1012.750] (-1019.880) (-1015.094) (-1012.837) * (-1019.418) (-1013.999) (-1014.890) [-1013.692] -- 0:00:36
419000 -- (-1013.924) (-1014.498) [-1016.707] (-1014.050) * (-1016.180) [-1014.491] (-1016.568) (-1014.406) -- 0:00:36
419500 -- (-1013.326) (-1013.913) [-1012.791] (-1014.160) * (-1016.143) (-1016.914) (-1012.655) [-1013.397] -- 0:00:35
420000 -- [-1014.845] (-1015.304) (-1013.934) (-1014.036) * [-1014.320] (-1017.574) (-1019.058) (-1013.818) -- 0:00:35
Average standard deviation of split frequencies: 0.015820
420500 -- (-1015.018) (-1015.375) (-1014.912) [-1015.988] * (-1015.279) (-1013.528) [-1015.336] (-1013.747) -- 0:00:37
421000 -- [-1014.025] (-1016.301) (-1015.184) (-1018.827) * (-1015.409) (-1013.861) [-1014.798] (-1016.729) -- 0:00:37
421500 -- (-1015.278) [-1017.790] (-1016.119) (-1016.629) * (-1015.086) (-1015.313) (-1018.077) [-1014.040] -- 0:00:37
422000 -- [-1014.673] (-1013.744) (-1015.412) (-1017.392) * [-1015.884] (-1014.710) (-1015.294) (-1015.972) -- 0:00:36
422500 -- [-1017.216] (-1013.774) (-1015.349) (-1018.516) * (-1017.064) [-1015.214] (-1018.226) (-1014.431) -- 0:00:36
423000 -- (-1017.713) (-1013.557) [-1015.694] (-1018.000) * (-1015.491) (-1015.538) [-1013.765] (-1013.694) -- 0:00:36
423500 -- (-1015.051) [-1016.480] (-1013.876) (-1014.955) * (-1016.433) [-1015.567] (-1016.329) (-1014.691) -- 0:00:36
424000 -- [-1014.355] (-1014.637) (-1014.099) (-1016.534) * (-1016.727) (-1016.214) (-1016.451) [-1013.347] -- 0:00:36
424500 -- (-1014.231) (-1016.389) (-1016.906) [-1015.108] * (-1016.552) (-1016.490) (-1014.954) [-1013.449] -- 0:00:36
425000 -- [-1016.632] (-1015.061) (-1016.862) (-1014.297) * (-1019.744) (-1014.683) (-1015.991) [-1016.640] -- 0:00:36
Average standard deviation of split frequencies: 0.016013
425500 -- (-1019.719) (-1016.554) (-1014.835) [-1013.836] * (-1016.375) [-1013.908] (-1015.631) (-1017.898) -- 0:00:36
426000 -- (-1014.347) (-1014.364) (-1014.040) [-1016.677] * (-1021.155) (-1015.443) (-1022.156) [-1015.547] -- 0:00:36
426500 -- [-1014.326] (-1015.588) (-1017.875) (-1015.005) * (-1025.191) [-1014.126] (-1015.315) (-1015.122) -- 0:00:36
427000 -- [-1014.291] (-1014.622) (-1013.572) (-1018.458) * (-1016.229) [-1013.436] (-1015.008) (-1014.921) -- 0:00:36
427500 -- (-1016.584) (-1017.454) [-1017.179] (-1015.552) * (-1017.445) (-1016.414) [-1013.770] (-1015.872) -- 0:00:36
428000 -- (-1013.915) (-1015.218) (-1014.822) [-1013.590] * (-1016.299) (-1014.168) [-1015.009] (-1014.699) -- 0:00:36
428500 -- (-1013.427) (-1016.746) [-1014.814] (-1013.960) * (-1015.627) (-1014.392) (-1013.982) [-1014.456] -- 0:00:36
429000 -- [-1013.909] (-1019.346) (-1014.952) (-1016.018) * (-1016.316) (-1018.332) [-1012.990] (-1014.788) -- 0:00:35
429500 -- (-1014.483) [-1014.412] (-1019.870) (-1014.549) * (-1014.951) [-1016.405] (-1014.688) (-1020.031) -- 0:00:35
430000 -- (-1016.085) [-1015.028] (-1021.075) (-1018.621) * (-1015.588) [-1015.320] (-1016.502) (-1016.399) -- 0:00:35
Average standard deviation of split frequencies: 0.015904
430500 -- (-1013.693) (-1014.037) [-1016.674] (-1017.027) * (-1018.395) [-1015.428] (-1013.829) (-1019.509) -- 0:00:35
431000 -- (-1013.940) [-1014.465] (-1014.849) (-1017.315) * (-1014.793) [-1015.146] (-1012.808) (-1013.785) -- 0:00:35
431500 -- [-1012.977] (-1017.186) (-1017.772) (-1017.051) * (-1012.897) (-1018.903) [-1014.949] (-1013.333) -- 0:00:35
432000 -- (-1015.713) (-1015.915) (-1017.237) [-1014.981] * (-1015.225) (-1018.145) (-1017.392) [-1013.345] -- 0:00:35
432500 -- (-1021.114) [-1016.597] (-1013.967) (-1013.091) * (-1015.308) (-1022.857) (-1013.482) [-1013.396] -- 0:00:35
433000 -- (-1020.980) (-1015.213) [-1012.905] (-1016.438) * (-1018.181) (-1020.311) [-1014.829] (-1016.097) -- 0:00:35
433500 -- (-1020.887) (-1013.419) [-1013.418] (-1014.302) * (-1013.774) (-1018.821) [-1016.182] (-1017.022) -- 0:00:35
434000 -- (-1013.436) (-1013.563) [-1014.828] (-1014.008) * (-1021.081) (-1015.679) (-1017.059) [-1017.274] -- 0:00:35
434500 -- [-1015.856] (-1014.234) (-1017.768) (-1015.962) * [-1019.358] (-1015.287) (-1013.705) (-1023.304) -- 0:00:35
435000 -- [-1015.641] (-1012.865) (-1018.133) (-1014.977) * (-1016.357) (-1017.930) (-1015.045) [-1015.099] -- 0:00:35
Average standard deviation of split frequencies: 0.016663
435500 -- (-1019.141) (-1014.268) (-1013.372) [-1013.940] * (-1016.370) [-1016.973] (-1018.901) (-1013.900) -- 0:00:34
436000 -- (-1013.467) (-1014.472) [-1014.299] (-1014.863) * (-1015.704) [-1017.607] (-1019.200) (-1017.468) -- 0:00:34
436500 -- (-1017.658) (-1015.717) [-1015.597] (-1014.904) * (-1015.362) (-1014.101) [-1014.059] (-1016.173) -- 0:00:36
437000 -- [-1016.127] (-1015.466) (-1015.475) (-1015.411) * (-1017.261) (-1016.964) (-1015.680) [-1013.497] -- 0:00:36
437500 -- (-1019.972) (-1013.430) [-1014.695] (-1015.194) * (-1019.802) (-1017.790) (-1014.263) [-1013.498] -- 0:00:36
438000 -- (-1019.151) (-1015.364) [-1013.852] (-1014.843) * [-1017.461] (-1013.559) (-1017.618) (-1017.685) -- 0:00:35
438500 -- [-1016.542] (-1015.673) (-1017.061) (-1015.571) * (-1016.876) [-1015.036] (-1015.010) (-1015.526) -- 0:00:35
439000 -- (-1013.884) [-1014.851] (-1014.134) (-1017.671) * (-1014.405) [-1014.545] (-1015.570) (-1014.241) -- 0:00:35
439500 -- (-1015.015) [-1013.378] (-1016.661) (-1015.697) * [-1014.444] (-1017.424) (-1015.873) (-1016.047) -- 0:00:35
440000 -- [-1014.107] (-1017.288) (-1016.832) (-1014.846) * (-1015.956) (-1014.937) (-1015.432) [-1014.306] -- 0:00:35
Average standard deviation of split frequencies: 0.017494
440500 -- (-1013.831) (-1013.078) [-1013.591] (-1013.757) * (-1014.434) (-1014.708) (-1017.057) [-1014.080] -- 0:00:35
441000 -- (-1014.571) (-1017.440) (-1013.167) [-1017.472] * (-1014.264) (-1016.104) (-1015.628) [-1014.172] -- 0:00:35
441500 -- (-1014.222) [-1016.536] (-1015.840) (-1015.448) * (-1013.564) (-1013.571) [-1019.860] (-1016.463) -- 0:00:35
442000 -- (-1014.445) (-1014.489) [-1014.996] (-1017.503) * (-1015.078) (-1020.692) [-1013.669] (-1014.457) -- 0:00:35
442500 -- (-1014.086) (-1015.840) (-1022.162) [-1016.826] * [-1016.569] (-1022.455) (-1014.641) (-1015.528) -- 0:00:35
443000 -- (-1014.620) [-1013.959] (-1017.230) (-1013.766) * (-1015.174) (-1022.119) (-1017.306) [-1017.234] -- 0:00:35
443500 -- (-1013.761) (-1015.372) (-1018.257) [-1014.559] * [-1013.564] (-1017.263) (-1017.468) (-1015.214) -- 0:00:35
444000 -- [-1013.588] (-1013.751) (-1017.357) (-1013.534) * (-1013.363) [-1015.385] (-1014.426) (-1013.718) -- 0:00:35
444500 -- (-1013.648) (-1015.472) (-1019.647) [-1012.904] * [-1016.985] (-1015.467) (-1016.256) (-1015.655) -- 0:00:34
445000 -- [-1013.393] (-1020.524) (-1018.050) (-1014.069) * (-1015.312) [-1014.074] (-1015.859) (-1016.360) -- 0:00:34
Average standard deviation of split frequencies: 0.017098
445500 -- (-1014.454) [-1014.725] (-1018.101) (-1013.717) * [-1013.266] (-1014.064) (-1015.940) (-1017.019) -- 0:00:34
446000 -- [-1016.217] (-1017.107) (-1014.356) (-1014.346) * (-1013.981) (-1015.687) (-1017.797) [-1020.224] -- 0:00:34
446500 -- (-1013.515) [-1014.295] (-1015.021) (-1015.299) * (-1016.450) (-1015.572) [-1015.917] (-1015.518) -- 0:00:34
447000 -- [-1014.478] (-1013.671) (-1016.456) (-1015.870) * (-1015.608) (-1018.154) [-1017.382] (-1016.791) -- 0:00:34
447500 -- (-1014.117) (-1013.660) [-1014.858] (-1015.541) * (-1015.748) [-1014.034] (-1015.688) (-1016.808) -- 0:00:34
448000 -- (-1015.809) [-1013.457] (-1015.699) (-1017.920) * (-1014.637) [-1015.058] (-1017.361) (-1013.768) -- 0:00:34
448500 -- [-1013.754] (-1019.524) (-1016.535) (-1015.309) * [-1014.412] (-1017.000) (-1015.751) (-1013.906) -- 0:00:34
449000 -- [-1014.596] (-1014.760) (-1013.877) (-1013.538) * (-1013.029) [-1016.787] (-1014.511) (-1015.526) -- 0:00:34
449500 -- (-1014.660) [-1015.389] (-1014.891) (-1014.723) * (-1013.154) (-1014.358) (-1014.552) [-1014.507] -- 0:00:34
450000 -- [-1017.830] (-1016.518) (-1015.729) (-1019.469) * (-1013.461) (-1016.148) [-1014.378] (-1016.578) -- 0:00:34
Average standard deviation of split frequencies: 0.016344
450500 -- [-1015.290] (-1016.632) (-1016.819) (-1026.161) * (-1014.771) [-1014.509] (-1017.063) (-1016.821) -- 0:00:34
451000 -- (-1013.791) (-1014.081) [-1019.325] (-1014.756) * (-1013.979) (-1013.185) (-1014.957) [-1015.708] -- 0:00:34
451500 -- [-1014.212] (-1015.819) (-1016.145) (-1014.127) * (-1016.355) [-1018.359] (-1013.120) (-1014.482) -- 0:00:34
452000 -- (-1016.277) (-1014.872) (-1016.188) [-1015.232] * (-1015.750) [-1016.773] (-1015.784) (-1013.901) -- 0:00:33
452500 -- (-1017.133) (-1015.019) [-1015.953] (-1015.328) * (-1015.246) (-1015.811) [-1018.228] (-1014.012) -- 0:00:33
453000 -- (-1022.080) (-1014.647) (-1015.829) [-1019.741] * (-1016.163) (-1015.632) (-1017.009) [-1013.925] -- 0:00:35
453500 -- (-1016.034) (-1013.603) (-1015.619) [-1020.663] * [-1013.617] (-1015.051) (-1016.093) (-1013.900) -- 0:00:34
454000 -- (-1014.321) [-1014.864] (-1016.733) (-1016.696) * (-1015.581) (-1014.218) [-1017.076] (-1016.433) -- 0:00:34
454500 -- [-1014.404] (-1017.169) (-1015.996) (-1019.347) * (-1016.023) (-1016.089) (-1020.879) [-1016.090] -- 0:00:34
455000 -- (-1015.145) (-1015.465) (-1017.450) [-1013.094] * [-1015.571] (-1015.410) (-1021.717) (-1016.398) -- 0:00:34
Average standard deviation of split frequencies: 0.016347
455500 -- (-1014.827) (-1014.265) (-1016.433) [-1014.833] * (-1015.170) [-1015.176] (-1016.389) (-1018.679) -- 0:00:34
456000 -- (-1016.241) (-1015.983) [-1013.998] (-1017.121) * (-1015.438) (-1013.727) [-1015.401] (-1019.170) -- 0:00:34
456500 -- [-1014.581] (-1014.793) (-1012.696) (-1015.823) * (-1016.948) [-1015.149] (-1016.202) (-1015.808) -- 0:00:34
457000 -- (-1013.512) (-1019.126) (-1013.496) [-1015.935] * (-1016.336) [-1014.807] (-1020.199) (-1015.473) -- 0:00:34
457500 -- [-1014.402] (-1014.067) (-1013.778) (-1016.859) * (-1017.228) (-1015.032) [-1015.519] (-1014.312) -- 0:00:34
458000 -- [-1014.377] (-1013.935) (-1013.987) (-1013.937) * (-1017.145) [-1012.986] (-1014.799) (-1013.389) -- 0:00:34
458500 -- [-1014.448] (-1017.894) (-1014.111) (-1014.683) * (-1017.828) [-1012.958] (-1016.274) (-1015.502) -- 0:00:34
459000 -- [-1014.060] (-1013.103) (-1013.541) (-1014.644) * (-1013.063) (-1014.118) [-1016.255] (-1014.057) -- 0:00:34
459500 -- (-1015.620) [-1014.257] (-1017.041) (-1016.721) * (-1016.871) (-1015.656) [-1015.257] (-1013.070) -- 0:00:34
460000 -- [-1017.571] (-1014.425) (-1014.225) (-1019.771) * (-1015.271) (-1013.221) [-1014.065] (-1013.431) -- 0:00:34
Average standard deviation of split frequencies: 0.016012
460500 -- (-1014.514) (-1016.130) [-1014.288] (-1014.943) * (-1016.292) (-1013.132) (-1013.712) [-1017.228] -- 0:00:33
461000 -- (-1015.624) [-1016.725] (-1014.817) (-1013.917) * [-1015.638] (-1015.657) (-1014.880) (-1014.315) -- 0:00:33
461500 -- (-1015.084) (-1015.838) (-1016.787) [-1013.538] * (-1014.342) (-1014.589) (-1013.516) [-1013.647] -- 0:00:33
462000 -- [-1017.341] (-1014.716) (-1015.170) (-1014.386) * (-1013.004) [-1014.209] (-1018.462) (-1013.904) -- 0:00:33
462500 -- [-1015.191] (-1015.837) (-1017.480) (-1014.461) * (-1013.134) [-1014.516] (-1017.156) (-1017.547) -- 0:00:33
463000 -- [-1014.224] (-1013.504) (-1015.104) (-1017.701) * (-1016.449) [-1017.154] (-1014.668) (-1016.952) -- 0:00:33
463500 -- [-1013.274] (-1015.318) (-1013.771) (-1017.591) * (-1020.340) [-1015.480] (-1013.377) (-1014.221) -- 0:00:33
464000 -- [-1013.476] (-1021.097) (-1014.756) (-1017.422) * (-1014.269) [-1016.633] (-1015.607) (-1015.562) -- 0:00:33
464500 -- [-1013.476] (-1018.930) (-1016.688) (-1016.142) * (-1015.278) [-1016.610] (-1017.572) (-1015.264) -- 0:00:33
465000 -- (-1014.130) (-1016.672) (-1017.055) [-1017.548] * (-1017.493) [-1012.784] (-1018.466) (-1016.944) -- 0:00:33
Average standard deviation of split frequencies: 0.015412
465500 -- (-1018.215) (-1017.703) [-1014.594] (-1020.452) * [-1015.159] (-1015.330) (-1018.180) (-1015.994) -- 0:00:33
466000 -- [-1017.709] (-1018.471) (-1014.548) (-1015.824) * (-1015.018) [-1014.927] (-1015.059) (-1016.624) -- 0:00:33
466500 -- (-1013.955) [-1014.764] (-1013.308) (-1018.861) * (-1019.581) (-1013.973) (-1018.561) [-1016.167] -- 0:00:33
467000 -- (-1015.455) (-1013.945) [-1013.316] (-1018.801) * (-1015.576) (-1013.674) [-1014.481] (-1016.061) -- 0:00:33
467500 -- (-1016.488) (-1015.001) (-1018.350) [-1015.829] * [-1014.933] (-1014.681) (-1013.168) (-1019.651) -- 0:00:33
468000 -- [-1015.675] (-1016.899) (-1015.793) (-1015.123) * (-1015.746) [-1013.343] (-1013.082) (-1014.985) -- 0:00:32
468500 -- (-1015.954) (-1018.180) [-1015.679] (-1016.427) * (-1014.985) [-1014.830] (-1016.490) (-1014.463) -- 0:00:32
469000 -- (-1019.472) [-1015.684] (-1012.993) (-1016.942) * (-1017.286) (-1016.866) [-1016.159] (-1015.229) -- 0:00:32
469500 -- (-1019.112) [-1013.533] (-1016.994) (-1018.769) * (-1014.299) (-1015.045) (-1015.161) [-1014.828] -- 0:00:33
470000 -- (-1013.226) (-1013.091) (-1016.535) [-1015.332] * (-1014.665) (-1015.431) [-1015.921] (-1014.758) -- 0:00:33
Average standard deviation of split frequencies: 0.015775
470500 -- [-1013.016] (-1014.306) (-1014.921) (-1017.072) * [-1016.716] (-1018.402) (-1019.102) (-1013.820) -- 0:00:33
471000 -- (-1013.435) (-1018.030) [-1016.547] (-1014.903) * (-1017.327) (-1016.939) (-1015.738) [-1013.840] -- 0:00:33
471500 -- (-1017.835) (-1015.636) [-1014.297] (-1015.257) * (-1014.696) (-1015.411) [-1018.656] (-1015.222) -- 0:00:33
472000 -- (-1020.318) (-1015.386) (-1013.339) [-1016.937] * (-1013.387) [-1015.454] (-1014.003) (-1016.224) -- 0:00:33
472500 -- (-1017.213) [-1016.027] (-1014.252) (-1017.340) * (-1014.175) [-1015.524] (-1015.556) (-1016.707) -- 0:00:33
473000 -- (-1016.195) (-1014.131) (-1015.207) [-1013.578] * [-1014.785] (-1014.315) (-1014.690) (-1015.048) -- 0:00:33
473500 -- (-1013.794) [-1013.243] (-1017.022) (-1013.654) * [-1013.821] (-1017.715) (-1013.550) (-1015.397) -- 0:00:33
474000 -- (-1016.914) (-1013.886) [-1016.218] (-1013.663) * [-1017.949] (-1017.547) (-1013.346) (-1012.878) -- 0:00:33
474500 -- (-1017.651) (-1014.419) [-1017.204] (-1014.449) * (-1018.468) (-1019.187) (-1014.235) [-1014.475] -- 0:00:33
475000 -- [-1013.984] (-1014.063) (-1015.571) (-1014.763) * [-1016.176] (-1018.784) (-1014.435) (-1016.933) -- 0:00:33
Average standard deviation of split frequencies: 0.015412
475500 -- (-1015.408) (-1015.411) [-1020.855] (-1013.999) * (-1014.617) (-1013.541) [-1014.319] (-1019.206) -- 0:00:33
476000 -- [-1015.248] (-1016.840) (-1015.821) (-1023.181) * (-1013.482) [-1014.407] (-1019.821) (-1014.488) -- 0:00:33
476500 -- (-1014.753) (-1013.520) (-1016.917) [-1020.087] * (-1013.286) (-1014.020) (-1014.752) [-1013.143] -- 0:00:32
477000 -- (-1012.877) (-1017.972) [-1021.554] (-1016.037) * (-1015.422) (-1014.399) [-1013.848] (-1022.152) -- 0:00:32
477500 -- [-1012.758] (-1021.279) (-1018.129) (-1014.822) * (-1014.040) (-1014.281) (-1016.303) [-1016.049] -- 0:00:32
478000 -- [-1013.431] (-1020.147) (-1013.236) (-1016.038) * (-1013.612) [-1016.366] (-1016.328) (-1016.621) -- 0:00:32
478500 -- [-1015.127] (-1015.556) (-1015.191) (-1016.496) * (-1014.155) (-1015.005) [-1016.453] (-1018.216) -- 0:00:32
479000 -- [-1014.539] (-1015.407) (-1017.828) (-1015.785) * [-1014.847] (-1014.679) (-1014.672) (-1015.097) -- 0:00:32
479500 -- (-1013.663) (-1017.748) (-1013.062) [-1016.435] * (-1013.486) (-1016.181) (-1014.296) [-1016.732] -- 0:00:32
480000 -- (-1015.496) (-1016.718) [-1013.303] (-1020.901) * (-1013.430) (-1015.380) [-1014.886] (-1016.544) -- 0:00:32
Average standard deviation of split frequencies: 0.014895
480500 -- (-1014.416) (-1014.282) (-1015.526) [-1014.403] * [-1014.187] (-1015.252) (-1014.720) (-1017.617) -- 0:00:32
481000 -- (-1013.198) (-1014.971) [-1015.077] (-1013.974) * [-1012.786] (-1019.094) (-1014.271) (-1015.949) -- 0:00:32
481500 -- [-1016.790] (-1016.292) (-1014.103) (-1018.668) * (-1012.971) [-1016.537] (-1013.685) (-1016.201) -- 0:00:32
482000 -- (-1014.596) [-1016.359] (-1018.953) (-1015.799) * (-1016.181) [-1019.784] (-1015.862) (-1016.341) -- 0:00:32
482500 -- (-1014.935) (-1017.167) (-1016.029) [-1014.809] * (-1013.349) (-1019.308) (-1015.823) [-1015.475] -- 0:00:32
483000 -- [-1015.242] (-1014.922) (-1015.901) (-1013.584) * (-1014.071) (-1015.126) (-1016.933) [-1014.089] -- 0:00:32
483500 -- [-1014.847] (-1014.022) (-1018.033) (-1016.907) * (-1014.026) [-1015.171] (-1017.590) (-1013.829) -- 0:00:32
484000 -- (-1016.423) (-1015.659) [-1014.981] (-1014.222) * (-1015.160) [-1015.283] (-1015.520) (-1014.071) -- 0:00:31
484500 -- (-1014.563) [-1014.666] (-1013.405) (-1014.630) * (-1017.191) (-1013.383) (-1015.524) [-1014.705] -- 0:00:31
485000 -- [-1014.200] (-1015.458) (-1015.384) (-1015.369) * [-1017.126] (-1014.874) (-1017.028) (-1014.635) -- 0:00:31
Average standard deviation of split frequencies: 0.014307
485500 -- (-1014.998) (-1016.156) (-1015.270) [-1015.725] * (-1018.411) (-1014.025) [-1016.712] (-1014.010) -- 0:00:31
486000 -- (-1016.663) (-1014.267) [-1013.759] (-1016.174) * (-1016.738) (-1015.272) (-1016.587) [-1013.002] -- 0:00:32
486500 -- (-1014.669) (-1013.492) (-1014.663) [-1016.110] * (-1015.812) (-1015.708) [-1016.535] (-1014.647) -- 0:00:32
487000 -- (-1014.654) [-1014.315] (-1014.236) (-1013.712) * [-1016.298] (-1013.755) (-1014.222) (-1016.987) -- 0:00:32
487500 -- (-1014.341) (-1017.305) (-1016.830) [-1015.264] * (-1016.617) (-1019.554) (-1016.249) [-1015.265] -- 0:00:32
488000 -- (-1014.524) (-1016.404) (-1014.389) [-1018.120] * (-1016.356) (-1020.381) (-1016.093) [-1015.263] -- 0:00:32
488500 -- (-1016.582) (-1013.879) [-1017.411] (-1018.162) * (-1015.434) [-1018.834] (-1014.433) (-1018.508) -- 0:00:32
489000 -- (-1016.301) (-1016.559) [-1013.844] (-1014.845) * (-1015.061) (-1014.300) [-1015.755] (-1016.914) -- 0:00:32
489500 -- [-1014.694] (-1013.525) (-1015.166) (-1014.194) * (-1014.910) [-1013.277] (-1014.416) (-1017.642) -- 0:00:32
490000 -- (-1015.780) (-1012.975) [-1017.710] (-1014.234) * (-1017.056) (-1014.512) (-1014.012) [-1016.017] -- 0:00:32
Average standard deviation of split frequencies: 0.013631
490500 -- (-1014.720) (-1014.535) (-1017.860) [-1014.922] * (-1014.316) (-1013.813) (-1014.227) [-1014.109] -- 0:00:32
491000 -- [-1017.428] (-1014.674) (-1016.112) (-1015.193) * (-1013.140) [-1015.132] (-1019.516) (-1013.651) -- 0:00:32
491500 -- [-1014.566] (-1017.603) (-1014.404) (-1014.455) * (-1014.129) (-1013.935) (-1015.659) [-1013.776] -- 0:00:32
492000 -- (-1016.458) [-1015.358] (-1015.075) (-1013.585) * (-1019.320) (-1014.855) [-1014.258] (-1014.149) -- 0:00:32
492500 -- (-1017.541) [-1013.279] (-1013.818) (-1015.942) * (-1018.418) (-1016.582) [-1015.610] (-1014.147) -- 0:00:31
493000 -- (-1014.383) [-1013.042] (-1014.008) (-1019.661) * (-1014.491) (-1014.888) [-1013.677] (-1014.055) -- 0:00:31
493500 -- (-1014.072) (-1015.149) [-1016.483] (-1015.615) * (-1013.832) (-1014.711) (-1013.615) [-1014.023] -- 0:00:31
494000 -- [-1012.666] (-1016.221) (-1018.214) (-1013.358) * [-1016.910] (-1017.775) (-1018.135) (-1016.405) -- 0:00:31
494500 -- (-1014.740) [-1016.333] (-1014.827) (-1014.592) * (-1014.909) [-1014.872] (-1014.921) (-1019.226) -- 0:00:31
495000 -- (-1017.407) (-1014.776) (-1016.831) [-1022.343] * [-1015.026] (-1015.364) (-1014.008) (-1012.936) -- 0:00:31
Average standard deviation of split frequencies: 0.013246
495500 -- [-1014.650] (-1017.015) (-1015.165) (-1014.359) * (-1014.800) [-1015.101] (-1020.834) (-1017.332) -- 0:00:31
496000 -- (-1015.123) (-1016.828) (-1013.218) [-1014.542] * (-1017.372) [-1014.110] (-1016.398) (-1017.105) -- 0:00:31
496500 -- [-1015.769] (-1015.361) (-1017.561) (-1014.086) * (-1016.140) (-1014.158) (-1014.656) [-1013.401] -- 0:00:31
497000 -- (-1015.992) [-1014.454] (-1017.475) (-1016.141) * (-1014.904) (-1016.420) (-1017.481) [-1015.757] -- 0:00:31
497500 -- (-1015.619) [-1014.704] (-1014.862) (-1015.858) * (-1014.907) (-1014.224) [-1014.307] (-1018.460) -- 0:00:31
498000 -- (-1013.832) [-1017.009] (-1015.057) (-1015.882) * (-1016.367) [-1015.237] (-1015.711) (-1015.883) -- 0:00:31
498500 -- (-1013.289) (-1018.177) (-1014.909) [-1016.845] * (-1017.076) [-1013.685] (-1015.657) (-1016.308) -- 0:00:31
499000 -- (-1016.393) (-1014.073) [-1014.399] (-1014.598) * (-1016.170) (-1015.306) [-1014.539] (-1017.116) -- 0:00:31
499500 -- [-1013.862] (-1014.328) (-1015.706) (-1014.555) * (-1012.688) (-1013.728) [-1014.077] (-1015.843) -- 0:00:31
500000 -- [-1013.110] (-1015.441) (-1016.843) (-1013.391) * [-1013.577] (-1014.795) (-1016.327) (-1015.990) -- 0:00:31
Average standard deviation of split frequencies: 0.012240
500500 -- (-1014.513) (-1015.212) [-1015.109] (-1014.804) * (-1014.261) (-1014.014) [-1014.775] (-1015.089) -- 0:00:30
501000 -- (-1016.136) [-1019.516] (-1013.029) (-1014.375) * (-1014.298) (-1019.345) (-1018.104) [-1014.896] -- 0:00:30
501500 -- [-1014.745] (-1018.428) (-1012.794) (-1015.484) * (-1014.148) (-1013.655) [-1013.049] (-1016.691) -- 0:00:30
502000 -- (-1016.018) (-1018.318) [-1014.620] (-1015.470) * (-1015.281) (-1028.662) (-1015.913) [-1013.917] -- 0:00:30
502500 -- (-1014.926) (-1014.021) [-1018.341] (-1013.109) * [-1015.934] (-1022.673) (-1015.264) (-1012.854) -- 0:00:31
503000 -- [-1017.039] (-1015.069) (-1015.389) (-1016.030) * (-1020.331) [-1013.375] (-1018.692) (-1013.019) -- 0:00:31
503500 -- (-1015.555) (-1016.571) (-1019.791) [-1012.956] * [-1016.703] (-1016.486) (-1021.420) (-1013.438) -- 0:00:31
504000 -- [-1013.982] (-1022.927) (-1019.903) (-1012.917) * (-1014.051) [-1014.257] (-1018.973) (-1014.179) -- 0:00:31
504500 -- (-1014.014) (-1013.827) (-1014.685) [-1013.074] * (-1013.974) (-1014.780) [-1014.237] (-1014.455) -- 0:00:31
505000 -- (-1014.817) (-1016.097) (-1014.374) [-1014.303] * (-1014.387) (-1014.869) [-1016.853] (-1018.171) -- 0:00:31
Average standard deviation of split frequencies: 0.011563
505500 -- (-1013.164) [-1016.019] (-1013.508) (-1014.130) * (-1014.092) (-1014.083) [-1021.137] (-1014.243) -- 0:00:31
506000 -- (-1018.456) (-1016.118) [-1014.109] (-1016.134) * [-1015.768] (-1014.294) (-1019.696) (-1016.317) -- 0:00:31
506500 -- (-1015.702) (-1015.355) [-1014.573] (-1013.387) * (-1016.205) [-1014.266] (-1014.607) (-1015.704) -- 0:00:31
507000 -- (-1013.585) (-1016.731) (-1015.339) [-1013.940] * [-1013.545] (-1013.680) (-1014.222) (-1016.320) -- 0:00:31
507500 -- (-1013.944) (-1014.600) (-1014.668) [-1016.724] * (-1019.914) [-1014.463] (-1016.790) (-1016.636) -- 0:00:31
508000 -- (-1012.953) (-1019.239) (-1014.314) [-1016.065] * (-1018.405) (-1017.408) [-1014.554] (-1015.831) -- 0:00:30
508500 -- [-1015.032] (-1018.403) (-1015.277) (-1017.331) * (-1014.789) [-1014.439] (-1013.499) (-1015.368) -- 0:00:30
509000 -- (-1013.314) [-1015.538] (-1017.233) (-1018.756) * (-1014.145) (-1017.218) [-1013.931] (-1015.646) -- 0:00:30
509500 -- (-1015.460) [-1015.004] (-1015.016) (-1017.138) * (-1016.123) (-1014.663) [-1014.804] (-1014.234) -- 0:00:30
510000 -- (-1015.315) [-1014.510] (-1014.370) (-1016.406) * [-1018.361] (-1013.412) (-1014.367) (-1016.951) -- 0:00:30
Average standard deviation of split frequencies: 0.011675
510500 -- (-1015.189) [-1014.265] (-1014.898) (-1015.247) * (-1013.755) [-1016.907] (-1016.468) (-1019.552) -- 0:00:30
511000 -- (-1014.688) [-1014.728] (-1015.397) (-1017.539) * [-1015.143] (-1015.463) (-1017.127) (-1015.307) -- 0:00:30
511500 -- (-1014.144) (-1016.008) (-1016.309) [-1014.247] * (-1014.344) (-1013.884) (-1016.543) [-1013.771] -- 0:00:30
512000 -- (-1015.907) [-1015.665] (-1015.979) (-1012.973) * [-1014.494] (-1015.435) (-1014.703) (-1013.628) -- 0:00:30
512500 -- (-1015.037) [-1016.534] (-1017.472) (-1014.361) * (-1015.201) [-1016.448] (-1014.218) (-1015.157) -- 0:00:30
513000 -- [-1014.215] (-1015.568) (-1016.372) (-1014.371) * [-1014.395] (-1012.956) (-1015.174) (-1013.393) -- 0:00:30
513500 -- [-1014.412] (-1016.063) (-1018.165) (-1018.153) * (-1015.419) [-1013.404] (-1014.606) (-1016.472) -- 0:00:30
514000 -- [-1016.415] (-1018.208) (-1018.102) (-1023.037) * (-1017.492) (-1013.403) (-1016.214) [-1013.705] -- 0:00:30
514500 -- (-1013.995) [-1018.501] (-1014.410) (-1020.453) * (-1014.963) [-1012.892] (-1016.405) (-1013.262) -- 0:00:30
515000 -- [-1013.812] (-1013.923) (-1014.882) (-1018.950) * (-1014.729) [-1012.892] (-1013.365) (-1013.172) -- 0:00:30
Average standard deviation of split frequencies: 0.011232
515500 -- (-1015.144) (-1017.048) [-1013.985] (-1014.801) * (-1019.011) (-1013.210) (-1013.871) [-1014.471] -- 0:00:30
516000 -- (-1013.945) (-1016.480) [-1014.418] (-1013.166) * [-1015.234] (-1014.540) (-1013.123) (-1018.767) -- 0:00:30
516500 -- [-1014.301] (-1016.051) (-1014.690) (-1013.268) * [-1015.391] (-1015.002) (-1013.292) (-1017.630) -- 0:00:29
517000 -- (-1016.126) (-1013.984) (-1015.678) [-1013.359] * (-1014.628) (-1018.931) (-1015.406) [-1015.703] -- 0:00:29
517500 -- (-1016.657) (-1018.952) (-1016.669) [-1013.813] * (-1014.347) (-1017.739) (-1014.751) [-1015.433] -- 0:00:29
518000 -- (-1016.861) (-1016.181) (-1020.004) [-1014.070] * (-1016.685) (-1016.970) (-1017.010) [-1018.172] -- 0:00:29
518500 -- (-1015.285) [-1014.661] (-1014.571) (-1014.040) * (-1019.055) (-1016.107) [-1018.149] (-1016.247) -- 0:00:30
519000 -- (-1016.486) (-1015.379) [-1016.046] (-1014.657) * [-1016.384] (-1017.787) (-1013.274) (-1017.525) -- 0:00:30
519500 -- (-1014.356) (-1014.801) [-1014.716] (-1014.774) * (-1013.195) (-1016.758) (-1014.834) [-1016.557] -- 0:00:30
520000 -- (-1019.995) (-1015.337) [-1015.390] (-1018.391) * (-1014.979) [-1013.032] (-1014.123) (-1016.523) -- 0:00:30
Average standard deviation of split frequencies: 0.011983
520500 -- (-1019.074) (-1018.801) [-1016.150] (-1014.781) * [-1015.319] (-1017.719) (-1015.555) (-1016.009) -- 0:00:30
521000 -- (-1018.076) [-1014.782] (-1019.575) (-1016.764) * (-1017.671) (-1016.846) (-1013.479) [-1014.414] -- 0:00:30
521500 -- (-1016.183) (-1015.450) (-1014.774) [-1015.212] * (-1016.119) [-1014.924] (-1013.339) (-1016.800) -- 0:00:30
522000 -- (-1019.185) [-1014.193] (-1018.011) (-1014.545) * [-1013.623] (-1015.813) (-1013.384) (-1013.120) -- 0:00:30
522500 -- (-1018.951) (-1014.539) (-1016.208) [-1016.585] * [-1013.843] (-1015.249) (-1013.728) (-1013.891) -- 0:00:30
523000 -- (-1014.974) (-1014.506) [-1013.482] (-1014.736) * (-1016.482) (-1013.969) (-1013.996) [-1013.180] -- 0:00:30
523500 -- (-1013.401) (-1017.332) [-1012.924] (-1014.942) * (-1014.853) (-1014.005) [-1014.016] (-1017.969) -- 0:00:30
524000 -- [-1013.877] (-1017.405) (-1013.175) (-1017.514) * [-1014.332] (-1014.030) (-1014.679) (-1018.735) -- 0:00:29
524500 -- (-1013.420) (-1015.078) [-1016.097] (-1013.876) * (-1013.419) [-1014.857] (-1016.397) (-1013.325) -- 0:00:29
525000 -- (-1014.411) (-1017.922) [-1017.707] (-1013.940) * (-1015.951) (-1014.542) [-1013.256] (-1015.368) -- 0:00:29
Average standard deviation of split frequencies: 0.011545
525500 -- (-1014.330) (-1015.971) (-1015.832) [-1016.852] * (-1014.474) (-1015.401) [-1013.011] (-1015.935) -- 0:00:29
526000 -- (-1013.661) (-1013.549) [-1015.820] (-1017.075) * (-1014.622) (-1015.294) (-1015.784) [-1013.614] -- 0:00:29
526500 -- [-1013.839] (-1013.127) (-1014.629) (-1014.515) * [-1016.531] (-1015.394) (-1017.689) (-1015.211) -- 0:00:29
527000 -- (-1015.829) [-1013.798] (-1016.219) (-1014.157) * (-1014.147) (-1013.501) (-1016.956) [-1016.350] -- 0:00:29
527500 -- (-1013.284) (-1013.918) [-1017.875] (-1019.581) * (-1014.995) (-1018.401) [-1015.275] (-1015.769) -- 0:00:29
528000 -- (-1013.257) (-1014.186) [-1014.079] (-1018.066) * (-1012.933) (-1017.128) [-1014.410] (-1014.198) -- 0:00:29
528500 -- (-1017.025) (-1014.574) [-1013.903] (-1016.545) * (-1014.608) [-1015.586] (-1018.102) (-1015.667) -- 0:00:29
529000 -- (-1015.175) (-1014.156) [-1013.762] (-1016.005) * [-1015.376] (-1014.975) (-1016.480) (-1017.038) -- 0:00:29
529500 -- [-1013.690] (-1014.218) (-1015.088) (-1017.399) * (-1015.854) [-1014.500] (-1017.216) (-1014.034) -- 0:00:29
530000 -- (-1012.902) (-1013.735) [-1014.156] (-1015.784) * (-1015.053) (-1015.756) (-1015.531) [-1013.921] -- 0:00:29
Average standard deviation of split frequencies: 0.011382
530500 -- (-1015.638) [-1014.176] (-1014.237) (-1016.790) * (-1015.258) [-1014.540] (-1016.132) (-1014.284) -- 0:00:29
531000 -- [-1015.168] (-1016.863) (-1014.560) (-1017.852) * [-1013.142] (-1013.696) (-1013.227) (-1014.807) -- 0:00:29
531500 -- (-1017.141) [-1014.399] (-1017.854) (-1015.569) * (-1014.417) [-1013.890] (-1013.384) (-1017.177) -- 0:00:29
532000 -- (-1016.279) (-1014.398) (-1024.772) [-1013.917] * (-1013.584) [-1015.638] (-1015.092) (-1015.064) -- 0:00:29
532500 -- (-1017.421) [-1015.314] (-1017.572) (-1014.923) * (-1013.824) (-1017.560) (-1014.418) [-1014.464] -- 0:00:28
533000 -- (-1013.535) [-1013.783] (-1015.446) (-1017.450) * (-1017.114) (-1014.301) (-1013.396) [-1014.454] -- 0:00:28
533500 -- (-1017.195) (-1015.473) (-1014.118) [-1019.251] * (-1014.606) (-1015.278) [-1015.967] (-1016.097) -- 0:00:28
534000 -- (-1019.843) [-1015.252] (-1016.523) (-1015.372) * [-1015.269] (-1013.414) (-1015.616) (-1016.482) -- 0:00:28
534500 -- (-1017.058) (-1017.321) (-1019.161) [-1016.532] * (-1016.430) (-1014.641) [-1014.449] (-1018.799) -- 0:00:29
535000 -- (-1016.853) [-1016.473] (-1020.873) (-1015.232) * (-1017.513) (-1015.326) [-1018.805] (-1018.298) -- 0:00:29
Average standard deviation of split frequencies: 0.010774
535500 -- (-1015.778) [-1013.368] (-1018.138) (-1014.863) * (-1017.224) [-1014.920] (-1015.903) (-1017.125) -- 0:00:29
536000 -- [-1013.560] (-1014.662) (-1014.515) (-1012.988) * (-1014.209) (-1018.439) (-1014.253) [-1013.141] -- 0:00:29
536500 -- (-1014.414) (-1012.971) (-1015.005) [-1013.348] * (-1016.391) [-1020.658] (-1013.789) (-1013.891) -- 0:00:29
537000 -- [-1013.862] (-1014.541) (-1015.447) (-1019.401) * (-1014.116) (-1022.160) [-1015.563] (-1014.400) -- 0:00:29
537500 -- (-1014.145) (-1013.598) (-1021.073) [-1016.625] * (-1015.286) (-1017.716) (-1015.998) [-1016.053] -- 0:00:29
538000 -- [-1014.116] (-1014.154) (-1016.582) (-1014.909) * (-1018.883) (-1014.410) [-1015.564] (-1013.391) -- 0:00:29
538500 -- (-1015.773) (-1014.735) [-1020.639] (-1014.220) * (-1014.951) [-1014.084] (-1016.973) (-1018.533) -- 0:00:29
539000 -- (-1015.517) [-1019.702] (-1020.702) (-1014.270) * (-1017.398) (-1018.532) (-1014.048) [-1014.624] -- 0:00:29
539500 -- (-1015.295) (-1015.941) (-1014.837) [-1016.518] * (-1014.131) (-1014.096) [-1014.292] (-1014.652) -- 0:00:29
540000 -- (-1015.709) [-1015.366] (-1014.681) (-1016.014) * (-1015.344) (-1015.490) [-1014.885] (-1014.250) -- 0:00:28
Average standard deviation of split frequencies: 0.010190
540500 -- (-1014.327) [-1014.557] (-1014.290) (-1016.846) * (-1013.362) (-1016.609) [-1017.143] (-1014.407) -- 0:00:28
541000 -- [-1013.656] (-1014.076) (-1013.214) (-1014.495) * (-1014.820) (-1016.575) [-1017.843] (-1013.991) -- 0:00:28
541500 -- (-1015.987) (-1014.132) [-1014.731] (-1015.261) * [-1016.051] (-1016.453) (-1017.336) (-1013.289) -- 0:00:28
542000 -- (-1014.589) [-1015.387] (-1016.634) (-1017.444) * (-1014.614) [-1015.406] (-1018.029) (-1018.585) -- 0:00:28
542500 -- (-1012.701) (-1017.355) (-1015.898) [-1015.599] * (-1015.920) [-1013.757] (-1018.349) (-1015.719) -- 0:00:28
543000 -- (-1013.350) (-1013.803) (-1016.772) [-1016.007] * (-1017.696) [-1014.630] (-1015.011) (-1017.690) -- 0:00:28
543500 -- (-1015.267) [-1014.730] (-1016.074) (-1014.355) * [-1014.353] (-1012.935) (-1017.205) (-1017.035) -- 0:00:28
544000 -- (-1013.289) [-1020.051] (-1013.369) (-1014.874) * (-1016.925) (-1014.501) (-1015.873) [-1014.285] -- 0:00:28
544500 -- (-1013.768) [-1019.513] (-1013.856) (-1016.982) * (-1014.555) (-1022.485) [-1014.933] (-1016.773) -- 0:00:28
545000 -- (-1013.917) (-1017.515) [-1016.642] (-1016.840) * [-1016.176] (-1017.371) (-1015.694) (-1015.689) -- 0:00:28
Average standard deviation of split frequencies: 0.010091
545500 -- [-1014.336] (-1020.943) (-1015.455) (-1016.844) * (-1015.154) [-1017.847] (-1014.793) (-1021.050) -- 0:00:28
546000 -- (-1015.205) (-1018.165) [-1014.070] (-1017.213) * (-1015.195) [-1013.908] (-1014.140) (-1020.748) -- 0:00:28
546500 -- [-1014.673] (-1015.452) (-1014.985) (-1015.278) * (-1013.331) (-1013.727) [-1015.205] (-1021.264) -- 0:00:28
547000 -- [-1015.415] (-1016.116) (-1014.443) (-1013.753) * (-1015.511) (-1013.375) (-1014.035) [-1014.807] -- 0:00:28
547500 -- [-1012.901] (-1018.608) (-1013.092) (-1015.052) * (-1016.067) (-1013.534) (-1014.374) [-1014.428] -- 0:00:28
548000 -- (-1014.395) [-1016.313] (-1016.204) (-1013.956) * (-1016.164) (-1021.687) (-1016.398) [-1013.382] -- 0:00:28
548500 -- (-1014.715) (-1014.559) (-1015.863) [-1014.950] * (-1014.587) [-1013.216] (-1016.919) (-1016.410) -- 0:00:27
549000 -- (-1018.780) (-1015.811) (-1015.069) [-1014.657] * [-1013.643] (-1015.468) (-1015.374) (-1014.000) -- 0:00:27
549500 -- (-1013.632) (-1014.097) [-1016.113] (-1014.626) * (-1014.328) (-1017.806) (-1016.140) [-1014.070] -- 0:00:27
550000 -- (-1015.157) (-1012.668) (-1013.428) [-1014.054] * (-1017.040) (-1013.689) [-1015.199] (-1014.264) -- 0:00:27
Average standard deviation of split frequencies: 0.010540
550500 -- (-1015.353) (-1013.583) (-1012.995) [-1015.918] * [-1013.405] (-1019.412) (-1019.010) (-1016.540) -- 0:00:27
551000 -- (-1013.171) (-1013.878) [-1016.701] (-1013.766) * (-1014.917) (-1019.692) (-1015.541) [-1013.102] -- 0:00:28
551500 -- (-1019.005) (-1013.491) (-1015.812) [-1015.384] * (-1015.517) [-1016.504] (-1014.081) (-1018.094) -- 0:00:28
552000 -- (-1018.658) [-1015.698] (-1015.013) (-1014.681) * (-1015.873) [-1013.705] (-1014.363) (-1013.415) -- 0:00:28
552500 -- (-1018.488) (-1014.858) (-1014.044) [-1015.546] * (-1015.560) (-1021.021) (-1016.559) [-1015.230] -- 0:00:28
553000 -- (-1022.314) (-1015.980) (-1013.482) [-1017.073] * (-1014.502) [-1013.001] (-1013.933) (-1015.392) -- 0:00:28
553500 -- (-1016.007) [-1015.387] (-1021.662) (-1015.726) * (-1016.163) [-1014.128] (-1016.000) (-1017.320) -- 0:00:28
554000 -- (-1014.363) (-1018.458) (-1016.830) [-1014.375] * [-1017.250] (-1018.265) (-1019.675) (-1013.991) -- 0:00:28
554500 -- (-1016.916) [-1014.990] (-1017.114) (-1020.009) * (-1015.689) (-1013.597) [-1014.803] (-1013.485) -- 0:00:28
555000 -- (-1013.668) (-1014.513) [-1015.175] (-1015.447) * (-1016.276) (-1016.117) [-1014.874] (-1014.852) -- 0:00:28
Average standard deviation of split frequencies: 0.010473
555500 -- (-1014.873) (-1013.162) (-1017.416) [-1013.805] * (-1013.221) (-1015.391) (-1015.469) [-1014.287] -- 0:00:28
556000 -- (-1018.398) [-1013.081] (-1014.580) (-1015.421) * (-1013.863) (-1015.115) [-1016.117] (-1013.198) -- 0:00:27
556500 -- (-1014.385) [-1013.593] (-1017.478) (-1014.954) * [-1013.779] (-1016.732) (-1015.193) (-1015.370) -- 0:00:27
557000 -- (-1013.480) (-1013.199) [-1016.042] (-1015.609) * [-1019.404] (-1013.441) (-1016.849) (-1014.073) -- 0:00:27
557500 -- (-1015.359) (-1014.695) [-1014.323] (-1014.299) * [-1016.829] (-1013.372) (-1015.839) (-1018.320) -- 0:00:27
558000 -- (-1015.410) [-1016.852] (-1015.464) (-1019.919) * (-1014.489) [-1014.939] (-1017.769) (-1016.712) -- 0:00:27
558500 -- (-1015.053) [-1013.204] (-1014.820) (-1017.680) * (-1015.674) [-1014.344] (-1015.532) (-1015.555) -- 0:00:27
559000 -- (-1015.814) (-1015.625) (-1013.384) [-1015.853] * (-1013.944) (-1020.709) [-1015.745] (-1012.776) -- 0:00:27
559500 -- (-1014.682) (-1016.207) [-1013.429] (-1018.281) * (-1013.629) (-1014.611) (-1014.669) [-1013.477] -- 0:00:27
560000 -- (-1019.991) (-1014.727) (-1015.793) [-1013.230] * [-1015.823] (-1014.444) (-1015.492) (-1014.118) -- 0:00:27
Average standard deviation of split frequencies: 0.009774
560500 -- [-1014.512] (-1014.044) (-1017.026) (-1014.124) * (-1015.156) (-1013.383) (-1015.206) [-1015.018] -- 0:00:27
561000 -- (-1015.103) (-1014.001) (-1016.232) [-1016.539] * [-1014.785] (-1015.561) (-1019.098) (-1013.149) -- 0:00:27
561500 -- (-1014.071) (-1015.278) (-1022.416) [-1017.112] * (-1014.321) (-1015.909) (-1014.683) [-1015.588] -- 0:00:27
562000 -- (-1014.992) (-1012.982) [-1013.161] (-1015.492) * [-1016.153] (-1017.042) (-1014.058) (-1014.740) -- 0:00:27
562500 -- (-1014.337) (-1013.995) (-1013.019) [-1015.643] * (-1015.866) [-1018.951] (-1018.431) (-1013.350) -- 0:00:27
563000 -- [-1015.005] (-1016.493) (-1013.133) (-1014.495) * (-1014.815) [-1015.814] (-1016.355) (-1014.497) -- 0:00:27
563500 -- [-1016.289] (-1015.583) (-1013.819) (-1018.848) * [-1013.584] (-1014.887) (-1013.431) (-1014.296) -- 0:00:27
564000 -- (-1016.081) (-1013.863) [-1016.218] (-1022.976) * (-1014.796) (-1018.656) (-1016.400) [-1016.250] -- 0:00:27
564500 -- (-1014.742) [-1013.909] (-1017.504) (-1014.676) * (-1015.968) (-1015.446) [-1016.760] (-1014.667) -- 0:00:27
565000 -- (-1017.033) (-1013.856) [-1023.247] (-1014.560) * (-1013.351) (-1015.242) (-1018.867) [-1013.697] -- 0:00:26
Average standard deviation of split frequencies: 0.010099
565500 -- (-1016.245) (-1014.039) (-1017.301) [-1013.299] * [-1013.718] (-1013.349) (-1017.926) (-1015.210) -- 0:00:26
566000 -- (-1014.513) (-1017.210) [-1013.877] (-1014.085) * (-1014.541) [-1012.823] (-1017.399) (-1016.740) -- 0:00:26
566500 -- (-1015.404) [-1015.701] (-1014.030) (-1014.073) * (-1019.544) (-1014.494) (-1016.589) [-1014.928] -- 0:00:26
567000 -- [-1014.679] (-1017.682) (-1014.783) (-1013.618) * (-1018.814) [-1013.440] (-1014.023) (-1016.453) -- 0:00:26
567500 -- (-1014.626) [-1015.534] (-1013.580) (-1016.350) * (-1015.843) [-1015.062] (-1013.697) (-1014.455) -- 0:00:26
568000 -- (-1015.004) (-1015.066) (-1013.589) [-1013.258] * (-1013.603) (-1012.960) (-1013.922) [-1015.641] -- 0:00:27
568500 -- (-1015.274) (-1013.867) (-1014.060) [-1013.271] * (-1013.577) [-1013.402] (-1014.090) (-1015.871) -- 0:00:27
569000 -- (-1013.866) (-1017.012) [-1016.008] (-1014.418) * (-1016.589) (-1013.696) (-1014.636) [-1015.139] -- 0:00:27
569500 -- (-1013.859) (-1016.338) [-1013.168] (-1013.540) * (-1015.491) [-1014.258] (-1013.625) (-1015.821) -- 0:00:27
570000 -- (-1016.620) (-1016.377) [-1013.190] (-1013.925) * [-1017.841] (-1018.818) (-1013.590) (-1016.516) -- 0:00:27
Average standard deviation of split frequencies: 0.010068
570500 -- [-1018.486] (-1014.594) (-1015.288) (-1016.496) * (-1014.423) (-1014.414) (-1015.255) [-1017.867] -- 0:00:27
571000 -- [-1013.876] (-1014.491) (-1018.085) (-1016.158) * (-1012.929) (-1014.869) [-1013.620] (-1015.232) -- 0:00:27
571500 -- (-1014.187) [-1013.628] (-1026.826) (-1014.565) * [-1015.996] (-1016.048) (-1016.559) (-1013.402) -- 0:00:26
572000 -- (-1014.325) [-1013.666] (-1018.992) (-1017.823) * (-1016.104) (-1013.935) [-1015.937] (-1013.507) -- 0:00:26
572500 -- (-1018.754) [-1014.824] (-1013.855) (-1014.653) * (-1014.947) (-1014.537) [-1014.135] (-1015.001) -- 0:00:26
573000 -- (-1013.567) [-1013.171] (-1019.527) (-1014.864) * [-1015.852] (-1013.506) (-1014.414) (-1023.538) -- 0:00:26
573500 -- (-1019.200) (-1014.151) (-1015.260) [-1013.315] * (-1019.010) [-1014.722] (-1014.947) (-1018.014) -- 0:00:26
574000 -- [-1016.355] (-1019.049) (-1016.799) (-1013.419) * (-1013.531) [-1013.032] (-1013.589) (-1021.986) -- 0:00:26
574500 -- [-1016.094] (-1018.414) (-1014.632) (-1013.535) * (-1020.601) (-1013.773) [-1013.158] (-1015.549) -- 0:00:26
575000 -- [-1013.525] (-1014.830) (-1013.338) (-1014.279) * (-1017.036) (-1013.672) [-1013.809] (-1017.266) -- 0:00:26
Average standard deviation of split frequencies: 0.009565
575500 -- (-1015.920) (-1019.872) (-1015.477) [-1014.201] * (-1015.856) [-1013.127] (-1015.073) (-1017.521) -- 0:00:26
576000 -- (-1015.510) [-1016.437] (-1020.681) (-1016.117) * (-1016.052) [-1014.269] (-1014.675) (-1016.303) -- 0:00:26
576500 -- (-1017.481) (-1014.265) (-1019.651) [-1015.948] * [-1015.571] (-1016.213) (-1013.508) (-1013.413) -- 0:00:26
577000 -- (-1018.752) (-1015.055) (-1013.652) [-1013.815] * (-1015.148) (-1016.137) [-1014.011] (-1013.442) -- 0:00:26
577500 -- (-1014.817) (-1017.018) (-1014.661) [-1013.611] * (-1013.638) (-1017.314) (-1014.923) [-1014.917] -- 0:00:26
578000 -- (-1017.393) (-1014.923) (-1014.399) [-1013.719] * (-1015.167) (-1014.505) [-1014.882] (-1013.258) -- 0:00:26
578500 -- (-1018.856) [-1015.205] (-1014.741) (-1015.051) * (-1013.952) (-1015.011) [-1013.156] (-1015.950) -- 0:00:26
579000 -- (-1014.327) (-1018.925) (-1014.954) [-1014.253] * (-1015.355) (-1014.435) (-1017.016) [-1013.434] -- 0:00:26
579500 -- (-1015.596) (-1016.846) (-1016.622) [-1017.452] * (-1014.329) [-1015.001] (-1014.011) (-1013.331) -- 0:00:26
580000 -- (-1016.818) (-1013.510) (-1014.963) [-1014.440] * (-1016.280) (-1016.270) [-1012.876] (-1015.158) -- 0:00:26
Average standard deviation of split frequencies: 0.009894
580500 -- (-1016.165) [-1013.620] (-1013.545) (-1015.510) * (-1016.085) [-1014.300] (-1013.761) (-1014.010) -- 0:00:26
581000 -- [-1014.615] (-1016.273) (-1017.471) (-1019.450) * [-1017.492] (-1015.345) (-1017.335) (-1013.786) -- 0:00:25
581500 -- (-1014.684) [-1013.970] (-1014.426) (-1018.894) * (-1013.292) [-1014.084] (-1016.975) (-1018.821) -- 0:00:25
582000 -- [-1014.593] (-1013.886) (-1013.558) (-1014.319) * (-1016.426) [-1013.836] (-1015.385) (-1017.817) -- 0:00:25
582500 -- (-1012.997) (-1013.409) (-1015.264) [-1014.437] * (-1016.405) (-1016.695) [-1016.353] (-1016.902) -- 0:00:25
583000 -- (-1013.865) [-1016.780] (-1013.433) (-1013.217) * (-1016.056) (-1017.336) [-1020.121] (-1017.662) -- 0:00:25
583500 -- (-1014.638) (-1013.374) [-1013.993] (-1015.285) * (-1013.611) [-1013.828] (-1020.554) (-1013.663) -- 0:00:25
584000 -- (-1019.047) [-1013.103] (-1016.186) (-1015.383) * (-1018.874) (-1014.347) [-1021.508] (-1013.814) -- 0:00:25
584500 -- [-1012.992] (-1013.054) (-1013.702) (-1019.035) * (-1016.055) (-1014.326) (-1017.544) [-1013.826] -- 0:00:26
585000 -- (-1015.920) (-1013.100) [-1015.177] (-1019.892) * [-1016.856] (-1013.414) (-1013.516) (-1015.233) -- 0:00:26
Average standard deviation of split frequencies: 0.009905
585500 -- (-1015.576) [-1013.739] (-1019.900) (-1018.664) * (-1017.028) [-1014.452] (-1014.993) (-1014.273) -- 0:00:26
586000 -- (-1015.034) (-1020.208) (-1017.716) [-1016.203] * [-1013.824] (-1016.379) (-1016.607) (-1017.980) -- 0:00:26
586500 -- (-1014.379) [-1014.000] (-1016.410) (-1019.536) * (-1018.126) [-1013.082] (-1013.338) (-1014.417) -- 0:00:26
587000 -- [-1014.681] (-1014.149) (-1017.784) (-1014.616) * (-1014.716) (-1013.670) [-1016.606] (-1013.885) -- 0:00:26
587500 -- (-1013.907) [-1014.611] (-1014.525) (-1014.456) * (-1013.133) [-1014.086] (-1015.819) (-1014.688) -- 0:00:25
588000 -- (-1014.243) (-1013.521) [-1014.586] (-1015.116) * (-1015.205) (-1013.377) (-1013.198) [-1014.275] -- 0:00:25
588500 -- (-1017.970) (-1015.990) [-1014.085] (-1013.119) * [-1015.984] (-1014.374) (-1018.684) (-1013.931) -- 0:00:25
589000 -- (-1021.346) (-1013.312) [-1020.199] (-1013.626) * [-1013.950] (-1017.964) (-1015.592) (-1013.558) -- 0:00:25
589500 -- (-1021.839) [-1015.111] (-1020.032) (-1013.435) * (-1016.619) [-1014.275] (-1017.143) (-1013.009) -- 0:00:25
590000 -- (-1015.608) [-1018.884] (-1016.037) (-1015.381) * (-1014.608) [-1015.255] (-1016.903) (-1014.006) -- 0:00:25
Average standard deviation of split frequencies: 0.009777
590500 -- (-1016.817) (-1015.686) (-1015.261) [-1014.444] * (-1015.935) (-1014.617) (-1015.839) [-1022.552] -- 0:00:25
591000 -- [-1015.198] (-1013.826) (-1013.419) (-1014.516) * (-1013.965) [-1014.446] (-1017.337) (-1014.698) -- 0:00:25
591500 -- (-1014.820) (-1013.850) (-1013.381) [-1019.699] * (-1013.927) [-1013.621] (-1017.937) (-1016.467) -- 0:00:25
592000 -- (-1014.145) (-1013.599) (-1014.581) [-1013.652] * (-1013.296) (-1017.204) (-1022.290) [-1014.960] -- 0:00:25
592500 -- (-1013.820) (-1013.456) (-1015.094) [-1017.066] * [-1016.195] (-1013.258) (-1014.775) (-1013.685) -- 0:00:25
593000 -- (-1013.831) (-1017.763) (-1014.304) [-1015.812] * (-1018.017) [-1014.681] (-1015.506) (-1013.190) -- 0:00:25
593500 -- (-1014.315) [-1017.669] (-1014.061) (-1013.509) * (-1016.745) (-1016.615) [-1015.399] (-1016.618) -- 0:00:25
594000 -- (-1015.850) (-1021.801) (-1014.845) [-1013.911] * [-1014.710] (-1021.622) (-1016.666) (-1014.631) -- 0:00:25
594500 -- (-1015.901) (-1018.193) (-1014.634) [-1013.514] * (-1013.139) (-1016.259) [-1019.086] (-1014.835) -- 0:00:25
595000 -- (-1014.003) [-1015.919] (-1013.868) (-1014.430) * [-1014.713] (-1013.879) (-1018.325) (-1015.092) -- 0:00:25
Average standard deviation of split frequencies: 0.009343
595500 -- (-1017.584) (-1013.992) (-1013.709) [-1016.880] * (-1016.537) (-1013.949) [-1014.336] (-1014.353) -- 0:00:25
596000 -- (-1012.731) [-1013.639] (-1015.356) (-1014.558) * (-1017.103) [-1022.291] (-1013.386) (-1016.870) -- 0:00:25
596500 -- (-1014.429) [-1013.404] (-1015.403) (-1013.879) * (-1014.904) [-1016.885] (-1014.034) (-1013.543) -- 0:00:25
597000 -- (-1014.429) (-1016.025) [-1013.328] (-1014.068) * (-1013.854) (-1017.675) [-1014.756] (-1014.421) -- 0:00:24
597500 -- (-1013.626) (-1017.436) (-1014.135) [-1014.016] * [-1013.193] (-1015.568) (-1016.085) (-1017.248) -- 0:00:24
598000 -- (-1014.655) (-1016.707) [-1013.545] (-1014.918) * (-1014.743) (-1015.675) [-1015.726] (-1022.691) -- 0:00:24
598500 -- (-1016.376) (-1015.688) [-1013.823] (-1014.648) * [-1018.432] (-1013.416) (-1015.325) (-1017.277) -- 0:00:24
599000 -- (-1016.125) (-1018.540) [-1015.261] (-1020.264) * (-1015.597) [-1014.859] (-1014.608) (-1016.146) -- 0:00:24
599500 -- [-1013.187] (-1015.056) (-1015.073) (-1017.818) * (-1013.815) (-1014.518) (-1015.171) [-1016.888] -- 0:00:25
600000 -- [-1013.038] (-1015.288) (-1015.360) (-1015.719) * (-1018.037) [-1016.480] (-1016.566) (-1014.456) -- 0:00:25
Average standard deviation of split frequencies: 0.008780
600500 -- (-1013.333) (-1013.055) [-1014.429] (-1013.922) * [-1015.509] (-1015.104) (-1014.861) (-1014.845) -- 0:00:25
601000 -- (-1014.624) (-1015.635) (-1014.727) [-1014.340] * [-1013.841] (-1018.464) (-1021.580) (-1016.377) -- 0:00:25
601500 -- (-1013.840) [-1015.525] (-1015.463) (-1017.832) * (-1015.322) (-1018.621) [-1017.904] (-1015.660) -- 0:00:25
602000 -- (-1013.423) [-1013.597] (-1014.983) (-1016.917) * (-1015.617) (-1014.068) [-1017.942] (-1016.003) -- 0:00:25
602500 -- [-1016.634] (-1015.758) (-1015.359) (-1014.743) * (-1014.773) [-1015.995] (-1019.660) (-1013.231) -- 0:00:25
603000 -- (-1015.707) [-1015.792] (-1014.203) (-1014.149) * (-1014.103) (-1015.747) (-1016.358) [-1017.610] -- 0:00:25
603500 -- (-1017.843) [-1014.647] (-1015.732) (-1017.537) * (-1014.033) [-1014.490] (-1014.795) (-1013.502) -- 0:00:24
604000 -- (-1020.004) (-1015.302) [-1014.824] (-1014.824) * (-1013.560) (-1014.467) [-1014.362] (-1014.995) -- 0:00:24
604500 -- (-1016.505) (-1014.054) [-1016.599] (-1014.771) * (-1016.038) (-1016.038) (-1014.618) [-1014.971] -- 0:00:24
605000 -- (-1016.153) (-1025.335) [-1015.645] (-1014.927) * (-1014.635) [-1014.215] (-1013.530) (-1013.249) -- 0:00:24
Average standard deviation of split frequencies: 0.008946
605500 -- (-1021.801) [-1016.125] (-1014.001) (-1013.957) * (-1013.050) (-1015.624) (-1015.058) [-1013.244] -- 0:00:24
606000 -- (-1016.710) [-1018.629] (-1013.500) (-1013.586) * (-1019.994) (-1015.457) (-1013.473) [-1013.792] -- 0:00:24
606500 -- (-1020.567) [-1017.289] (-1015.675) (-1013.602) * (-1014.400) (-1014.940) [-1015.749] (-1014.274) -- 0:00:24
607000 -- (-1015.108) (-1014.199) (-1014.893) [-1013.965] * (-1014.655) [-1013.930] (-1016.648) (-1014.234) -- 0:00:24
607500 -- (-1015.036) (-1014.032) [-1014.751] (-1014.568) * [-1012.908] (-1014.229) (-1020.377) (-1013.374) -- 0:00:24
608000 -- [-1016.263] (-1016.112) (-1018.959) (-1013.518) * (-1016.900) (-1015.688) [-1020.824] (-1013.780) -- 0:00:24
608500 -- [-1015.056] (-1015.062) (-1017.778) (-1014.733) * [-1017.056] (-1015.455) (-1019.907) (-1013.675) -- 0:00:24
609000 -- [-1014.653] (-1014.185) (-1019.193) (-1015.252) * (-1015.476) (-1015.136) [-1017.691] (-1018.520) -- 0:00:24
609500 -- (-1013.909) [-1015.930] (-1018.850) (-1014.736) * [-1015.001] (-1015.697) (-1015.375) (-1018.110) -- 0:00:24
610000 -- (-1017.885) (-1013.112) (-1019.552) [-1015.000] * (-1015.502) (-1013.495) (-1015.934) [-1016.399] -- 0:00:24
Average standard deviation of split frequencies: 0.008684
610500 -- (-1014.012) (-1013.305) (-1013.762) [-1013.867] * (-1015.671) [-1014.459] (-1018.553) (-1016.449) -- 0:00:24
611000 -- (-1014.599) (-1014.965) [-1015.680] (-1018.372) * (-1015.130) [-1013.936] (-1013.653) (-1016.754) -- 0:00:24
611500 -- (-1015.584) (-1015.090) (-1015.270) [-1017.187] * (-1014.533) [-1015.438] (-1019.120) (-1014.473) -- 0:00:24
612000 -- [-1015.406] (-1017.502) (-1013.778) (-1017.488) * (-1013.917) (-1016.555) [-1014.552] (-1014.816) -- 0:00:24
612500 -- (-1014.451) [-1013.452] (-1013.618) (-1015.294) * [-1014.060] (-1016.078) (-1016.487) (-1014.644) -- 0:00:24
613000 -- (-1014.367) (-1013.649) (-1015.233) [-1016.033] * (-1014.285) (-1016.645) (-1016.463) [-1014.342] -- 0:00:24
613500 -- [-1015.496] (-1014.367) (-1014.926) (-1015.634) * (-1014.098) (-1013.466) (-1018.196) [-1016.401] -- 0:00:24
614000 -- (-1015.024) [-1013.083] (-1016.156) (-1016.077) * (-1014.180) (-1015.625) [-1014.277] (-1016.004) -- 0:00:24
614500 -- (-1015.249) (-1014.071) (-1015.678) [-1015.082] * (-1012.996) (-1016.226) [-1016.152] (-1016.881) -- 0:00:24
615000 -- (-1016.223) (-1014.185) [-1013.838] (-1014.490) * [-1015.028] (-1015.259) (-1016.389) (-1022.140) -- 0:00:24
Average standard deviation of split frequencies: 0.008083
615500 -- (-1021.969) [-1014.030] (-1017.124) (-1018.700) * [-1015.607] (-1014.801) (-1021.630) (-1015.408) -- 0:00:24
616000 -- (-1015.420) [-1014.157] (-1015.189) (-1016.716) * (-1014.809) (-1014.825) (-1018.145) [-1016.453] -- 0:00:24
616500 -- (-1015.724) (-1014.555) (-1015.101) [-1016.453] * (-1013.824) (-1015.937) (-1014.906) [-1014.629] -- 0:00:24
617000 -- (-1018.156) [-1014.439] (-1014.422) (-1015.862) * (-1015.152) (-1014.180) [-1014.604] (-1014.689) -- 0:00:24
617500 -- [-1015.857] (-1015.340) (-1017.597) (-1020.047) * (-1017.024) (-1016.428) (-1014.827) [-1013.323] -- 0:00:24
618000 -- (-1016.705) (-1015.454) (-1018.014) [-1018.919] * (-1016.304) (-1016.068) (-1013.749) [-1013.453] -- 0:00:24
618500 -- [-1019.421] (-1016.317) (-1015.708) (-1018.127) * [-1018.597] (-1013.044) (-1015.941) (-1016.439) -- 0:00:24
619000 -- (-1013.461) [-1015.504] (-1013.610) (-1018.569) * (-1013.582) (-1014.405) [-1014.454] (-1016.906) -- 0:00:24
619500 -- [-1013.893] (-1016.496) (-1013.676) (-1015.764) * (-1014.005) (-1015.398) [-1014.074] (-1018.697) -- 0:00:23
620000 -- (-1018.440) (-1015.496) [-1014.183] (-1014.634) * (-1013.076) (-1020.833) (-1014.969) [-1013.263] -- 0:00:23
Average standard deviation of split frequencies: 0.008545
620500 -- (-1018.215) (-1021.238) [-1014.476] (-1014.852) * (-1014.833) (-1016.458) (-1017.805) [-1013.197] -- 0:00:23
621000 -- (-1014.620) (-1015.009) [-1013.472] (-1015.081) * (-1015.922) (-1015.807) (-1014.675) [-1013.590] -- 0:00:23
621500 -- (-1016.494) (-1016.683) (-1013.436) [-1013.376] * (-1013.465) (-1016.822) [-1015.923] (-1013.808) -- 0:00:23
622000 -- (-1016.345) (-1015.963) (-1015.244) [-1014.831] * (-1013.300) (-1014.443) [-1014.287] (-1013.736) -- 0:00:23
622500 -- (-1013.165) (-1015.251) (-1018.475) [-1014.845] * (-1019.599) [-1014.519] (-1014.407) (-1014.633) -- 0:00:23
623000 -- (-1013.164) (-1015.103) [-1016.183] (-1015.297) * (-1013.733) (-1015.152) (-1015.091) [-1014.130] -- 0:00:23
623500 -- (-1014.434) (-1017.336) [-1015.074] (-1015.241) * [-1014.981] (-1014.918) (-1013.913) (-1016.038) -- 0:00:23
624000 -- (-1016.074) [-1018.925] (-1013.800) (-1015.810) * (-1016.499) [-1015.696] (-1013.321) (-1015.510) -- 0:00:23
624500 -- [-1014.388] (-1014.960) (-1013.396) (-1015.276) * (-1014.653) (-1015.589) (-1013.219) [-1012.999] -- 0:00:23
625000 -- (-1012.781) [-1015.891] (-1012.805) (-1017.404) * (-1015.342) (-1014.267) (-1012.961) [-1013.660] -- 0:00:23
Average standard deviation of split frequencies: 0.009081
625500 -- [-1013.034] (-1015.152) (-1016.849) (-1016.084) * (-1013.349) (-1014.029) (-1015.831) [-1014.899] -- 0:00:23
626000 -- (-1016.252) [-1016.000] (-1015.015) (-1016.733) * (-1014.038) (-1014.135) (-1014.322) [-1013.976] -- 0:00:23
626500 -- (-1017.658) (-1013.554) [-1014.981] (-1017.051) * (-1018.007) [-1015.537] (-1016.352) (-1013.611) -- 0:00:23
627000 -- (-1014.737) [-1013.710] (-1012.984) (-1019.380) * (-1017.435) (-1016.834) (-1019.827) [-1015.066] -- 0:00:23
627500 -- (-1013.214) [-1014.987] (-1015.014) (-1014.703) * [-1013.928] (-1019.468) (-1016.136) (-1017.390) -- 0:00:23
628000 -- [-1015.006] (-1014.907) (-1014.411) (-1015.406) * (-1015.563) (-1016.998) [-1021.726] (-1021.726) -- 0:00:23
628500 -- (-1014.867) (-1014.986) (-1013.127) [-1013.262] * [-1015.146] (-1016.119) (-1013.051) (-1013.325) -- 0:00:23
629000 -- (-1013.548) (-1014.416) [-1017.107] (-1014.907) * (-1015.539) (-1016.640) (-1013.358) [-1013.159] -- 0:00:23
629500 -- (-1014.666) (-1014.826) (-1015.155) [-1014.355] * (-1015.878) (-1013.243) [-1015.944] (-1014.337) -- 0:00:23
630000 -- (-1016.065) (-1016.922) [-1016.188] (-1018.027) * (-1018.621) (-1014.090) [-1016.223] (-1012.849) -- 0:00:23
Average standard deviation of split frequencies: 0.009453
630500 -- [-1015.150] (-1014.507) (-1015.903) (-1014.701) * (-1019.001) (-1014.581) [-1017.491] (-1017.184) -- 0:00:23
631000 -- (-1020.134) (-1014.552) [-1016.620] (-1014.061) * (-1015.632) (-1015.621) (-1013.472) [-1017.693] -- 0:00:23
631500 -- (-1014.952) (-1018.507) [-1014.983] (-1015.146) * (-1015.845) (-1014.391) (-1014.010) [-1013.922] -- 0:00:23
632000 -- (-1014.300) (-1021.323) [-1013.802] (-1019.504) * (-1013.954) (-1014.770) [-1014.657] (-1014.868) -- 0:00:23
632500 -- (-1017.631) [-1015.452] (-1016.214) (-1016.939) * [-1013.412] (-1014.220) (-1019.715) (-1020.694) -- 0:00:23
633000 -- (-1018.607) [-1015.327] (-1014.395) (-1014.405) * (-1014.270) (-1013.874) (-1020.266) [-1016.545] -- 0:00:23
633500 -- (-1016.650) (-1015.216) [-1014.431] (-1014.935) * (-1015.350) (-1013.333) [-1013.553] (-1014.336) -- 0:00:23
634000 -- (-1017.414) [-1013.909] (-1015.055) (-1017.339) * (-1015.857) (-1014.888) (-1014.339) [-1013.946] -- 0:00:23
634500 -- (-1016.034) (-1014.268) [-1014.630] (-1017.916) * (-1013.339) (-1014.172) (-1017.831) [-1014.473] -- 0:00:23
635000 -- [-1014.903] (-1014.240) (-1016.669) (-1016.738) * (-1014.760) (-1016.816) (-1014.236) [-1014.724] -- 0:00:22
Average standard deviation of split frequencies: 0.009330
635500 -- [-1015.661] (-1013.904) (-1012.752) (-1015.305) * (-1014.591) (-1017.388) (-1013.936) [-1021.282] -- 0:00:22
636000 -- (-1014.538) [-1014.595] (-1013.533) (-1016.227) * (-1013.378) (-1013.185) (-1017.321) [-1015.488] -- 0:00:22
636500 -- (-1014.427) [-1015.512] (-1013.942) (-1013.973) * (-1013.667) (-1014.285) (-1016.172) [-1015.564] -- 0:00:22
637000 -- (-1019.624) (-1016.197) (-1015.035) [-1016.167] * (-1013.428) [-1014.679] (-1017.918) (-1013.597) -- 0:00:22
637500 -- (-1014.132) (-1015.002) (-1013.870) [-1014.410] * (-1015.957) (-1016.356) (-1016.239) [-1015.415] -- 0:00:22
638000 -- [-1015.259] (-1015.550) (-1013.152) (-1014.727) * (-1016.219) (-1015.562) [-1014.022] (-1015.525) -- 0:00:22
638500 -- (-1013.609) (-1015.666) [-1017.711] (-1017.071) * (-1019.113) (-1015.269) [-1013.116] (-1013.867) -- 0:00:22
639000 -- (-1014.802) (-1015.260) (-1015.614) [-1013.611] * (-1017.025) (-1016.992) (-1017.795) [-1015.139] -- 0:00:22
639500 -- (-1015.813) [-1013.653] (-1017.385) (-1016.587) * (-1018.062) (-1017.848) (-1016.444) [-1016.122] -- 0:00:22
640000 -- (-1015.382) (-1016.240) (-1019.707) [-1016.615] * (-1014.393) (-1018.809) (-1019.762) [-1014.106] -- 0:00:22
Average standard deviation of split frequencies: 0.009089
640500 -- (-1015.478) (-1015.998) (-1017.717) [-1016.617] * [-1014.600] (-1014.664) (-1015.629) (-1013.364) -- 0:00:22
641000 -- (-1014.738) (-1013.663) [-1015.008] (-1021.899) * (-1016.045) [-1016.836] (-1013.693) (-1017.020) -- 0:00:22
641500 -- (-1013.439) [-1013.414] (-1014.983) (-1014.976) * (-1016.839) (-1016.264) [-1015.520] (-1017.558) -- 0:00:22
642000 -- [-1014.846] (-1014.978) (-1013.488) (-1017.524) * (-1014.145) (-1015.631) (-1013.108) [-1016.956] -- 0:00:22
642500 -- (-1016.356) (-1014.643) (-1015.518) [-1017.799] * (-1015.552) (-1015.003) [-1013.126] (-1020.394) -- 0:00:22
643000 -- (-1015.617) (-1014.764) (-1014.618) [-1015.635] * (-1014.254) [-1015.411] (-1013.692) (-1014.732) -- 0:00:22
643500 -- [-1015.617] (-1013.085) (-1015.975) (-1014.098) * (-1013.789) (-1016.671) (-1014.108) [-1014.639] -- 0:00:22
644000 -- (-1015.848) [-1013.994] (-1015.899) (-1017.969) * (-1015.010) [-1016.445] (-1014.700) (-1014.687) -- 0:00:22
644500 -- (-1028.246) [-1015.155] (-1017.077) (-1015.000) * (-1014.198) [-1015.154] (-1020.061) (-1015.603) -- 0:00:22
645000 -- [-1013.228] (-1013.924) (-1015.341) (-1017.210) * (-1014.741) (-1015.132) (-1015.393) [-1013.720] -- 0:00:22
Average standard deviation of split frequencies: 0.009229
645500 -- [-1015.127] (-1013.617) (-1015.533) (-1015.761) * [-1013.185] (-1017.296) (-1015.510) (-1014.225) -- 0:00:22
646000 -- (-1014.848) [-1013.855] (-1015.292) (-1020.061) * (-1019.268) (-1020.535) (-1013.525) [-1013.932] -- 0:00:22
646500 -- [-1015.478] (-1014.340) (-1019.259) (-1019.731) * (-1015.634) (-1015.205) (-1014.953) [-1012.991] -- 0:00:22
647000 -- (-1015.489) (-1015.109) (-1015.164) [-1015.516] * (-1014.934) [-1014.237] (-1015.689) (-1013.780) -- 0:00:22
647500 -- (-1015.433) (-1014.494) (-1015.334) [-1014.050] * [-1013.476] (-1013.863) (-1014.875) (-1016.415) -- 0:00:22
648000 -- (-1013.520) [-1013.829] (-1017.788) (-1014.573) * [-1013.399] (-1015.006) (-1014.381) (-1014.503) -- 0:00:22
648500 -- (-1017.762) (-1021.101) [-1017.363] (-1017.564) * (-1014.746) (-1014.351) (-1021.246) [-1014.158] -- 0:00:22
649000 -- (-1014.359) (-1014.128) [-1014.484] (-1015.054) * (-1015.528) (-1013.064) (-1015.432) [-1014.178] -- 0:00:22
649500 -- (-1014.167) (-1015.004) [-1013.120] (-1014.474) * [-1016.829] (-1014.655) (-1015.505) (-1015.061) -- 0:00:22
650000 -- (-1017.704) (-1015.157) (-1015.124) [-1016.422] * [-1016.072] (-1015.034) (-1017.589) (-1020.983) -- 0:00:22
Average standard deviation of split frequencies: 0.009632
650500 -- (-1018.266) (-1015.352) [-1014.717] (-1017.145) * (-1016.156) (-1014.179) [-1014.263] (-1022.400) -- 0:00:22
651000 -- (-1013.760) (-1014.858) (-1014.340) [-1014.763] * (-1015.575) (-1015.826) (-1015.860) [-1015.158] -- 0:00:21
651500 -- [-1015.411] (-1013.963) (-1019.438) (-1015.530) * (-1016.327) (-1015.520) [-1014.243] (-1014.109) -- 0:00:21
652000 -- (-1013.024) [-1018.825] (-1016.211) (-1014.785) * (-1014.099) (-1016.949) (-1013.521) [-1016.077] -- 0:00:21
652500 -- [-1013.345] (-1017.223) (-1017.204) (-1014.055) * (-1015.889) [-1015.001] (-1015.782) (-1016.629) -- 0:00:21
653000 -- (-1013.952) (-1014.821) [-1015.094] (-1016.510) * (-1017.329) [-1014.111] (-1014.540) (-1017.854) -- 0:00:21
653500 -- [-1016.722] (-1015.691) (-1015.392) (-1015.996) * (-1018.048) [-1014.527] (-1017.732) (-1014.815) -- 0:00:21
654000 -- (-1014.407) (-1016.372) [-1013.837] (-1013.208) * (-1013.878) [-1014.930] (-1014.843) (-1014.561) -- 0:00:21
654500 -- [-1017.608] (-1016.739) (-1014.153) (-1015.037) * (-1017.217) (-1015.235) (-1014.038) [-1014.871] -- 0:00:21
655000 -- [-1014.719] (-1014.812) (-1014.508) (-1015.172) * (-1014.792) (-1014.171) [-1014.206] (-1013.666) -- 0:00:21
Average standard deviation of split frequencies: 0.009469
655500 -- (-1015.699) [-1019.714] (-1013.641) (-1014.613) * (-1013.890) (-1014.336) (-1013.832) [-1015.694] -- 0:00:21
656000 -- (-1015.746) [-1016.357] (-1015.638) (-1015.207) * (-1015.104) (-1015.788) [-1013.381] (-1016.594) -- 0:00:21
656500 -- [-1015.115] (-1013.464) (-1014.353) (-1016.807) * (-1014.774) (-1014.931) (-1016.017) [-1013.104] -- 0:00:21
657000 -- (-1016.362) [-1013.415] (-1014.975) (-1015.679) * (-1014.491) (-1014.196) [-1019.009] (-1013.127) -- 0:00:21
657500 -- (-1015.069) (-1014.303) [-1017.979] (-1015.611) * [-1012.844] (-1018.329) (-1016.637) (-1016.070) -- 0:00:21
658000 -- (-1013.848) (-1015.547) [-1015.533] (-1015.798) * (-1019.147) (-1019.729) [-1016.616] (-1016.985) -- 0:00:21
658500 -- [-1014.223] (-1014.016) (-1015.163) (-1013.667) * (-1016.891) [-1017.869] (-1014.509) (-1016.122) -- 0:00:21
659000 -- (-1013.837) (-1017.896) (-1016.905) [-1013.840] * (-1015.098) [-1014.051] (-1016.112) (-1016.660) -- 0:00:21
659500 -- [-1015.922] (-1013.347) (-1018.126) (-1013.426) * (-1014.157) (-1014.654) (-1018.967) [-1016.777] -- 0:00:21
660000 -- (-1014.180) (-1015.393) (-1017.649) [-1015.650] * [-1015.653] (-1015.383) (-1014.022) (-1014.047) -- 0:00:21
Average standard deviation of split frequencies: 0.010157
660500 -- [-1012.953] (-1016.554) (-1014.124) (-1014.336) * (-1014.482) (-1016.685) [-1012.818] (-1014.740) -- 0:00:21
661000 -- (-1015.194) (-1016.129) (-1015.216) [-1013.250] * (-1012.668) [-1022.092] (-1016.515) (-1013.034) -- 0:00:21
661500 -- (-1019.567) (-1016.373) (-1013.074) [-1015.839] * (-1012.650) [-1018.577] (-1016.276) (-1018.727) -- 0:00:21
662000 -- (-1015.953) (-1016.622) [-1013.262] (-1017.589) * (-1013.138) (-1012.930) (-1014.448) [-1016.034] -- 0:00:21
662500 -- (-1018.200) (-1015.460) [-1014.695] (-1013.645) * (-1018.583) (-1012.813) [-1017.523] (-1015.458) -- 0:00:21
663000 -- (-1015.387) [-1013.256] (-1013.574) (-1017.216) * (-1015.819) [-1014.276] (-1016.410) (-1016.409) -- 0:00:21
663500 -- (-1019.235) (-1017.754) (-1013.664) [-1012.949] * (-1015.042) [-1014.896] (-1017.238) (-1013.105) -- 0:00:21
664000 -- (-1013.464) (-1016.530) [-1015.117] (-1016.343) * [-1015.427] (-1018.522) (-1015.451) (-1013.533) -- 0:00:21
664500 -- (-1014.488) (-1014.897) (-1018.281) [-1013.500] * (-1018.787) [-1013.039] (-1012.942) (-1013.130) -- 0:00:21
665000 -- (-1013.002) (-1019.004) [-1014.502] (-1015.722) * (-1016.784) [-1013.367] (-1013.748) (-1016.121) -- 0:00:21
Average standard deviation of split frequencies: 0.010659
665500 -- (-1014.652) [-1016.179] (-1014.362) (-1015.827) * (-1017.342) (-1013.575) (-1018.571) [-1014.717] -- 0:00:21
666000 -- (-1015.773) [-1015.783] (-1013.035) (-1016.839) * (-1015.132) (-1017.699) [-1020.150] (-1017.114) -- 0:00:21
666500 -- (-1014.803) [-1016.597] (-1015.103) (-1015.722) * [-1015.852] (-1017.486) (-1016.064) (-1020.019) -- 0:00:21
667000 -- [-1013.373] (-1016.170) (-1014.784) (-1015.371) * (-1012.910) [-1014.066] (-1014.351) (-1017.008) -- 0:00:20
667500 -- (-1015.488) (-1014.355) (-1016.444) [-1014.322] * [-1013.948] (-1013.748) (-1013.969) (-1015.376) -- 0:00:20
668000 -- (-1013.176) [-1013.716] (-1013.437) (-1014.145) * (-1017.391) (-1015.071) [-1016.771] (-1016.642) -- 0:00:20
668500 -- (-1013.156) [-1015.291] (-1013.057) (-1015.250) * (-1014.129) (-1013.160) [-1015.829] (-1019.110) -- 0:00:20
669000 -- [-1014.435] (-1012.972) (-1015.635) (-1015.195) * (-1013.590) [-1014.433] (-1013.313) (-1017.031) -- 0:00:20
669500 -- (-1017.391) (-1012.907) [-1013.469] (-1013.931) * (-1014.240) (-1015.230) (-1013.574) [-1017.816] -- 0:00:20
670000 -- (-1012.884) (-1016.210) [-1017.626] (-1014.075) * (-1015.890) (-1016.757) [-1014.252] (-1015.947) -- 0:00:20
Average standard deviation of split frequencies: 0.010047
670500 -- [-1015.471] (-1017.242) (-1014.346) (-1013.438) * (-1014.415) [-1013.308] (-1014.637) (-1014.812) -- 0:00:20
671000 -- [-1015.295] (-1017.352) (-1013.483) (-1013.085) * (-1014.866) [-1014.143] (-1016.374) (-1014.294) -- 0:00:20
671500 -- (-1015.859) (-1017.382) [-1017.097] (-1013.389) * (-1016.091) (-1019.395) (-1014.540) [-1014.970] -- 0:00:20
672000 -- (-1013.997) (-1017.556) [-1018.248] (-1020.572) * (-1017.149) (-1015.818) [-1014.581] (-1015.295) -- 0:00:20
672500 -- (-1014.346) (-1013.258) [-1014.895] (-1021.570) * (-1014.755) (-1016.888) [-1015.523] (-1016.002) -- 0:00:20
673000 -- [-1014.231] (-1014.632) (-1015.133) (-1014.492) * [-1015.198] (-1014.872) (-1014.264) (-1013.136) -- 0:00:20
673500 -- (-1013.739) (-1015.766) [-1014.699] (-1014.039) * (-1015.646) (-1015.018) (-1014.842) [-1014.997] -- 0:00:20
674000 -- (-1015.164) (-1017.810) [-1014.860] (-1013.470) * [-1016.085] (-1017.798) (-1014.433) (-1014.720) -- 0:00:20
674500 -- (-1021.280) (-1014.671) [-1013.320] (-1015.720) * (-1016.470) (-1015.300) [-1014.280] (-1015.972) -- 0:00:20
675000 -- (-1013.060) (-1018.200) [-1015.233] (-1019.167) * (-1015.251) (-1018.484) (-1013.935) [-1015.447] -- 0:00:20
Average standard deviation of split frequencies: 0.009599
675500 -- (-1013.167) [-1014.302] (-1015.613) (-1017.996) * [-1014.019] (-1014.474) (-1014.385) (-1014.840) -- 0:00:20
676000 -- (-1014.664) (-1017.511) [-1013.392] (-1015.230) * (-1013.751) (-1015.174) (-1014.432) [-1015.506] -- 0:00:20
676500 -- (-1015.914) [-1013.552] (-1013.394) (-1015.381) * (-1013.258) (-1014.414) (-1020.459) [-1014.307] -- 0:00:20
677000 -- [-1014.864] (-1014.188) (-1013.035) (-1014.118) * (-1016.015) (-1015.446) (-1018.345) [-1015.820] -- 0:00:20
677500 -- [-1015.494] (-1015.991) (-1013.098) (-1014.666) * (-1013.495) [-1015.499] (-1018.858) (-1015.911) -- 0:00:20
678000 -- (-1014.324) (-1014.915) [-1012.944] (-1024.482) * (-1013.532) (-1014.074) [-1013.788] (-1015.475) -- 0:00:20
678500 -- (-1014.249) (-1017.625) (-1013.875) [-1016.348] * [-1015.897] (-1017.068) (-1018.797) (-1014.357) -- 0:00:20
679000 -- (-1017.513) (-1014.050) [-1016.870] (-1013.805) * (-1015.532) (-1014.669) [-1015.072] (-1013.974) -- 0:00:20
679500 -- (-1013.526) (-1018.209) (-1015.281) [-1013.853] * [-1016.441] (-1015.236) (-1015.019) (-1014.418) -- 0:00:20
680000 -- (-1014.358) (-1016.738) (-1018.420) [-1015.384] * (-1015.757) (-1014.773) [-1015.753] (-1014.441) -- 0:00:20
Average standard deviation of split frequencies: 0.007572
680500 -- [-1017.336] (-1014.758) (-1017.771) (-1017.363) * (-1015.428) [-1015.728] (-1014.111) (-1015.877) -- 0:00:20
681000 -- (-1013.479) (-1015.246) (-1014.892) [-1014.520] * (-1013.885) (-1015.606) (-1018.011) [-1013.867] -- 0:00:20
681500 -- (-1014.636) (-1014.664) (-1015.982) [-1013.051] * (-1013.351) (-1014.813) (-1014.212) [-1017.725] -- 0:00:20
682000 -- [-1015.324] (-1013.688) (-1015.624) (-1016.584) * (-1017.071) (-1016.055) [-1017.282] (-1016.879) -- 0:00:20
682500 -- (-1013.407) [-1015.780] (-1016.026) (-1017.190) * (-1017.387) [-1014.333] (-1015.223) (-1014.111) -- 0:00:20
683000 -- (-1013.147) [-1018.633] (-1013.044) (-1018.967) * [-1014.256] (-1014.823) (-1018.942) (-1014.012) -- 0:00:19
683500 -- [-1013.507] (-1017.386) (-1013.731) (-1015.132) * (-1014.177) [-1015.547] (-1018.360) (-1014.082) -- 0:00:19
684000 -- [-1014.840] (-1018.427) (-1014.446) (-1014.810) * [-1014.515] (-1013.950) (-1014.784) (-1015.521) -- 0:00:19
684500 -- (-1014.913) [-1013.875] (-1015.727) (-1014.364) * (-1014.314) (-1016.907) (-1014.235) [-1013.091] -- 0:00:19
685000 -- (-1014.169) (-1016.351) [-1015.627] (-1014.205) * [-1013.798] (-1017.188) (-1013.606) (-1017.810) -- 0:00:19
Average standard deviation of split frequencies: 0.008461
685500 -- [-1013.502] (-1013.448) (-1015.452) (-1013.975) * (-1018.051) (-1016.486) (-1013.919) [-1013.757] -- 0:00:19
686000 -- (-1014.096) [-1015.106] (-1016.514) (-1016.830) * (-1018.113) (-1016.617) (-1014.040) [-1013.803] -- 0:00:19
686500 -- (-1015.781) [-1015.350] (-1017.336) (-1014.833) * (-1017.179) (-1013.767) (-1013.313) [-1014.969] -- 0:00:19
687000 -- (-1015.024) (-1014.753) [-1013.527] (-1012.966) * (-1014.508) [-1014.025] (-1014.184) (-1012.875) -- 0:00:19
687500 -- (-1017.949) (-1015.656) (-1013.137) [-1012.812] * (-1013.776) [-1015.878] (-1014.386) (-1016.960) -- 0:00:19
688000 -- (-1015.192) (-1013.022) (-1015.648) [-1013.591] * (-1014.287) [-1017.259] (-1014.831) (-1013.686) -- 0:00:19
688500 -- [-1012.887] (-1013.105) (-1015.614) (-1014.404) * [-1015.488] (-1015.857) (-1014.910) (-1017.928) -- 0:00:19
689000 -- (-1013.096) (-1014.691) [-1015.230] (-1013.264) * [-1013.727] (-1018.719) (-1013.792) (-1020.013) -- 0:00:19
689500 -- (-1014.230) (-1014.977) (-1013.578) [-1013.921] * (-1013.678) (-1018.084) [-1014.083] (-1017.800) -- 0:00:19
690000 -- [-1014.738] (-1015.100) (-1017.244) (-1014.160) * [-1016.449] (-1017.501) (-1015.570) (-1015.512) -- 0:00:19
Average standard deviation of split frequencies: 0.007593
690500 -- (-1014.876) (-1013.938) [-1014.342] (-1016.942) * (-1017.602) (-1014.399) (-1019.008) [-1014.389] -- 0:00:19
691000 -- [-1013.632] (-1015.882) (-1014.261) (-1017.043) * (-1015.276) [-1016.842] (-1014.218) (-1013.929) -- 0:00:19
691500 -- (-1013.191) [-1014.352] (-1015.925) (-1017.683) * (-1015.700) (-1014.160) [-1015.159] (-1017.782) -- 0:00:19
692000 -- (-1013.778) (-1015.196) [-1015.094] (-1014.660) * (-1015.231) (-1013.601) [-1014.140] (-1015.290) -- 0:00:19
692500 -- (-1013.736) (-1020.007) (-1018.258) [-1014.477] * (-1013.087) [-1014.718] (-1018.108) (-1014.595) -- 0:00:19
693000 -- [-1017.267] (-1020.744) (-1014.990) (-1016.420) * (-1016.313) (-1014.801) (-1017.716) [-1012.942] -- 0:00:19
693500 -- [-1018.690] (-1016.325) (-1015.368) (-1016.045) * [-1014.922] (-1013.630) (-1013.834) (-1012.990) -- 0:00:19
694000 -- [-1016.266] (-1015.253) (-1013.152) (-1017.285) * [-1015.237] (-1012.929) (-1013.233) (-1015.582) -- 0:00:19
694500 -- (-1013.458) (-1013.963) [-1013.245] (-1015.459) * [-1015.237] (-1012.929) (-1015.785) (-1013.255) -- 0:00:19
695000 -- (-1015.115) [-1016.553] (-1014.763) (-1015.424) * (-1015.297) (-1015.395) (-1014.806) [-1017.300] -- 0:00:19
Average standard deviation of split frequencies: 0.007620
695500 -- (-1014.753) [-1013.137] (-1014.216) (-1015.745) * (-1014.504) [-1015.544] (-1013.163) (-1016.111) -- 0:00:19
696000 -- (-1014.778) (-1016.463) (-1018.297) [-1012.838] * (-1014.082) [-1014.890] (-1014.529) (-1019.514) -- 0:00:19
696500 -- (-1016.165) (-1016.263) [-1016.051] (-1014.612) * (-1013.336) [-1014.739] (-1015.983) (-1014.258) -- 0:00:19
697000 -- (-1018.317) [-1018.933] (-1017.671) (-1014.627) * [-1013.875] (-1017.858) (-1014.915) (-1014.369) -- 0:00:19
697500 -- (-1014.502) [-1015.394] (-1020.549) (-1014.215) * (-1017.787) [-1014.281] (-1014.124) (-1014.304) -- 0:00:19
698000 -- (-1014.169) (-1013.583) (-1017.072) [-1016.788] * (-1015.973) (-1013.241) (-1014.472) [-1016.625] -- 0:00:19
698500 -- (-1014.776) (-1016.246) [-1017.780] (-1015.096) * (-1014.793) [-1017.073] (-1014.316) (-1017.642) -- 0:00:18
699000 -- (-1015.961) (-1015.813) (-1015.480) [-1014.077] * (-1013.826) (-1013.741) (-1016.141) [-1014.419] -- 0:00:18
699500 -- [-1013.448] (-1016.037) (-1015.429) (-1018.108) * (-1014.426) (-1012.985) [-1013.492] (-1013.936) -- 0:00:18
700000 -- (-1016.302) [-1015.463] (-1017.337) (-1018.054) * (-1013.336) (-1014.328) [-1013.698] (-1016.082) -- 0:00:18
Average standard deviation of split frequencies: 0.007527
700500 -- (-1015.421) (-1014.733) (-1014.757) [-1014.992] * (-1017.672) (-1014.985) [-1013.104] (-1016.006) -- 0:00:18
701000 -- [-1014.035] (-1014.354) (-1018.439) (-1016.581) * (-1019.295) (-1015.330) [-1014.723] (-1013.402) -- 0:00:18
701500 -- (-1014.024) (-1013.983) (-1020.497) [-1015.826] * (-1015.763) [-1014.718] (-1014.476) (-1017.567) -- 0:00:18
702000 -- (-1014.018) (-1014.385) [-1015.761] (-1015.866) * (-1013.950) (-1015.118) (-1016.257) [-1015.837] -- 0:00:18
702500 -- (-1013.671) [-1014.652] (-1015.172) (-1015.765) * (-1013.335) (-1012.989) [-1016.158] (-1014.685) -- 0:00:18
703000 -- [-1016.389] (-1014.536) (-1015.265) (-1015.719) * (-1014.015) (-1017.225) (-1015.251) [-1013.282] -- 0:00:18
703500 -- [-1014.971] (-1014.408) (-1014.362) (-1015.226) * (-1016.025) [-1017.338] (-1016.659) (-1020.823) -- 0:00:18
704000 -- [-1014.076] (-1016.641) (-1015.147) (-1014.826) * (-1014.314) (-1014.118) [-1018.794] (-1014.118) -- 0:00:18
704500 -- [-1015.576] (-1014.588) (-1015.356) (-1014.538) * (-1016.128) [-1013.904] (-1017.497) (-1013.301) -- 0:00:18
705000 -- [-1014.814] (-1014.414) (-1018.781) (-1014.214) * (-1014.925) (-1015.030) (-1014.132) [-1013.809] -- 0:00:18
Average standard deviation of split frequencies: 0.007261
705500 -- [-1014.216] (-1018.778) (-1017.230) (-1013.998) * (-1014.423) (-1014.774) (-1015.883) [-1020.107] -- 0:00:18
706000 -- [-1015.004] (-1015.300) (-1014.209) (-1015.582) * (-1016.409) (-1015.674) [-1015.197] (-1016.435) -- 0:00:18
706500 -- [-1015.617] (-1016.178) (-1014.382) (-1019.034) * [-1016.730] (-1014.900) (-1015.653) (-1015.425) -- 0:00:18
707000 -- (-1013.751) [-1013.617] (-1018.823) (-1016.032) * (-1017.929) (-1014.745) (-1014.219) [-1013.276] -- 0:00:18
707500 -- (-1015.530) (-1012.817) (-1014.975) [-1018.966] * (-1014.381) [-1013.158] (-1013.692) (-1013.752) -- 0:00:18
708000 -- (-1013.952) (-1014.908) (-1013.313) [-1014.635] * [-1013.939] (-1016.098) (-1013.670) (-1014.230) -- 0:00:18
708500 -- (-1013.475) [-1016.336] (-1013.419) (-1014.470) * [-1015.432] (-1016.513) (-1014.698) (-1015.032) -- 0:00:18
709000 -- (-1014.389) [-1014.889] (-1015.300) (-1016.434) * (-1014.610) (-1019.232) (-1016.783) [-1014.245] -- 0:00:18
709500 -- (-1015.671) (-1017.909) [-1013.333] (-1014.371) * [-1014.150] (-1015.175) (-1015.928) (-1014.268) -- 0:00:18
710000 -- (-1014.919) [-1019.094] (-1014.767) (-1013.818) * (-1014.786) (-1016.857) (-1015.300) [-1013.538] -- 0:00:18
Average standard deviation of split frequencies: 0.007338
710500 -- (-1015.935) (-1019.013) (-1017.657) [-1015.801] * (-1014.585) [-1013.973] (-1013.335) (-1015.685) -- 0:00:18
711000 -- (-1016.644) (-1021.899) (-1016.404) [-1013.808] * (-1016.607) [-1013.369] (-1013.167) (-1016.982) -- 0:00:18
711500 -- (-1019.002) [-1015.585] (-1014.654) (-1016.351) * (-1014.011) (-1016.329) [-1016.177] (-1016.581) -- 0:00:18
712000 -- [-1016.070] (-1018.924) (-1014.498) (-1015.239) * (-1015.042) (-1015.014) [-1013.918] (-1015.438) -- 0:00:18
712500 -- [-1016.395] (-1015.485) (-1014.399) (-1014.367) * (-1012.944) [-1016.238] (-1013.212) (-1017.776) -- 0:00:18
713000 -- (-1017.179) [-1016.258] (-1014.249) (-1016.219) * (-1015.234) [-1013.557] (-1013.360) (-1017.208) -- 0:00:18
713500 -- (-1017.106) (-1014.150) [-1015.829] (-1014.953) * (-1015.935) [-1013.889] (-1014.092) (-1017.074) -- 0:00:18
714000 -- [-1016.160] (-1014.764) (-1015.888) (-1021.396) * (-1015.634) (-1013.812) [-1013.142] (-1018.955) -- 0:00:18
714500 -- (-1016.220) (-1016.266) [-1013.823] (-1015.024) * [-1016.414] (-1016.280) (-1014.136) (-1015.567) -- 0:00:17
715000 -- (-1013.548) (-1014.680) [-1014.202] (-1014.854) * (-1017.476) [-1013.502] (-1014.273) (-1014.570) -- 0:00:17
Average standard deviation of split frequencies: 0.007078
715500 -- [-1016.842] (-1014.447) (-1015.514) (-1015.568) * (-1015.841) (-1014.679) [-1013.258] (-1017.969) -- 0:00:17
716000 -- [-1016.030] (-1013.728) (-1017.104) (-1015.276) * [-1014.226] (-1023.125) (-1013.918) (-1012.889) -- 0:00:17
716500 -- [-1014.636] (-1013.150) (-1019.178) (-1014.291) * (-1013.350) (-1017.301) (-1019.267) [-1014.050] -- 0:00:17
717000 -- (-1014.045) [-1016.271] (-1013.159) (-1014.476) * (-1015.588) [-1015.750] (-1015.971) (-1014.951) -- 0:00:17
717500 -- (-1014.405) (-1015.446) [-1014.024] (-1014.781) * (-1014.866) [-1015.302] (-1015.888) (-1015.220) -- 0:00:17
718000 -- (-1017.917) (-1015.098) (-1013.385) [-1012.889] * [-1013.463] (-1013.362) (-1018.812) (-1015.888) -- 0:00:17
718500 -- (-1015.656) (-1017.153) (-1013.361) [-1013.400] * (-1018.885) (-1015.191) (-1014.966) [-1013.825] -- 0:00:17
719000 -- (-1015.369) (-1013.257) [-1013.245] (-1012.907) * (-1014.490) [-1015.466] (-1018.363) (-1014.462) -- 0:00:17
719500 -- [-1014.441] (-1017.545) (-1018.248) (-1014.735) * (-1014.369) (-1014.711) [-1016.764] (-1013.853) -- 0:00:17
720000 -- (-1015.440) (-1013.756) [-1017.104] (-1014.907) * (-1016.136) [-1014.837] (-1018.809) (-1014.455) -- 0:00:17
Average standard deviation of split frequencies: 0.005843
720500 -- (-1013.236) (-1014.705) (-1014.882) [-1014.540] * (-1013.558) [-1014.914] (-1014.686) (-1014.504) -- 0:00:17
721000 -- (-1013.750) (-1015.587) [-1019.205] (-1014.636) * (-1013.304) [-1015.579] (-1015.278) (-1016.720) -- 0:00:17
721500 -- (-1014.386) [-1013.712] (-1016.678) (-1014.116) * (-1014.097) (-1013.926) [-1016.174] (-1017.001) -- 0:00:17
722000 -- (-1013.964) (-1015.340) (-1016.800) [-1013.652] * (-1017.244) (-1016.215) [-1016.034] (-1015.573) -- 0:00:17
722500 -- [-1014.843] (-1018.306) (-1016.318) (-1016.971) * (-1015.578) [-1015.377] (-1016.033) (-1018.583) -- 0:00:17
723000 -- (-1015.989) (-1015.968) [-1015.154] (-1014.698) * (-1016.782) (-1018.055) [-1017.044] (-1015.125) -- 0:00:17
723500 -- (-1013.478) [-1014.134] (-1017.639) (-1015.190) * (-1016.521) (-1019.239) (-1017.254) [-1016.615] -- 0:00:17
724000 -- (-1013.968) (-1014.744) (-1013.491) [-1013.754] * (-1021.504) (-1016.858) (-1015.588) [-1013.547] -- 0:00:17
724500 -- (-1014.337) (-1014.525) (-1020.851) [-1015.068] * (-1016.208) (-1013.801) (-1016.771) [-1013.351] -- 0:00:17
725000 -- [-1014.684] (-1013.862) (-1018.661) (-1015.527) * [-1013.927] (-1013.637) (-1013.617) (-1014.185) -- 0:00:17
Average standard deviation of split frequencies: 0.006017
725500 -- [-1018.858] (-1016.462) (-1014.959) (-1014.872) * [-1014.414] (-1016.887) (-1015.588) (-1014.889) -- 0:00:17
726000 -- [-1015.158] (-1014.615) (-1013.385) (-1014.886) * (-1014.706) (-1016.420) (-1015.128) [-1014.403] -- 0:00:17
726500 -- [-1013.905] (-1015.910) (-1014.654) (-1013.996) * (-1017.016) (-1014.699) [-1013.443] (-1013.723) -- 0:00:17
727000 -- (-1013.539) [-1015.136] (-1014.575) (-1021.100) * (-1014.760) (-1013.146) [-1013.825] (-1016.023) -- 0:00:17
727500 -- (-1016.753) (-1017.930) [-1013.824] (-1019.518) * (-1015.561) (-1014.510) [-1013.723] (-1017.562) -- 0:00:17
728000 -- [-1015.033] (-1014.001) (-1014.671) (-1014.886) * (-1014.692) (-1017.053) [-1017.787] (-1016.977) -- 0:00:17
728500 -- (-1015.844) (-1014.728) (-1014.115) [-1014.297] * (-1014.920) [-1022.869] (-1019.072) (-1014.004) -- 0:00:17
729000 -- (-1018.016) [-1015.255] (-1014.283) (-1018.235) * (-1014.131) (-1022.680) [-1013.001] (-1014.093) -- 0:00:17
729500 -- (-1012.891) (-1019.447) [-1012.893] (-1014.780) * [-1016.973] (-1015.107) (-1014.673) (-1015.601) -- 0:00:17
730000 -- (-1014.630) (-1015.701) (-1015.453) [-1014.133] * [-1014.067] (-1017.418) (-1013.461) (-1016.018) -- 0:00:17
Average standard deviation of split frequencies: 0.006194
730500 -- (-1013.824) [-1015.020] (-1017.148) (-1017.875) * (-1013.157) (-1016.262) [-1012.656] (-1015.847) -- 0:00:16
731000 -- (-1017.250) [-1014.933] (-1018.340) (-1019.125) * (-1015.195) (-1015.291) (-1014.805) [-1016.619] -- 0:00:16
731500 -- (-1015.649) [-1015.013] (-1015.525) (-1015.649) * (-1014.064) (-1015.843) (-1017.415) [-1015.253] -- 0:00:16
732000 -- [-1015.583] (-1019.417) (-1015.572) (-1013.658) * (-1012.883) (-1016.337) [-1013.788] (-1013.788) -- 0:00:16
732500 -- [-1014.035] (-1015.980) (-1016.975) (-1015.850) * (-1013.425) (-1014.201) [-1015.149] (-1017.783) -- 0:00:16
733000 -- (-1016.272) (-1013.817) [-1013.459] (-1015.731) * [-1017.160] (-1013.852) (-1014.580) (-1016.635) -- 0:00:16
733500 -- (-1013.728) (-1013.837) [-1017.661] (-1013.859) * (-1012.942) (-1018.444) [-1017.134] (-1018.885) -- 0:00:16
734000 -- (-1016.390) (-1013.567) [-1015.669] (-1016.263) * (-1016.727) [-1014.102] (-1014.551) (-1017.803) -- 0:00:16
734500 -- (-1016.310) (-1014.800) (-1017.705) [-1014.248] * [-1013.422] (-1015.164) (-1014.002) (-1017.706) -- 0:00:16
735000 -- (-1016.331) [-1013.758] (-1017.228) (-1019.946) * (-1014.334) [-1015.466] (-1014.097) (-1015.700) -- 0:00:16
Average standard deviation of split frequencies: 0.005764
735500 -- (-1016.192) (-1013.190) (-1014.790) [-1015.000] * (-1016.206) (-1016.031) (-1015.034) [-1014.613] -- 0:00:16
736000 -- (-1013.971) (-1014.620) (-1016.742) [-1016.050] * (-1018.444) (-1013.851) (-1015.999) [-1014.147] -- 0:00:16
736500 -- (-1014.873) [-1013.974] (-1014.759) (-1015.717) * (-1013.454) (-1013.742) [-1019.456] (-1014.583) -- 0:00:16
737000 -- (-1015.350) (-1014.945) [-1016.572] (-1021.226) * [-1013.844] (-1016.256) (-1020.158) (-1012.935) -- 0:00:16
737500 -- (-1014.358) (-1017.114) (-1017.757) [-1016.647] * (-1013.872) (-1013.896) (-1015.681) [-1013.328] -- 0:00:16
738000 -- (-1020.839) [-1021.578] (-1017.683) (-1014.366) * [-1013.814] (-1015.400) (-1015.889) (-1014.620) -- 0:00:16
738500 -- (-1016.300) (-1015.611) (-1014.361) [-1013.153] * (-1013.229) (-1019.000) [-1016.407] (-1015.615) -- 0:00:16
739000 -- (-1013.065) [-1016.533] (-1014.695) (-1014.961) * (-1017.666) (-1018.020) (-1015.939) [-1018.149] -- 0:00:16
739500 -- (-1020.590) (-1015.564) (-1013.396) [-1013.176] * (-1016.977) [-1013.804] (-1018.459) (-1021.887) -- 0:00:16
740000 -- (-1014.850) (-1016.598) (-1013.113) [-1013.176] * (-1018.598) [-1014.111] (-1017.717) (-1017.608) -- 0:00:16
Average standard deviation of split frequencies: 0.005940
740500 -- [-1014.411] (-1018.447) (-1014.196) (-1014.491) * (-1019.121) [-1013.902] (-1014.501) (-1014.142) -- 0:00:16
741000 -- (-1018.881) [-1014.282] (-1014.265) (-1014.769) * (-1019.089) [-1015.967] (-1015.951) (-1016.382) -- 0:00:16
741500 -- (-1017.313) (-1016.537) [-1013.281] (-1015.637) * (-1014.231) (-1015.292) (-1017.161) [-1018.101] -- 0:00:16
742000 -- (-1017.631) (-1015.109) (-1014.533) [-1014.070] * (-1016.611) [-1016.283] (-1017.426) (-1020.511) -- 0:00:16
742500 -- [-1016.635] (-1015.506) (-1019.485) (-1019.351) * [-1016.584] (-1014.013) (-1018.068) (-1024.204) -- 0:00:16
743000 -- (-1017.152) (-1014.185) (-1014.702) [-1014.299] * (-1017.926) (-1015.841) (-1019.545) [-1013.617] -- 0:00:16
743500 -- (-1016.261) (-1013.454) (-1012.921) [-1014.187] * (-1018.268) (-1013.733) [-1014.426] (-1014.258) -- 0:00:16
744000 -- (-1015.906) (-1012.932) [-1014.535] (-1015.913) * (-1016.959) [-1013.650] (-1017.932) (-1014.276) -- 0:00:16
744500 -- (-1014.955) (-1014.701) (-1014.581) [-1014.160] * [-1016.393] (-1017.999) (-1023.553) (-1014.427) -- 0:00:16
745000 -- (-1013.056) (-1017.728) (-1015.952) [-1013.583] * [-1015.274] (-1017.128) (-1027.744) (-1013.132) -- 0:00:16
Average standard deviation of split frequencies: 0.005729
745500 -- [-1014.197] (-1013.914) (-1014.721) (-1015.481) * [-1013.991] (-1014.475) (-1023.622) (-1013.992) -- 0:00:16
746000 -- (-1013.695) [-1013.601] (-1014.033) (-1016.048) * (-1015.288) (-1016.849) (-1022.921) [-1013.620] -- 0:00:16
746500 -- (-1013.996) (-1015.444) [-1013.614] (-1017.504) * (-1015.434) (-1017.955) (-1023.843) [-1015.794] -- 0:00:15
747000 -- (-1014.324) [-1015.201] (-1013.599) (-1013.954) * [-1017.146] (-1019.298) (-1020.894) (-1016.007) -- 0:00:15
747500 -- (-1013.649) [-1021.721] (-1013.647) (-1016.243) * [-1017.436] (-1017.036) (-1018.079) (-1017.016) -- 0:00:15
748000 -- (-1013.844) [-1016.993] (-1013.753) (-1016.148) * (-1016.804) (-1015.136) [-1018.119] (-1017.210) -- 0:00:15
748500 -- (-1014.120) (-1015.163) (-1014.703) [-1019.140] * (-1015.362) (-1015.989) [-1014.725] (-1014.803) -- 0:00:15
749000 -- (-1015.215) (-1013.941) [-1014.925] (-1016.655) * [-1013.046] (-1014.700) (-1018.095) (-1015.384) -- 0:00:15
749500 -- (-1015.148) (-1015.678) [-1016.060] (-1014.069) * [-1014.728] (-1018.789) (-1018.397) (-1014.296) -- 0:00:15
750000 -- (-1014.692) [-1014.783] (-1016.191) (-1013.420) * (-1014.541) (-1018.177) (-1014.133) [-1014.686] -- 0:00:15
Average standard deviation of split frequencies: 0.005987
750500 -- [-1014.733] (-1015.050) (-1013.265) (-1014.939) * (-1014.537) (-1015.607) [-1019.384] (-1015.002) -- 0:00:15
751000 -- (-1013.045) (-1016.291) (-1013.777) [-1018.497] * (-1014.751) (-1015.654) [-1016.929] (-1014.853) -- 0:00:15
751500 -- (-1013.893) [-1016.251] (-1014.140) (-1014.611) * (-1014.341) (-1017.106) (-1016.382) [-1015.639] -- 0:00:15
752000 -- (-1013.723) (-1015.209) (-1013.216) [-1017.341] * (-1013.479) (-1018.050) (-1012.887) [-1017.578] -- 0:00:15
752500 -- (-1015.889) [-1015.161] (-1014.273) (-1014.149) * (-1015.901) [-1020.229] (-1016.230) (-1016.125) -- 0:00:15
753000 -- (-1015.703) [-1015.489] (-1018.907) (-1014.561) * (-1014.534) (-1015.446) (-1015.221) [-1014.678] -- 0:00:15
753500 -- (-1014.348) (-1014.639) [-1013.379] (-1015.743) * [-1014.569] (-1016.632) (-1013.574) (-1013.993) -- 0:00:15
754000 -- (-1016.303) [-1013.577] (-1016.522) (-1014.411) * (-1014.259) (-1014.174) [-1013.741] (-1013.687) -- 0:00:15
754500 -- (-1015.547) (-1013.219) (-1013.327) [-1017.081] * (-1016.335) [-1014.776] (-1016.041) (-1013.809) -- 0:00:15
755000 -- (-1015.398) [-1014.678] (-1014.989) (-1015.516) * (-1013.195) [-1015.949] (-1014.160) (-1016.709) -- 0:00:15
Average standard deviation of split frequencies: 0.006069
755500 -- (-1014.738) [-1013.330] (-1013.768) (-1017.553) * [-1013.912] (-1014.899) (-1016.316) (-1015.255) -- 0:00:15
756000 -- (-1016.104) [-1014.817] (-1013.612) (-1013.317) * (-1015.157) (-1031.440) [-1015.185] (-1023.553) -- 0:00:15
756500 -- (-1015.852) (-1016.599) (-1013.718) [-1014.752] * (-1014.727) (-1014.568) [-1015.787] (-1015.544) -- 0:00:15
757000 -- (-1016.144) [-1013.176] (-1019.115) (-1014.087) * [-1014.517] (-1013.497) (-1017.691) (-1014.163) -- 0:00:15
757500 -- [-1015.232] (-1015.615) (-1015.786) (-1013.974) * (-1013.472) (-1017.949) (-1014.854) [-1014.332] -- 0:00:15
758000 -- (-1015.786) (-1017.763) [-1015.480] (-1015.844) * (-1018.192) (-1016.382) [-1017.225] (-1015.776) -- 0:00:15
758500 -- [-1015.027] (-1018.392) (-1014.989) (-1013.629) * (-1015.438) (-1014.646) [-1015.772] (-1014.219) -- 0:00:15
759000 -- (-1016.403) [-1015.747] (-1019.692) (-1013.529) * (-1016.101) [-1014.599] (-1013.550) (-1014.901) -- 0:00:15
759500 -- (-1014.344) [-1014.132] (-1014.673) (-1017.408) * [-1015.718] (-1014.954) (-1013.910) (-1017.773) -- 0:00:15
760000 -- [-1013.425] (-1015.408) (-1015.179) (-1013.515) * (-1015.172) (-1014.970) (-1013.424) [-1016.176] -- 0:00:15
Average standard deviation of split frequencies: 0.006280
760500 -- (-1015.318) (-1013.793) (-1014.642) [-1013.984] * [-1013.284] (-1015.940) (-1012.847) (-1018.510) -- 0:00:15
761000 -- (-1013.785) [-1015.867] (-1014.598) (-1013.868) * (-1014.040) [-1015.799] (-1015.832) (-1015.110) -- 0:00:15
761500 -- (-1014.119) (-1019.990) (-1015.933) [-1013.090] * [-1014.145] (-1015.345) (-1016.008) (-1015.662) -- 0:00:15
762000 -- [-1013.939] (-1016.933) (-1015.835) (-1013.824) * (-1019.407) [-1013.590] (-1012.812) (-1015.061) -- 0:00:14
762500 -- [-1016.195] (-1015.089) (-1018.870) (-1013.285) * (-1015.898) (-1014.130) [-1012.990] (-1013.198) -- 0:00:14
763000 -- [-1017.260] (-1014.714) (-1013.624) (-1016.100) * (-1017.703) (-1014.623) (-1015.959) [-1014.688] -- 0:00:14
763500 -- (-1014.859) (-1016.227) (-1013.892) [-1016.061] * (-1014.422) (-1014.068) [-1013.578] (-1015.029) -- 0:00:14
764000 -- [-1012.631] (-1016.688) (-1013.364) (-1016.922) * [-1014.606] (-1014.934) (-1016.505) (-1015.436) -- 0:00:14
764500 -- [-1017.122] (-1015.725) (-1014.263) (-1018.128) * (-1014.283) (-1015.047) (-1015.924) [-1014.100] -- 0:00:14
765000 -- (-1013.299) (-1019.864) (-1016.585) [-1014.624] * (-1013.881) (-1014.002) [-1014.521] (-1015.366) -- 0:00:14
Average standard deviation of split frequencies: 0.007154
765500 -- [-1014.733] (-1014.577) (-1015.508) (-1015.613) * [-1014.084] (-1016.919) (-1015.411) (-1017.812) -- 0:00:14
766000 -- (-1013.294) (-1015.338) (-1017.533) [-1014.379] * [-1016.593] (-1014.711) (-1014.945) (-1015.363) -- 0:00:14
766500 -- (-1012.811) [-1014.792] (-1013.738) (-1012.791) * [-1016.529] (-1016.121) (-1015.214) (-1013.790) -- 0:00:14
767000 -- (-1015.004) (-1015.224) (-1013.702) [-1012.874] * [-1015.095] (-1014.626) (-1013.433) (-1015.651) -- 0:00:14
767500 -- (-1015.866) (-1019.081) [-1019.189] (-1018.225) * [-1015.463] (-1014.377) (-1018.123) (-1018.027) -- 0:00:14
768000 -- (-1014.846) [-1018.935] (-1019.237) (-1014.312) * (-1014.254) [-1013.537] (-1015.582) (-1013.362) -- 0:00:14
768500 -- (-1018.669) (-1016.283) (-1014.119) [-1013.963] * [-1014.073] (-1013.863) (-1014.859) (-1014.343) -- 0:00:14
769000 -- (-1016.936) (-1016.607) [-1014.587] (-1014.808) * [-1014.004] (-1014.775) (-1014.076) (-1014.785) -- 0:00:14
769500 -- [-1013.612] (-1014.600) (-1014.519) (-1014.559) * (-1018.175) (-1015.141) (-1013.530) [-1017.338] -- 0:00:14
770000 -- (-1014.175) (-1013.605) (-1013.303) [-1014.192] * (-1015.219) (-1014.266) (-1013.276) [-1016.557] -- 0:00:14
Average standard deviation of split frequencies: 0.006321
770500 -- (-1016.446) [-1013.347] (-1014.008) (-1015.080) * [-1021.070] (-1013.363) (-1014.804) (-1017.212) -- 0:00:14
771000 -- (-1016.917) (-1016.536) [-1015.277] (-1014.672) * (-1020.495) [-1014.707] (-1013.733) (-1014.998) -- 0:00:14
771500 -- [-1015.681] (-1014.954) (-1016.970) (-1015.567) * [-1015.906] (-1024.597) (-1012.800) (-1019.820) -- 0:00:14
772000 -- (-1017.750) [-1014.949] (-1015.267) (-1013.266) * (-1015.308) (-1014.474) [-1012.832] (-1017.148) -- 0:00:14
772500 -- [-1013.795] (-1014.015) (-1019.912) (-1012.815) * (-1014.083) (-1015.326) [-1014.802] (-1014.670) -- 0:00:14
773000 -- [-1013.315] (-1016.188) (-1015.494) (-1014.135) * (-1015.705) (-1014.189) (-1015.485) [-1015.896] -- 0:00:14
773500 -- [-1014.706] (-1014.519) (-1015.042) (-1014.960) * [-1017.442] (-1016.024) (-1014.863) (-1016.568) -- 0:00:14
774000 -- (-1014.726) [-1016.551] (-1012.812) (-1015.424) * (-1015.009) (-1013.344) [-1018.211] (-1018.883) -- 0:00:14
774500 -- (-1016.555) (-1014.749) [-1016.477] (-1013.783) * (-1014.992) (-1013.900) (-1014.149) [-1015.661] -- 0:00:14
775000 -- (-1015.015) [-1014.874] (-1016.193) (-1013.590) * [-1017.773] (-1015.898) (-1014.094) (-1013.499) -- 0:00:14
Average standard deviation of split frequencies: 0.006601
775500 -- [-1014.717] (-1017.319) (-1018.607) (-1014.340) * (-1017.734) (-1015.825) (-1017.308) [-1014.477] -- 0:00:14
776000 -- (-1016.801) (-1018.278) (-1012.960) [-1016.718] * (-1013.048) (-1018.299) (-1015.376) [-1014.602] -- 0:00:14
776500 -- (-1016.904) (-1015.489) (-1013.468) [-1019.671] * [-1014.509] (-1013.371) (-1015.509) (-1014.535) -- 0:00:14
777000 -- (-1014.891) [-1015.747] (-1014.905) (-1017.263) * (-1016.239) [-1016.848] (-1015.854) (-1014.611) -- 0:00:14
777500 -- (-1017.767) (-1015.606) (-1014.304) [-1015.312] * (-1017.623) (-1016.970) [-1016.577] (-1017.633) -- 0:00:14
778000 -- (-1014.207) (-1015.519) (-1013.846) [-1016.037] * (-1015.636) [-1015.765] (-1014.687) (-1013.198) -- 0:00:13
778500 -- (-1013.343) (-1014.519) [-1016.423] (-1016.391) * (-1015.018) [-1017.396] (-1016.571) (-1016.166) -- 0:00:13
779000 -- (-1014.107) [-1015.064] (-1016.538) (-1014.742) * (-1014.988) [-1017.627] (-1014.958) (-1016.921) -- 0:00:13
779500 -- (-1014.107) [-1015.140] (-1017.725) (-1014.744) * [-1015.636] (-1023.705) (-1015.820) (-1013.648) -- 0:00:13
780000 -- (-1013.720) [-1014.578] (-1016.076) (-1014.842) * (-1016.941) [-1015.273] (-1016.198) (-1015.062) -- 0:00:13
Average standard deviation of split frequencies: 0.006763
780500 -- (-1014.453) [-1014.613] (-1015.943) (-1013.760) * (-1013.422) (-1012.724) [-1019.224] (-1017.791) -- 0:00:13
781000 -- (-1014.940) [-1017.377] (-1016.386) (-1014.818) * (-1014.867) [-1019.883] (-1016.213) (-1018.894) -- 0:00:13
781500 -- [-1015.647] (-1018.037) (-1016.154) (-1013.625) * [-1013.811] (-1020.107) (-1013.636) (-1018.631) -- 0:00:13
782000 -- (-1016.614) (-1019.224) [-1015.847] (-1016.702) * [-1013.274] (-1014.502) (-1017.290) (-1017.655) -- 0:00:13
782500 -- (-1017.993) (-1019.576) [-1015.357] (-1018.096) * (-1014.933) (-1016.799) [-1015.121] (-1013.909) -- 0:00:13
783000 -- (-1017.717) (-1015.418) [-1015.530] (-1016.355) * (-1015.638) (-1014.618) (-1013.866) [-1014.793] -- 0:00:13
783500 -- (-1016.540) (-1015.823) (-1013.961) [-1013.790] * [-1013.870] (-1017.115) (-1014.794) (-1013.833) -- 0:00:13
784000 -- (-1015.822) [-1014.483] (-1014.764) (-1016.181) * (-1014.114) [-1014.699] (-1015.207) (-1014.646) -- 0:00:13
784500 -- (-1016.840) (-1014.183) [-1014.099] (-1017.302) * [-1015.035] (-1014.997) (-1016.801) (-1013.929) -- 0:00:13
785000 -- (-1015.950) (-1018.621) [-1015.890] (-1018.535) * (-1014.887) (-1017.190) (-1017.981) [-1014.479] -- 0:00:13
Average standard deviation of split frequencies: 0.008397
785500 -- (-1018.939) (-1014.643) (-1018.663) [-1016.494] * [-1014.052] (-1015.992) (-1015.809) (-1013.819) -- 0:00:13
786000 -- (-1017.487) [-1015.507] (-1012.818) (-1014.927) * (-1013.700) [-1013.989] (-1015.440) (-1015.361) -- 0:00:13
786500 -- [-1015.171] (-1017.036) (-1019.499) (-1014.395) * (-1014.259) [-1014.428] (-1018.613) (-1013.544) -- 0:00:13
787000 -- (-1013.672) (-1017.957) [-1015.958] (-1014.884) * [-1016.050] (-1013.178) (-1015.762) (-1016.299) -- 0:00:13
787500 -- (-1013.530) (-1015.590) (-1016.540) [-1014.833] * [-1015.962] (-1014.672) (-1015.266) (-1014.278) -- 0:00:13
788000 -- (-1015.300) (-1016.478) (-1018.407) [-1016.206] * (-1016.537) (-1014.167) (-1016.003) [-1013.822] -- 0:00:13
788500 -- (-1013.437) (-1017.741) (-1014.599) [-1016.720] * (-1014.428) (-1012.906) [-1014.495] (-1021.781) -- 0:00:13
789000 -- (-1015.167) (-1019.862) (-1015.450) [-1013.740] * (-1018.201) (-1014.559) (-1013.463) [-1014.091] -- 0:00:13
789500 -- (-1015.200) (-1019.592) [-1017.238] (-1013.774) * (-1014.949) (-1014.923) (-1014.097) [-1014.328] -- 0:00:13
790000 -- (-1018.254) (-1016.159) [-1014.890] (-1014.415) * (-1016.151) [-1014.016] (-1013.329) (-1015.600) -- 0:00:13
Average standard deviation of split frequencies: 0.007602
790500 -- (-1014.409) (-1014.634) [-1015.855] (-1014.412) * (-1014.359) (-1013.757) (-1013.671) [-1017.282] -- 0:00:13
791000 -- (-1014.991) (-1018.233) (-1021.635) [-1015.694] * [-1014.758] (-1014.628) (-1014.063) (-1015.342) -- 0:00:13
791500 -- (-1017.839) [-1014.093] (-1016.285) (-1014.744) * (-1018.007) (-1014.337) (-1014.983) [-1014.654] -- 0:00:13
792000 -- (-1017.544) [-1015.265] (-1017.841) (-1014.262) * (-1018.100) [-1014.435] (-1015.730) (-1015.041) -- 0:00:13
792500 -- (-1017.353) (-1018.805) (-1013.703) [-1015.133] * (-1018.042) [-1013.980] (-1014.550) (-1015.688) -- 0:00:13
793000 -- [-1017.086] (-1017.285) (-1016.412) (-1017.177) * (-1014.951) (-1015.021) (-1014.824) [-1014.628] -- 0:00:13
793500 -- [-1016.370] (-1014.861) (-1013.628) (-1013.369) * [-1013.827] (-1015.588) (-1013.736) (-1014.330) -- 0:00:13
794000 -- (-1013.281) (-1020.070) (-1013.496) [-1016.726] * (-1018.379) (-1014.031) (-1015.334) [-1018.962] -- 0:00:12
794500 -- [-1018.067] (-1017.634) (-1014.272) (-1012.783) * (-1014.524) [-1013.059] (-1016.385) (-1018.178) -- 0:00:12
795000 -- [-1014.323] (-1017.709) (-1017.445) (-1013.607) * [-1013.828] (-1019.280) (-1015.456) (-1014.659) -- 0:00:12
Average standard deviation of split frequencies: 0.007662
795500 -- [-1016.850] (-1015.402) (-1015.882) (-1013.973) * (-1014.342) [-1014.607] (-1014.488) (-1013.521) -- 0:00:12
796000 -- (-1017.534) (-1020.529) [-1016.500] (-1016.854) * [-1017.765] (-1015.994) (-1014.904) (-1015.684) -- 0:00:12
796500 -- [-1016.760] (-1017.583) (-1015.289) (-1014.231) * (-1014.829) (-1015.056) [-1016.066] (-1013.845) -- 0:00:12
797000 -- [-1018.729] (-1015.158) (-1013.523) (-1014.910) * [-1012.901] (-1013.260) (-1016.754) (-1014.806) -- 0:00:12
797500 -- (-1014.017) (-1014.546) (-1013.882) [-1015.582] * (-1014.873) (-1014.825) (-1019.570) [-1014.808] -- 0:00:12
798000 -- (-1013.429) [-1014.445] (-1016.717) (-1016.917) * [-1015.267] (-1015.549) (-1014.218) (-1016.420) -- 0:00:12
798500 -- (-1013.059) (-1013.676) (-1018.297) [-1015.446] * [-1013.370] (-1014.776) (-1015.529) (-1013.453) -- 0:00:12
799000 -- (-1015.418) [-1013.768] (-1024.211) (-1013.328) * (-1015.878) (-1014.487) (-1016.440) [-1017.151] -- 0:00:12
799500 -- (-1017.435) (-1020.564) [-1015.229] (-1013.444) * (-1015.048) [-1015.239] (-1015.596) (-1016.514) -- 0:00:12
800000 -- (-1015.597) [-1013.756] (-1013.525) (-1016.402) * [-1014.983] (-1023.707) (-1015.010) (-1012.821) -- 0:00:12
Average standard deviation of split frequencies: 0.007360
800500 -- (-1014.939) [-1016.015] (-1013.525) (-1015.315) * (-1019.944) [-1013.909] (-1018.118) (-1013.151) -- 0:00:12
801000 -- (-1014.274) [-1019.317] (-1015.676) (-1014.510) * (-1016.711) [-1015.470] (-1015.360) (-1015.421) -- 0:00:12
801500 -- (-1015.305) (-1015.922) (-1018.624) [-1014.376] * (-1016.094) (-1017.400) (-1013.330) [-1014.384] -- 0:00:12
802000 -- (-1017.406) [-1014.058] (-1018.995) (-1015.114) * [-1014.659] (-1015.922) (-1013.355) (-1014.596) -- 0:00:12
802500 -- (-1018.989) [-1013.751] (-1017.965) (-1020.119) * (-1015.383) [-1020.260] (-1020.503) (-1013.844) -- 0:00:12
803000 -- (-1013.703) [-1014.482] (-1018.535) (-1020.370) * (-1015.491) (-1016.669) (-1015.244) [-1016.372] -- 0:00:12
803500 -- (-1019.141) (-1022.071) (-1015.329) [-1015.290] * [-1015.210] (-1012.947) (-1018.038) (-1016.476) -- 0:00:12
804000 -- [-1016.655] (-1015.542) (-1015.260) (-1015.759) * (-1016.129) (-1014.954) (-1016.527) [-1016.909] -- 0:00:12
804500 -- (-1017.441) (-1016.305) (-1019.295) [-1014.888] * (-1013.760) [-1014.304] (-1015.317) (-1018.106) -- 0:00:12
805000 -- (-1015.307) (-1016.630) [-1015.728] (-1017.268) * (-1012.929) [-1014.840] (-1016.253) (-1015.200) -- 0:00:12
Average standard deviation of split frequencies: 0.007786
805500 -- (-1015.074) [-1014.706] (-1014.993) (-1017.501) * (-1019.890) [-1019.152] (-1015.732) (-1013.138) -- 0:00:12
806000 -- [-1013.630] (-1013.305) (-1017.239) (-1017.357) * (-1014.916) (-1013.999) [-1014.944] (-1014.182) -- 0:00:12
806500 -- (-1015.726) (-1013.044) [-1014.676] (-1014.418) * (-1013.986) (-1013.923) [-1014.127] (-1014.056) -- 0:00:12
807000 -- (-1014.901) [-1013.078] (-1016.886) (-1015.237) * (-1016.170) [-1013.474] (-1014.912) (-1014.796) -- 0:00:12
807500 -- [-1015.130] (-1014.743) (-1017.639) (-1016.023) * (-1019.974) [-1017.573] (-1018.901) (-1014.827) -- 0:00:12
808000 -- (-1016.263) [-1015.874] (-1014.237) (-1017.335) * (-1017.383) [-1018.721] (-1015.188) (-1013.848) -- 0:00:12
808500 -- (-1015.857) (-1013.610) (-1014.442) [-1013.441] * (-1013.729) [-1014.864] (-1019.714) (-1015.288) -- 0:00:12
809000 -- (-1017.550) (-1019.774) [-1015.171] (-1013.081) * (-1013.875) (-1016.171) (-1017.272) [-1014.848] -- 0:00:12
809500 -- (-1015.647) (-1014.540) (-1013.148) [-1013.231] * [-1013.961] (-1015.142) (-1013.105) (-1018.734) -- 0:00:12
810000 -- (-1015.225) (-1012.929) (-1015.342) [-1013.985] * (-1014.011) [-1016.267] (-1014.703) (-1014.769) -- 0:00:11
Average standard deviation of split frequencies: 0.007632
810500 -- (-1017.122) [-1012.856] (-1016.453) (-1022.535) * (-1014.870) (-1014.328) [-1013.126] (-1014.095) -- 0:00:11
811000 -- (-1016.024) (-1015.491) [-1014.338] (-1015.258) * (-1013.598) (-1013.594) [-1012.852] (-1014.631) -- 0:00:11
811500 -- (-1017.561) (-1014.277) [-1015.307] (-1014.170) * (-1015.401) [-1013.730] (-1014.764) (-1015.460) -- 0:00:11
812000 -- (-1017.272) [-1014.478] (-1015.844) (-1013.756) * (-1014.900) (-1017.999) (-1017.890) [-1015.104] -- 0:00:11
812500 -- (-1020.235) [-1014.896] (-1013.652) (-1015.915) * (-1013.611) (-1014.449) [-1014.220] (-1018.921) -- 0:00:11
813000 -- (-1013.008) (-1012.919) [-1014.492] (-1014.283) * (-1013.861) (-1019.415) [-1014.186] (-1013.418) -- 0:00:11
813500 -- (-1015.877) (-1015.778) [-1013.875] (-1017.937) * [-1014.548] (-1014.102) (-1014.490) (-1016.073) -- 0:00:11
814000 -- (-1013.834) (-1014.931) (-1013.617) [-1013.985] * [-1016.073] (-1013.840) (-1020.239) (-1017.274) -- 0:00:11
814500 -- (-1014.157) [-1014.601] (-1015.123) (-1014.589) * (-1018.643) [-1013.676] (-1017.938) (-1016.426) -- 0:00:11
815000 -- [-1016.009] (-1015.961) (-1020.931) (-1015.824) * (-1014.534) (-1019.532) [-1015.616] (-1014.199) -- 0:00:11
Average standard deviation of split frequencies: 0.007618
815500 -- (-1016.379) [-1021.131] (-1016.609) (-1014.713) * (-1018.061) (-1016.408) [-1013.705] (-1018.000) -- 0:00:11
816000 -- (-1013.995) (-1014.485) (-1017.648) [-1017.419] * [-1017.342] (-1016.178) (-1013.905) (-1014.158) -- 0:00:11
816500 -- (-1014.280) (-1014.380) (-1019.482) [-1014.039] * (-1017.386) (-1016.359) [-1016.741] (-1012.885) -- 0:00:11
817000 -- [-1015.900] (-1017.514) (-1013.616) (-1017.686) * (-1021.292) [-1015.653] (-1015.182) (-1019.674) -- 0:00:11
817500 -- [-1015.241] (-1015.321) (-1014.583) (-1015.107) * (-1019.500) (-1016.382) (-1017.009) [-1014.850] -- 0:00:11
818000 -- [-1013.963] (-1013.677) (-1015.287) (-1015.927) * (-1014.637) (-1017.885) [-1016.923] (-1016.836) -- 0:00:11
818500 -- [-1013.236] (-1017.436) (-1014.966) (-1015.981) * [-1014.265] (-1016.079) (-1015.695) (-1019.616) -- 0:00:11
819000 -- [-1015.835] (-1015.467) (-1015.356) (-1020.014) * [-1015.354] (-1014.403) (-1016.240) (-1020.826) -- 0:00:11
819500 -- (-1015.363) (-1018.917) [-1019.712] (-1014.697) * (-1014.518) [-1013.433] (-1016.042) (-1013.903) -- 0:00:11
820000 -- (-1014.928) [-1013.960] (-1015.785) (-1018.138) * (-1015.087) (-1013.909) (-1017.654) [-1017.586] -- 0:00:11
Average standard deviation of split frequencies: 0.007216
820500 -- (-1015.945) (-1016.999) (-1013.917) [-1015.910] * (-1015.014) (-1013.457) (-1014.531) [-1014.369] -- 0:00:11
821000 -- (-1018.131) (-1013.762) (-1017.061) [-1015.152] * (-1013.593) (-1015.463) [-1014.144] (-1014.966) -- 0:00:11
821500 -- (-1015.271) [-1013.121] (-1014.348) (-1015.034) * (-1017.888) [-1013.363] (-1016.915) (-1014.753) -- 0:00:11
822000 -- (-1014.772) (-1013.248) [-1015.164] (-1015.614) * (-1013.776) (-1015.113) [-1015.377] (-1018.134) -- 0:00:11
822500 -- [-1013.809] (-1013.059) (-1016.477) (-1017.621) * (-1015.163) (-1014.373) (-1013.434) [-1015.463] -- 0:00:11
823000 -- (-1015.049) [-1014.472] (-1015.640) (-1014.665) * (-1014.732) (-1014.130) [-1014.975] (-1015.342) -- 0:00:11
823500 -- (-1014.725) [-1013.673] (-1014.570) (-1016.939) * [-1013.805] (-1014.070) (-1018.719) (-1016.667) -- 0:00:11
824000 -- (-1015.673) (-1013.755) (-1014.653) [-1013.438] * [-1014.139] (-1023.768) (-1018.067) (-1020.698) -- 0:00:11
824500 -- (-1015.073) (-1016.078) [-1015.711] (-1014.050) * (-1015.911) (-1018.896) (-1017.440) [-1021.120] -- 0:00:11
825000 -- (-1014.740) [-1013.991] (-1021.866) (-1013.288) * (-1013.971) (-1015.973) [-1015.687] (-1015.104) -- 0:00:11
Average standard deviation of split frequencies: 0.007170
825500 -- (-1013.903) (-1015.048) (-1021.318) [-1013.506] * (-1017.460) [-1015.006] (-1017.554) (-1013.058) -- 0:00:10
826000 -- [-1014.281] (-1014.686) (-1019.409) (-1013.429) * (-1017.231) (-1014.881) [-1019.899] (-1019.287) -- 0:00:10
826500 -- (-1013.670) [-1014.454] (-1014.247) (-1013.414) * (-1016.735) (-1015.294) [-1016.201] (-1013.866) -- 0:00:10
827000 -- (-1012.784) (-1013.937) [-1016.428] (-1013.518) * (-1016.850) (-1013.141) [-1016.788] (-1013.787) -- 0:00:10
827500 -- (-1013.649) (-1013.406) [-1014.596] (-1017.372) * (-1014.276) (-1013.496) (-1016.412) [-1013.882] -- 0:00:10
828000 -- (-1015.722) (-1015.407) [-1015.440] (-1014.744) * (-1014.275) [-1017.281] (-1013.635) (-1014.829) -- 0:00:10
828500 -- (-1014.196) (-1016.078) [-1017.528] (-1013.374) * [-1014.416] (-1014.242) (-1013.979) (-1016.620) -- 0:00:10
829000 -- (-1021.839) (-1019.165) [-1014.732] (-1013.783) * [-1016.498] (-1015.617) (-1013.710) (-1016.258) -- 0:00:10
829500 -- [-1013.864] (-1020.058) (-1015.766) (-1015.517) * (-1015.244) (-1015.785) [-1014.319] (-1014.191) -- 0:00:10
830000 -- (-1020.291) (-1016.874) [-1015.447] (-1014.718) * [-1014.774] (-1014.726) (-1014.022) (-1014.036) -- 0:00:10
Average standard deviation of split frequencies: 0.006987
830500 -- (-1019.769) (-1019.562) [-1018.765] (-1019.680) * (-1013.572) (-1015.978) [-1013.555] (-1014.099) -- 0:00:10
831000 -- (-1015.527) (-1016.532) [-1015.970] (-1014.033) * (-1015.348) (-1014.324) (-1013.659) [-1013.608] -- 0:00:10
831500 -- (-1014.643) [-1013.801] (-1013.438) (-1014.758) * (-1016.256) [-1013.569] (-1016.019) (-1013.788) -- 0:00:10
832000 -- (-1018.537) [-1014.906] (-1021.381) (-1013.074) * (-1015.484) (-1014.097) [-1013.121] (-1013.289) -- 0:00:10
832500 -- (-1016.733) [-1013.751] (-1013.712) (-1015.723) * [-1016.720] (-1013.398) (-1014.299) (-1013.684) -- 0:00:10
833000 -- (-1015.556) (-1017.637) (-1014.466) [-1016.429] * [-1015.304] (-1018.440) (-1014.305) (-1015.601) -- 0:00:10
833500 -- (-1015.519) (-1018.686) [-1016.286] (-1012.796) * (-1016.188) [-1015.803] (-1014.757) (-1015.555) -- 0:00:10
834000 -- (-1014.216) (-1015.869) [-1013.966] (-1013.224) * (-1014.883) (-1013.106) [-1013.390] (-1016.704) -- 0:00:10
834500 -- (-1014.148) (-1016.504) (-1014.229) [-1019.228] * (-1015.959) (-1015.049) [-1017.867] (-1014.438) -- 0:00:10
835000 -- [-1015.823] (-1016.110) (-1014.633) (-1015.415) * [-1019.516] (-1015.945) (-1022.167) (-1013.676) -- 0:00:10
Average standard deviation of split frequencies: 0.006767
835500 -- (-1015.808) (-1015.564) [-1013.741] (-1013.236) * [-1016.108] (-1014.812) (-1015.705) (-1015.010) -- 0:00:10
836000 -- (-1014.325) [-1014.993] (-1013.784) (-1013.516) * (-1019.223) [-1015.125] (-1012.985) (-1015.579) -- 0:00:10
836500 -- (-1015.761) (-1013.491) [-1014.449] (-1013.796) * (-1016.949) (-1014.400) [-1013.437] (-1013.814) -- 0:00:10
837000 -- (-1013.613) (-1015.943) [-1013.778] (-1014.122) * (-1015.167) [-1014.201] (-1014.992) (-1014.245) -- 0:00:10
837500 -- (-1014.037) [-1014.128] (-1014.136) (-1016.106) * (-1020.996) [-1013.041] (-1016.262) (-1016.714) -- 0:00:10
838000 -- (-1015.430) [-1014.529] (-1015.787) (-1015.437) * [-1015.848] (-1013.781) (-1014.840) (-1015.654) -- 0:00:10
838500 -- (-1019.951) [-1013.422] (-1015.183) (-1015.927) * [-1013.702] (-1019.158) (-1013.300) (-1014.779) -- 0:00:10
839000 -- (-1013.343) (-1017.624) (-1015.360) [-1015.394] * (-1014.240) [-1019.564] (-1015.953) (-1014.165) -- 0:00:10
839500 -- [-1013.771] (-1018.107) (-1018.435) (-1014.160) * (-1013.282) [-1015.113] (-1015.496) (-1022.419) -- 0:00:10
840000 -- (-1017.348) (-1014.960) [-1013.267] (-1014.689) * (-1015.450) (-1014.703) [-1015.115] (-1014.754) -- 0:00:10
Average standard deviation of split frequencies: 0.006393
840500 -- (-1022.149) (-1013.599) [-1015.578] (-1013.271) * (-1014.361) (-1015.015) (-1016.251) [-1013.921] -- 0:00:10
841000 -- [-1017.897] (-1014.897) (-1013.817) (-1014.662) * (-1016.570) (-1015.585) [-1014.387] (-1013.611) -- 0:00:10
841500 -- [-1016.811] (-1015.292) (-1013.480) (-1015.763) * (-1015.106) (-1013.217) (-1013.079) [-1014.301] -- 0:00:09
842000 -- [-1014.017] (-1015.581) (-1013.569) (-1014.253) * (-1018.176) (-1016.757) [-1015.683] (-1014.947) -- 0:00:09
842500 -- (-1015.238) (-1013.045) (-1012.903) [-1012.982] * [-1016.667] (-1013.844) (-1013.636) (-1016.199) -- 0:00:09
843000 -- (-1014.893) (-1014.423) (-1014.016) [-1015.807] * (-1015.420) (-1013.819) [-1013.964] (-1014.520) -- 0:00:09
843500 -- (-1014.349) (-1015.593) [-1016.581] (-1019.200) * (-1014.949) (-1013.952) (-1013.535) [-1017.918] -- 0:00:09
844000 -- (-1015.149) (-1014.088) [-1014.890] (-1019.970) * (-1020.820) (-1014.128) [-1014.045] (-1017.080) -- 0:00:09
844500 -- (-1015.879) [-1015.007] (-1018.791) (-1015.987) * (-1018.679) (-1017.036) (-1013.248) [-1015.871] -- 0:00:09
845000 -- [-1014.806] (-1013.538) (-1013.118) (-1017.512) * (-1017.145) [-1014.636] (-1017.652) (-1016.439) -- 0:00:09
Average standard deviation of split frequencies: 0.006575
845500 -- (-1014.456) (-1014.597) [-1014.121] (-1019.675) * (-1016.263) (-1019.115) [-1013.131] (-1013.446) -- 0:00:09
846000 -- [-1015.375] (-1017.680) (-1019.025) (-1014.600) * (-1015.340) (-1018.698) [-1015.013] (-1020.521) -- 0:00:09
846500 -- (-1016.920) (-1016.890) [-1016.225] (-1014.302) * (-1015.330) (-1018.529) [-1015.638] (-1015.675) -- 0:00:09
847000 -- (-1016.501) (-1017.308) (-1013.700) [-1013.271] * (-1019.873) [-1013.874] (-1016.319) (-1013.040) -- 0:00:09
847500 -- [-1013.165] (-1018.585) (-1014.822) (-1014.284) * (-1013.542) (-1016.816) (-1019.026) [-1014.563] -- 0:00:09
848000 -- (-1013.368) (-1013.972) (-1012.913) [-1013.973] * (-1015.543) [-1015.146] (-1014.197) (-1014.406) -- 0:00:09
848500 -- (-1016.345) (-1014.916) [-1014.596] (-1014.140) * [-1014.137] (-1014.389) (-1013.694) (-1013.910) -- 0:00:09
849000 -- (-1015.501) (-1015.622) [-1016.459] (-1016.477) * (-1015.979) (-1017.400) [-1018.667] (-1014.779) -- 0:00:09
849500 -- (-1015.231) (-1015.210) [-1018.235] (-1014.058) * (-1016.454) (-1019.650) (-1015.663) [-1013.009] -- 0:00:09
850000 -- (-1020.115) [-1017.092] (-1019.721) (-1014.672) * [-1018.614] (-1014.029) (-1013.982) (-1014.075) -- 0:00:09
Average standard deviation of split frequencies: 0.006724
850500 -- (-1017.681) [-1013.304] (-1018.775) (-1018.620) * (-1015.799) [-1016.918] (-1017.048) (-1016.529) -- 0:00:09
851000 -- (-1018.686) [-1015.535] (-1024.258) (-1016.545) * (-1014.850) (-1017.023) (-1013.472) [-1016.494] -- 0:00:09
851500 -- (-1017.446) (-1013.180) [-1015.116] (-1016.995) * [-1016.577] (-1016.635) (-1014.354) (-1015.155) -- 0:00:09
852000 -- [-1013.473] (-1017.146) (-1017.204) (-1015.992) * (-1019.062) (-1021.781) (-1013.242) [-1015.477] -- 0:00:09
852500 -- (-1015.312) (-1021.731) (-1015.630) [-1018.797] * (-1018.715) (-1014.961) [-1014.407] (-1015.648) -- 0:00:09
853000 -- [-1013.772] (-1015.032) (-1016.133) (-1020.365) * (-1016.021) [-1015.038] (-1016.765) (-1013.052) -- 0:00:09
853500 -- [-1015.690] (-1014.438) (-1017.318) (-1018.310) * (-1013.465) [-1013.314] (-1019.815) (-1013.610) -- 0:00:09
854000 -- (-1013.947) [-1014.904] (-1021.189) (-1014.942) * (-1014.938) (-1015.783) [-1013.693] (-1018.264) -- 0:00:09
854500 -- (-1015.821) (-1013.099) (-1018.726) [-1015.317] * [-1015.528] (-1014.911) (-1016.332) (-1019.332) -- 0:00:09
855000 -- (-1016.867) (-1013.641) (-1015.643) [-1015.413] * (-1015.967) [-1015.473] (-1015.394) (-1014.674) -- 0:00:09
Average standard deviation of split frequencies: 0.006719
855500 -- (-1015.500) [-1013.962] (-1015.312) (-1014.363) * [-1015.145] (-1016.367) (-1016.154) (-1014.852) -- 0:00:09
856000 -- (-1014.989) (-1015.763) (-1017.897) [-1012.889] * (-1019.116) [-1017.449] (-1014.833) (-1017.517) -- 0:00:09
856500 -- (-1017.371) (-1016.386) (-1014.162) [-1012.934] * [-1013.305] (-1015.002) (-1014.816) (-1015.432) -- 0:00:09
857000 -- (-1014.119) (-1014.244) [-1020.677] (-1012.839) * (-1014.845) [-1016.058] (-1019.927) (-1013.986) -- 0:00:09
857500 -- (-1013.675) (-1013.115) (-1014.650) [-1013.779] * (-1016.774) (-1015.473) (-1016.053) [-1013.809] -- 0:00:08
858000 -- [-1014.376] (-1014.042) (-1014.875) (-1015.538) * (-1016.891) [-1014.817] (-1015.403) (-1013.814) -- 0:00:08
858500 -- [-1013.518] (-1017.079) (-1014.372) (-1019.323) * (-1017.937) (-1014.353) [-1014.039] (-1013.824) -- 0:00:08
859000 -- [-1013.979] (-1013.539) (-1015.353) (-1018.084) * (-1017.553) (-1013.442) (-1014.751) [-1015.275] -- 0:00:08
859500 -- [-1015.840] (-1016.903) (-1014.999) (-1013.850) * (-1014.893) (-1013.451) (-1014.749) [-1014.462] -- 0:00:08
860000 -- (-1014.408) (-1013.749) (-1014.041) [-1014.588] * (-1013.807) (-1014.593) [-1014.224] (-1014.341) -- 0:00:08
Average standard deviation of split frequencies: 0.006500
860500 -- (-1015.602) (-1014.354) (-1017.137) [-1013.130] * [-1017.810] (-1015.883) (-1015.350) (-1018.220) -- 0:00:08
861000 -- (-1019.619) [-1014.673] (-1015.509) (-1013.024) * (-1015.325) (-1013.661) [-1015.372] (-1014.020) -- 0:00:08
861500 -- [-1016.116] (-1015.775) (-1020.528) (-1012.937) * [-1018.039] (-1013.979) (-1013.327) (-1015.431) -- 0:00:08
862000 -- (-1016.417) [-1017.278] (-1015.879) (-1015.323) * [-1016.780] (-1014.483) (-1016.975) (-1014.588) -- 0:00:08
862500 -- (-1015.907) (-1017.722) (-1015.531) [-1014.472] * [-1015.557] (-1013.987) (-1015.116) (-1015.333) -- 0:00:08
863000 -- (-1013.170) (-1013.785) (-1013.557) [-1014.957] * (-1015.987) [-1013.645] (-1017.016) (-1013.657) -- 0:00:08
863500 -- (-1013.784) [-1013.355] (-1013.925) (-1015.660) * (-1015.794) [-1021.347] (-1013.125) (-1012.730) -- 0:00:08
864000 -- [-1016.333] (-1014.652) (-1014.094) (-1014.034) * (-1014.573) (-1016.444) (-1016.431) [-1018.416] -- 0:00:08
864500 -- (-1015.880) [-1015.704] (-1018.136) (-1016.160) * (-1014.187) (-1014.073) [-1014.975] (-1023.855) -- 0:00:08
865000 -- (-1016.244) [-1015.352] (-1013.937) (-1016.364) * (-1016.715) [-1014.186] (-1016.159) (-1017.841) -- 0:00:08
Average standard deviation of split frequencies: 0.006786
865500 -- (-1017.203) (-1015.581) (-1013.656) [-1013.344] * (-1015.719) (-1013.380) [-1018.184] (-1017.462) -- 0:00:08
866000 -- (-1013.516) (-1014.165) [-1014.879] (-1016.776) * [-1014.713] (-1015.357) (-1015.768) (-1016.326) -- 0:00:08
866500 -- (-1018.051) [-1014.962] (-1017.199) (-1013.647) * (-1014.876) (-1013.708) (-1014.660) [-1013.781] -- 0:00:08
867000 -- (-1015.984) (-1014.969) [-1014.222] (-1014.355) * (-1014.650) (-1014.433) [-1013.677] (-1013.549) -- 0:00:08
867500 -- (-1014.889) (-1013.747) (-1013.936) [-1013.808] * (-1013.023) (-1014.689) (-1014.857) [-1015.582] -- 0:00:08
868000 -- [-1015.400] (-1016.606) (-1014.097) (-1014.421) * (-1013.506) (-1014.208) (-1014.828) [-1013.840] -- 0:00:08
868500 -- (-1022.914) (-1015.911) (-1016.646) [-1014.756] * (-1019.106) (-1014.911) [-1017.544] (-1013.927) -- 0:00:08
869000 -- (-1016.492) [-1013.619] (-1016.996) (-1015.981) * (-1015.879) (-1014.261) [-1015.071] (-1014.623) -- 0:00:08
869500 -- [-1013.505] (-1013.799) (-1020.831) (-1016.006) * (-1013.644) (-1016.792) (-1014.565) [-1013.840] -- 0:00:08
870000 -- [-1018.898] (-1016.325) (-1018.966) (-1015.241) * (-1016.836) (-1015.760) (-1013.236) [-1013.291] -- 0:00:08
Average standard deviation of split frequencies: 0.006642
870500 -- (-1014.126) (-1017.071) [-1016.116] (-1013.917) * (-1014.006) (-1016.113) [-1013.045] (-1013.304) -- 0:00:08
871000 -- (-1018.484) (-1015.331) [-1015.925] (-1014.345) * (-1015.523) (-1016.874) (-1016.500) [-1014.981] -- 0:00:08
871500 -- (-1017.249) [-1016.370] (-1015.366) (-1017.810) * (-1017.786) (-1025.613) (-1015.026) [-1017.565] -- 0:00:08
872000 -- (-1015.955) (-1015.931) (-1014.559) [-1012.768] * [-1015.814] (-1018.216) (-1014.737) (-1014.107) -- 0:00:08
872500 -- (-1015.562) [-1015.629] (-1015.924) (-1016.053) * (-1012.943) [-1016.629] (-1013.899) (-1015.623) -- 0:00:08
873000 -- (-1016.186) [-1017.490] (-1016.550) (-1016.019) * [-1014.252] (-1021.025) (-1013.319) (-1012.837) -- 0:00:08
873500 -- (-1017.128) (-1019.104) (-1014.392) [-1014.081] * (-1015.273) (-1014.160) (-1014.505) [-1012.837] -- 0:00:07
874000 -- (-1015.957) (-1019.807) [-1013.926] (-1013.893) * (-1015.516) (-1015.509) [-1014.319] (-1014.893) -- 0:00:07
874500 -- (-1012.809) (-1017.370) (-1015.274) [-1014.833] * (-1015.323) [-1018.885] (-1014.859) (-1016.121) -- 0:00:07
875000 -- (-1018.361) (-1014.591) [-1014.331] (-1013.215) * (-1017.140) [-1016.705] (-1013.486) (-1016.033) -- 0:00:07
Average standard deviation of split frequencies: 0.007032
875500 -- (-1015.781) (-1014.792) [-1014.073] (-1012.952) * (-1015.005) (-1016.604) (-1013.752) [-1014.879] -- 0:00:07
876000 -- (-1016.412) (-1019.680) (-1013.381) [-1012.883] * (-1018.408) (-1015.468) [-1014.268] (-1016.308) -- 0:00:07
876500 -- (-1015.019) (-1016.069) [-1013.140] (-1014.751) * (-1016.166) [-1013.289] (-1016.462) (-1014.486) -- 0:00:07
877000 -- (-1014.247) (-1015.348) [-1014.180] (-1014.774) * (-1014.547) [-1013.543] (-1014.939) (-1017.408) -- 0:00:07
877500 -- (-1017.848) [-1014.454] (-1015.809) (-1017.912) * (-1014.337) [-1014.747] (-1017.655) (-1013.569) -- 0:00:07
878000 -- [-1016.231] (-1015.666) (-1015.587) (-1017.107) * (-1020.159) (-1015.077) [-1016.933] (-1014.340) -- 0:00:07
878500 -- [-1014.716] (-1017.539) (-1017.079) (-1016.155) * [-1015.217] (-1021.092) (-1017.222) (-1015.040) -- 0:00:07
879000 -- (-1014.218) (-1018.132) (-1016.153) [-1018.061] * (-1017.488) [-1014.030] (-1014.019) (-1020.819) -- 0:00:07
879500 -- (-1014.907) (-1014.660) (-1014.450) [-1014.166] * (-1015.805) (-1016.893) [-1016.546] (-1021.377) -- 0:00:07
880000 -- (-1023.341) (-1016.372) [-1013.495] (-1017.986) * (-1015.736) (-1016.463) [-1013.747] (-1014.718) -- 0:00:07
Average standard deviation of split frequencies: 0.006887
880500 -- (-1016.885) (-1014.825) (-1016.299) [-1014.210] * (-1018.259) (-1016.110) [-1014.945] (-1015.702) -- 0:00:07
881000 -- (-1018.530) [-1015.615] (-1013.566) (-1013.611) * (-1019.476) (-1014.157) (-1014.922) [-1016.057] -- 0:00:07
881500 -- (-1016.143) (-1016.406) (-1014.889) [-1013.876] * (-1017.309) [-1014.946] (-1017.269) (-1015.429) -- 0:00:07
882000 -- (-1017.878) (-1015.479) (-1014.879) [-1014.644] * (-1021.741) (-1014.007) (-1014.853) [-1014.764] -- 0:00:07
882500 -- (-1016.198) [-1014.215] (-1016.049) (-1015.868) * (-1014.464) (-1014.566) [-1013.326] (-1023.091) -- 0:00:07
883000 -- (-1018.938) (-1014.380) (-1015.079) [-1015.548] * (-1016.363) (-1014.179) (-1012.963) [-1016.027] -- 0:00:07
883500 -- [-1014.677] (-1015.148) (-1014.063) (-1014.470) * (-1020.337) (-1020.782) (-1012.927) [-1015.018] -- 0:00:07
884000 -- [-1014.201] (-1014.502) (-1013.276) (-1013.997) * (-1016.457) (-1013.328) [-1017.131] (-1013.399) -- 0:00:07
884500 -- (-1014.182) (-1016.131) (-1016.120) [-1015.276] * (-1013.595) (-1015.254) (-1016.004) [-1013.537] -- 0:00:07
885000 -- [-1015.280] (-1013.621) (-1016.315) (-1016.557) * (-1016.237) (-1015.305) (-1014.573) [-1014.208] -- 0:00:07
Average standard deviation of split frequencies: 0.007023
885500 -- (-1013.439) [-1013.559] (-1021.032) (-1013.899) * [-1014.417] (-1013.253) (-1014.130) (-1016.641) -- 0:00:07
886000 -- (-1014.404) (-1014.961) (-1017.734) [-1013.336] * (-1014.430) [-1015.716] (-1014.018) (-1012.906) -- 0:00:07
886500 -- (-1013.743) (-1017.486) [-1014.329] (-1019.815) * [-1014.096] (-1018.926) (-1015.894) (-1016.131) -- 0:00:07
887000 -- (-1014.412) [-1014.693] (-1018.476) (-1018.099) * [-1013.325] (-1014.664) (-1015.292) (-1016.024) -- 0:00:07
887500 -- [-1016.689] (-1013.610) (-1013.740) (-1017.125) * (-1014.763) (-1015.160) [-1015.899] (-1015.603) -- 0:00:07
888000 -- (-1015.453) (-1014.420) [-1013.369] (-1016.844) * (-1014.687) [-1015.008] (-1014.899) (-1012.859) -- 0:00:07
888500 -- (-1014.219) (-1015.582) (-1014.569) [-1014.994] * (-1014.362) (-1016.110) (-1018.371) [-1012.924] -- 0:00:07
889000 -- (-1014.820) (-1013.117) [-1014.097] (-1014.202) * (-1017.288) [-1014.089] (-1013.929) (-1019.260) -- 0:00:06
889500 -- (-1014.690) (-1013.864) [-1017.346] (-1015.963) * (-1016.367) (-1014.382) [-1015.357] (-1014.949) -- 0:00:06
890000 -- (-1014.437) (-1013.098) (-1016.691) [-1017.070] * (-1020.458) (-1014.450) (-1014.778) [-1013.805] -- 0:00:06
Average standard deviation of split frequencies: 0.006951
890500 -- (-1014.595) [-1016.230] (-1017.187) (-1015.096) * (-1019.013) (-1017.313) [-1013.196] (-1014.409) -- 0:00:06
891000 -- [-1013.807] (-1018.798) (-1014.710) (-1014.451) * [-1014.112] (-1014.427) (-1016.676) (-1013.726) -- 0:00:06
891500 -- (-1013.762) (-1015.381) [-1013.010] (-1017.456) * [-1014.200] (-1018.340) (-1014.663) (-1014.072) -- 0:00:06
892000 -- (-1013.354) [-1020.173] (-1012.995) (-1014.483) * (-1014.188) (-1020.670) (-1017.711) [-1016.892] -- 0:00:06
892500 -- [-1013.709] (-1019.165) (-1015.747) (-1014.636) * (-1013.296) (-1018.238) [-1015.238] (-1014.587) -- 0:00:06
893000 -- (-1013.661) [-1014.499] (-1015.639) (-1014.522) * (-1013.270) (-1018.237) (-1018.347) [-1017.333] -- 0:00:06
893500 -- [-1014.324] (-1015.719) (-1014.277) (-1013.689) * (-1013.266) (-1016.674) (-1014.424) [-1017.791] -- 0:00:06
894000 -- (-1017.828) (-1018.315) [-1013.852] (-1013.773) * (-1014.204) (-1013.886) (-1015.082) [-1014.325] -- 0:00:06
894500 -- [-1014.786] (-1018.322) (-1013.654) (-1014.676) * (-1013.497) (-1016.272) [-1015.321] (-1015.914) -- 0:00:06
895000 -- [-1015.159] (-1019.979) (-1014.859) (-1018.232) * [-1016.577] (-1014.869) (-1016.300) (-1018.121) -- 0:00:06
Average standard deviation of split frequencies: 0.006875
895500 -- [-1016.421] (-1017.555) (-1015.861) (-1015.384) * [-1020.618] (-1015.758) (-1014.033) (-1014.359) -- 0:00:06
896000 -- [-1015.930] (-1014.736) (-1015.539) (-1017.647) * (-1023.792) (-1015.313) (-1014.718) [-1013.389] -- 0:00:06
896500 -- (-1013.521) [-1015.871] (-1014.545) (-1014.604) * (-1019.217) [-1013.684] (-1015.828) (-1015.237) -- 0:00:06
897000 -- (-1014.363) (-1015.947) (-1018.267) [-1012.835] * [-1017.603] (-1015.776) (-1014.270) (-1013.666) -- 0:00:06
897500 -- [-1013.777] (-1018.231) (-1018.943) (-1014.577) * (-1016.466) (-1015.079) [-1016.251] (-1012.975) -- 0:00:06
898000 -- [-1012.851] (-1015.047) (-1015.658) (-1014.212) * [-1016.244] (-1016.971) (-1018.004) (-1012.949) -- 0:00:06
898500 -- (-1012.803) [-1014.327] (-1014.055) (-1014.488) * (-1014.631) (-1014.103) (-1017.062) [-1013.902] -- 0:00:06
899000 -- (-1014.319) (-1013.449) [-1015.593] (-1013.885) * (-1013.519) [-1014.314] (-1014.267) (-1014.494) -- 0:00:06
899500 -- (-1017.135) [-1015.722] (-1014.746) (-1014.098) * (-1014.025) (-1012.900) (-1016.871) [-1015.813] -- 0:00:06
900000 -- [-1016.393] (-1014.026) (-1014.753) (-1016.662) * (-1013.352) (-1014.785) (-1016.336) [-1014.702] -- 0:00:06
Average standard deviation of split frequencies: 0.006874
900500 -- (-1014.024) (-1013.498) [-1015.457] (-1013.180) * (-1017.461) [-1017.830] (-1014.367) (-1014.361) -- 0:00:06
901000 -- (-1014.484) (-1015.578) (-1014.889) [-1013.367] * (-1014.441) [-1014.968] (-1016.720) (-1013.818) -- 0:00:06
901500 -- (-1014.448) (-1013.828) (-1015.198) [-1014.619] * (-1012.742) [-1017.237] (-1017.120) (-1015.999) -- 0:00:06
902000 -- [-1017.024] (-1014.013) (-1017.170) (-1014.849) * (-1013.411) [-1015.830] (-1014.587) (-1013.990) -- 0:00:06
902500 -- [-1014.512] (-1014.968) (-1014.689) (-1014.984) * [-1014.561] (-1015.525) (-1016.783) (-1019.031) -- 0:00:06
903000 -- [-1015.249] (-1014.322) (-1014.616) (-1015.539) * (-1016.152) (-1015.962) [-1015.247] (-1015.515) -- 0:00:06
903500 -- (-1015.316) (-1016.136) [-1014.891] (-1017.353) * (-1013.933) [-1015.618] (-1015.923) (-1016.620) -- 0:00:06
904000 -- (-1013.448) [-1016.799] (-1018.314) (-1016.066) * [-1014.941] (-1017.987) (-1017.830) (-1013.520) -- 0:00:06
904500 -- (-1014.211) (-1015.371) (-1017.480) [-1014.098] * (-1015.615) (-1017.842) (-1014.245) [-1015.899] -- 0:00:06
905000 -- (-1019.990) (-1014.915) (-1015.154) [-1016.808] * [-1015.955] (-1016.751) (-1015.093) (-1015.294) -- 0:00:05
Average standard deviation of split frequencies: 0.006764
905500 -- (-1014.093) [-1021.324] (-1013.094) (-1017.643) * (-1015.406) (-1014.010) [-1013.794] (-1017.947) -- 0:00:05
906000 -- (-1015.402) (-1029.214) (-1014.203) [-1016.753] * (-1016.550) (-1012.689) [-1014.204] (-1014.175) -- 0:00:05
906500 -- (-1016.669) [-1017.515] (-1013.190) (-1019.835) * (-1014.779) (-1015.550) (-1015.717) [-1013.380] -- 0:00:05
907000 -- [-1015.098] (-1019.371) (-1014.396) (-1021.255) * (-1015.691) [-1013.745] (-1012.897) (-1013.767) -- 0:00:05
907500 -- [-1013.647] (-1017.253) (-1013.955) (-1014.287) * (-1021.541) (-1013.460) [-1013.214] (-1018.246) -- 0:00:05
908000 -- (-1017.118) (-1013.762) [-1015.636] (-1015.261) * (-1019.429) (-1013.202) (-1014.899) [-1014.081] -- 0:00:05
908500 -- (-1013.293) (-1012.916) (-1014.407) [-1015.184] * (-1018.063) (-1016.062) [-1013.706] (-1016.850) -- 0:00:05
909000 -- (-1015.282) (-1015.379) (-1013.588) [-1017.201] * (-1013.483) (-1018.053) (-1014.081) [-1015.853] -- 0:00:05
909500 -- (-1015.270) (-1014.941) (-1016.322) [-1014.959] * [-1013.637] (-1016.487) (-1016.054) (-1016.263) -- 0:00:05
910000 -- [-1014.859] (-1019.925) (-1019.443) (-1014.623) * (-1013.673) (-1018.686) [-1014.970] (-1017.014) -- 0:00:05
Average standard deviation of split frequencies: 0.006833
910500 -- (-1014.667) (-1014.046) [-1015.977] (-1017.558) * (-1016.348) [-1015.853] (-1016.712) (-1015.690) -- 0:00:05
911000 -- (-1014.683) (-1014.178) [-1016.813] (-1013.184) * (-1015.015) [-1014.283] (-1018.337) (-1016.229) -- 0:00:05
911500 -- (-1014.367) (-1016.283) [-1013.537] (-1014.349) * [-1016.868] (-1014.356) (-1016.596) (-1013.243) -- 0:00:05
912000 -- (-1017.388) [-1015.749] (-1016.154) (-1013.896) * (-1019.173) [-1014.384] (-1017.458) (-1013.908) -- 0:00:05
912500 -- (-1015.825) (-1016.735) [-1014.090] (-1014.867) * [-1017.798] (-1015.677) (-1016.898) (-1015.532) -- 0:00:05
913000 -- (-1017.741) (-1019.235) (-1014.431) [-1014.753] * [-1013.745] (-1013.757) (-1017.036) (-1014.853) -- 0:00:05
913500 -- (-1016.346) [-1018.967] (-1014.855) (-1019.063) * (-1014.454) [-1014.790] (-1017.748) (-1016.522) -- 0:00:05
914000 -- [-1013.102] (-1021.734) (-1015.319) (-1014.906) * (-1014.290) [-1015.799] (-1018.375) (-1014.151) -- 0:00:05
914500 -- (-1015.911) [-1015.147] (-1013.285) (-1014.097) * (-1014.757) (-1017.039) (-1014.867) [-1018.154] -- 0:00:05
915000 -- (-1015.011) (-1016.638) (-1015.678) [-1013.399] * [-1014.612] (-1014.058) (-1016.147) (-1014.451) -- 0:00:05
Average standard deviation of split frequencies: 0.007033
915500 -- (-1014.790) [-1015.234] (-1013.151) (-1016.224) * (-1014.014) (-1014.721) [-1016.083] (-1013.245) -- 0:00:05
916000 -- (-1018.813) (-1018.519) [-1016.620] (-1015.609) * (-1015.403) (-1018.218) (-1015.083) [-1014.290] -- 0:00:05
916500 -- (-1015.001) (-1016.597) [-1018.402] (-1015.294) * (-1015.700) (-1014.587) (-1018.182) [-1014.208] -- 0:00:05
917000 -- (-1016.090) [-1014.514] (-1016.485) (-1014.120) * (-1016.962) (-1021.156) [-1014.978] (-1015.112) -- 0:00:05
917500 -- (-1013.873) (-1014.377) (-1015.451) [-1018.628] * (-1017.346) (-1017.877) [-1014.089] (-1015.486) -- 0:00:05
918000 -- (-1018.000) (-1016.100) (-1015.435) [-1013.570] * (-1015.150) (-1016.144) [-1016.505] (-1019.864) -- 0:00:05
918500 -- [-1013.809] (-1015.008) (-1013.998) (-1017.163) * (-1014.410) (-1013.299) [-1014.346] (-1014.926) -- 0:00:05
919000 -- [-1017.664] (-1013.133) (-1014.293) (-1016.661) * (-1015.043) [-1012.723] (-1014.191) (-1013.062) -- 0:00:05
919500 -- (-1018.141) (-1014.579) [-1013.783] (-1014.085) * (-1015.874) (-1013.433) (-1013.614) [-1014.861] -- 0:00:05
920000 -- (-1014.646) (-1015.030) (-1022.181) [-1013.620] * (-1012.876) (-1013.746) (-1013.069) [-1014.172] -- 0:00:05
Average standard deviation of split frequencies: 0.007202
920500 -- (-1015.010) (-1013.067) (-1017.646) [-1013.232] * (-1013.832) (-1014.772) (-1013.396) [-1015.310] -- 0:00:05
921000 -- [-1014.652] (-1016.794) (-1013.412) (-1017.773) * (-1017.559) (-1014.518) (-1016.224) [-1013.992] -- 0:00:04
921500 -- [-1013.571] (-1016.633) (-1013.579) (-1018.641) * (-1014.259) (-1013.042) [-1015.186] (-1013.205) -- 0:00:04
922000 -- (-1014.408) [-1014.063] (-1015.752) (-1013.510) * (-1015.025) [-1013.482] (-1014.362) (-1013.204) -- 0:00:04
922500 -- (-1015.840) (-1014.932) (-1015.209) [-1013.814] * (-1016.399) (-1014.110) (-1021.249) [-1013.444] -- 0:00:04
923000 -- [-1016.087] (-1015.271) (-1015.502) (-1014.378) * (-1016.572) (-1019.372) [-1015.254] (-1014.309) -- 0:00:04
923500 -- (-1017.658) [-1014.636] (-1015.549) (-1014.143) * (-1014.771) (-1014.156) [-1016.523] (-1012.977) -- 0:00:04
924000 -- (-1014.867) [-1016.457] (-1014.286) (-1014.074) * [-1014.698] (-1015.270) (-1017.287) (-1013.063) -- 0:00:04
924500 -- (-1016.952) (-1013.897) (-1015.029) [-1013.899] * (-1021.447) [-1014.966] (-1018.276) (-1015.144) -- 0:00:04
925000 -- (-1014.208) (-1015.758) [-1014.370] (-1015.797) * (-1013.837) (-1020.007) (-1019.832) [-1018.669] -- 0:00:04
Average standard deviation of split frequencies: 0.007602
925500 -- (-1014.202) (-1014.462) (-1015.032) [-1016.589] * (-1015.551) (-1016.262) (-1015.848) [-1015.097] -- 0:00:04
926000 -- (-1014.001) (-1015.914) [-1014.181] (-1017.436) * (-1015.417) [-1013.898] (-1013.628) (-1015.525) -- 0:00:04
926500 -- (-1015.243) [-1014.410] (-1014.767) (-1012.804) * (-1016.840) [-1014.965] (-1013.821) (-1014.687) -- 0:00:04
927000 -- (-1017.376) (-1013.390) [-1013.414] (-1016.411) * (-1013.654) [-1013.908] (-1013.368) (-1015.070) -- 0:00:04
927500 -- (-1018.877) (-1013.240) [-1014.587] (-1015.789) * (-1014.947) [-1014.662] (-1013.527) (-1014.019) -- 0:00:04
928000 -- (-1015.010) (-1014.526) (-1017.795) [-1015.039] * (-1013.358) [-1014.782] (-1017.047) (-1014.532) -- 0:00:04
928500 -- (-1013.871) [-1015.514] (-1014.747) (-1018.062) * [-1015.233] (-1014.417) (-1013.676) (-1016.815) -- 0:00:04
929000 -- (-1015.908) [-1014.770] (-1015.954) (-1018.746) * (-1015.227) [-1013.799] (-1015.080) (-1016.729) -- 0:00:04
929500 -- (-1015.708) (-1015.497) [-1017.438] (-1015.817) * (-1018.481) (-1013.735) [-1014.041] (-1018.181) -- 0:00:04
930000 -- (-1013.222) (-1015.194) [-1014.981] (-1014.707) * (-1013.567) [-1018.045] (-1016.404) (-1018.099) -- 0:00:04
Average standard deviation of split frequencies: 0.007767
930500 -- (-1014.834) (-1016.983) [-1015.912] (-1018.036) * (-1017.194) (-1014.945) (-1015.155) [-1015.248] -- 0:00:04
931000 -- (-1014.914) (-1014.700) (-1015.624) [-1013.921] * [-1013.353] (-1021.717) (-1016.143) (-1013.455) -- 0:00:04
931500 -- [-1013.000] (-1013.497) (-1014.687) (-1014.684) * (-1012.948) (-1013.567) [-1015.433] (-1013.891) -- 0:00:04
932000 -- (-1015.014) (-1018.441) [-1013.002] (-1014.066) * [-1015.075] (-1013.789) (-1020.080) (-1015.905) -- 0:00:04
932500 -- (-1013.277) [-1017.444] (-1014.491) (-1015.127) * (-1016.107) [-1018.796] (-1013.993) (-1019.527) -- 0:00:04
933000 -- (-1014.396) (-1021.739) [-1019.050] (-1016.192) * (-1016.403) (-1015.035) [-1013.949] (-1019.232) -- 0:00:04
933500 -- (-1013.083) (-1023.125) [-1012.997] (-1015.050) * (-1015.011) (-1014.493) [-1014.653] (-1019.752) -- 0:00:04
934000 -- (-1014.529) (-1021.646) [-1013.790] (-1014.255) * (-1016.401) (-1015.345) [-1016.756] (-1019.527) -- 0:00:04
934500 -- (-1014.976) (-1014.086) (-1013.225) [-1016.066] * [-1014.030] (-1017.623) (-1014.741) (-1018.437) -- 0:00:04
935000 -- (-1015.123) (-1019.264) [-1012.818] (-1019.588) * (-1017.289) (-1015.945) (-1015.930) [-1013.227] -- 0:00:04
Average standard deviation of split frequencies: 0.008125
935500 -- (-1014.935) (-1015.218) (-1013.549) [-1014.536] * (-1019.117) [-1015.365] (-1016.094) (-1019.929) -- 0:00:04
936000 -- (-1017.111) (-1014.305) (-1013.656) [-1016.171] * (-1014.513) [-1013.620] (-1017.711) (-1022.636) -- 0:00:04
936500 -- (-1013.755) [-1014.230] (-1013.271) (-1015.936) * (-1013.191) (-1016.855) [-1014.388] (-1013.839) -- 0:00:04
937000 -- [-1014.492] (-1013.252) (-1014.309) (-1016.018) * (-1014.407) (-1015.329) (-1018.817) [-1014.914] -- 0:00:03
937500 -- (-1014.847) (-1014.438) [-1014.219] (-1014.638) * (-1016.914) [-1014.429] (-1017.139) (-1013.529) -- 0:00:03
938000 -- (-1015.734) (-1014.129) [-1014.537] (-1017.285) * (-1016.497) (-1018.021) [-1017.550] (-1014.183) -- 0:00:03
938500 -- (-1017.744) (-1015.890) (-1013.919) [-1017.352] * [-1013.516] (-1014.992) (-1015.084) (-1016.885) -- 0:00:03
939000 -- (-1018.106) (-1015.347) [-1013.896] (-1016.037) * [-1014.124] (-1015.483) (-1015.998) (-1020.406) -- 0:00:03
939500 -- (-1015.525) (-1016.156) (-1015.090) [-1014.283] * (-1014.810) (-1013.047) (-1018.010) [-1015.251] -- 0:00:03
940000 -- [-1012.921] (-1016.269) (-1014.443) (-1013.629) * (-1017.278) [-1014.051] (-1023.344) (-1017.654) -- 0:00:03
Average standard deviation of split frequencies: 0.008319
940500 -- (-1013.048) (-1016.906) (-1017.326) [-1017.536] * (-1019.577) [-1014.059] (-1019.869) (-1013.387) -- 0:00:03
941000 -- (-1012.894) (-1016.357) [-1014.520] (-1014.833) * (-1015.675) (-1014.404) (-1019.011) [-1012.983] -- 0:00:03
941500 -- (-1013.592) (-1016.100) (-1016.798) [-1014.747] * [-1015.258] (-1013.266) (-1014.733) (-1013.401) -- 0:00:03
942000 -- (-1014.314) [-1014.773] (-1019.106) (-1014.155) * (-1014.558) [-1013.269] (-1018.136) (-1014.659) -- 0:00:03
942500 -- (-1019.105) (-1014.305) (-1015.948) [-1014.978] * (-1017.348) [-1016.101] (-1015.994) (-1015.311) -- 0:00:03
943000 -- (-1022.595) [-1014.798] (-1013.419) (-1014.281) * [-1014.006] (-1016.487) (-1014.029) (-1015.554) -- 0:00:03
943500 -- (-1016.122) (-1014.429) (-1015.308) [-1014.502] * [-1014.888] (-1014.200) (-1016.613) (-1013.339) -- 0:00:03
944000 -- [-1014.426] (-1014.898) (-1013.988) (-1013.546) * (-1012.808) (-1013.367) [-1014.041] (-1015.412) -- 0:00:03
944500 -- (-1013.520) [-1016.784] (-1014.534) (-1014.106) * (-1015.906) [-1015.520] (-1016.580) (-1025.797) -- 0:00:03
945000 -- [-1013.222] (-1017.130) (-1013.897) (-1017.974) * [-1013.926] (-1013.725) (-1015.497) (-1021.210) -- 0:00:03
Average standard deviation of split frequencies: 0.008272
945500 -- (-1013.080) (-1015.272) [-1016.260] (-1016.187) * [-1012.755] (-1013.597) (-1017.892) (-1014.902) -- 0:00:03
946000 -- (-1014.978) [-1013.385] (-1013.887) (-1017.181) * (-1014.353) (-1016.705) (-1015.817) [-1016.249] -- 0:00:03
946500 -- (-1014.800) (-1020.197) [-1013.181] (-1015.401) * (-1018.809) (-1014.709) (-1016.801) [-1012.876] -- 0:00:03
947000 -- (-1016.186) [-1016.630] (-1013.779) (-1014.385) * (-1015.395) (-1014.571) (-1017.217) [-1012.787] -- 0:00:03
947500 -- (-1016.496) (-1015.748) (-1015.756) [-1015.930] * (-1013.727) [-1013.906] (-1014.552) (-1014.568) -- 0:00:03
948000 -- [-1014.785] (-1016.161) (-1018.809) (-1015.306) * (-1013.233) (-1014.710) (-1013.718) [-1014.297] -- 0:00:03
948500 -- [-1016.000] (-1015.821) (-1016.263) (-1020.041) * (-1015.531) (-1018.809) (-1014.103) [-1016.677] -- 0:00:03
949000 -- [-1013.615] (-1013.340) (-1016.370) (-1014.938) * [-1017.230] (-1016.273) (-1015.134) (-1015.842) -- 0:00:03
949500 -- [-1017.013] (-1013.442) (-1015.224) (-1013.172) * (-1020.232) [-1018.986] (-1017.771) (-1014.860) -- 0:00:03
950000 -- [-1015.309] (-1015.069) (-1017.530) (-1014.853) * [-1017.629] (-1019.621) (-1015.739) (-1016.800) -- 0:00:03
Average standard deviation of split frequencies: 0.008298
950500 -- (-1015.394) [-1016.715] (-1017.383) (-1016.966) * (-1017.964) (-1016.237) [-1015.750] (-1013.433) -- 0:00:03
951000 -- (-1015.731) [-1016.519] (-1016.911) (-1016.465) * [-1014.279] (-1016.172) (-1015.413) (-1013.694) -- 0:00:03
951500 -- (-1017.335) (-1017.196) (-1018.475) [-1014.528] * (-1016.835) (-1018.376) [-1014.555] (-1013.246) -- 0:00:03
952000 -- (-1016.183) (-1020.616) (-1016.127) [-1016.716] * (-1017.387) [-1014.670] (-1014.396) (-1016.068) -- 0:00:03
952500 -- (-1015.851) [-1013.953] (-1015.690) (-1015.361) * (-1014.997) (-1013.708) [-1016.661] (-1015.947) -- 0:00:02
953000 -- [-1017.040] (-1018.645) (-1014.257) (-1016.389) * (-1014.663) [-1014.037] (-1015.437) (-1015.744) -- 0:00:02
953500 -- [-1016.696] (-1017.335) (-1015.944) (-1015.487) * (-1013.745) (-1013.442) [-1015.986] (-1022.276) -- 0:00:02
954000 -- (-1017.961) (-1017.284) (-1015.745) [-1014.140] * [-1014.586] (-1014.137) (-1017.283) (-1017.673) -- 0:00:02
954500 -- (-1016.340) (-1016.237) (-1014.110) [-1015.683] * (-1014.014) (-1014.043) [-1015.714] (-1016.900) -- 0:00:02
955000 -- [-1014.704] (-1015.005) (-1013.600) (-1015.709) * [-1013.398] (-1017.269) (-1015.909) (-1013.683) -- 0:00:02
Average standard deviation of split frequencies: 0.008251
955500 -- (-1015.216) (-1021.042) [-1014.510] (-1015.660) * (-1013.395) (-1015.880) (-1013.055) [-1016.443] -- 0:00:02
956000 -- (-1014.207) (-1016.451) (-1014.446) [-1015.369] * (-1015.475) (-1014.643) (-1015.938) [-1015.100] -- 0:00:02
956500 -- (-1016.477) (-1015.916) [-1017.002] (-1015.538) * (-1014.749) [-1014.591] (-1014.762) (-1013.853) -- 0:00:02
957000 -- (-1019.316) [-1013.959] (-1015.176) (-1018.350) * (-1014.795) (-1019.797) [-1017.060] (-1014.234) -- 0:00:02
957500 -- (-1015.490) (-1022.196) (-1016.869) [-1015.766] * (-1014.398) (-1018.553) [-1013.757] (-1019.828) -- 0:00:02
958000 -- (-1017.122) (-1016.263) (-1013.298) [-1014.860] * (-1015.383) (-1017.433) [-1014.428] (-1019.916) -- 0:00:02
958500 -- (-1018.601) (-1014.100) [-1013.922] (-1018.380) * [-1014.928] (-1015.198) (-1016.152) (-1020.447) -- 0:00:02
959000 -- (-1022.551) (-1015.941) [-1014.697] (-1014.033) * (-1014.497) [-1014.304] (-1017.283) (-1022.573) -- 0:00:02
959500 -- (-1016.399) (-1021.377) (-1013.481) [-1014.579] * (-1013.783) [-1014.512] (-1016.617) (-1016.826) -- 0:00:02
960000 -- [-1013.128] (-1019.210) (-1014.891) (-1019.736) * (-1013.768) (-1019.989) [-1015.239] (-1015.784) -- 0:00:02
Average standard deviation of split frequencies: 0.008342
960500 -- (-1014.133) [-1014.818] (-1013.609) (-1020.659) * (-1012.932) (-1019.505) (-1020.343) [-1014.246] -- 0:00:02
961000 -- (-1015.672) (-1017.110) (-1013.253) [-1013.192] * [-1016.575] (-1018.747) (-1014.774) (-1015.279) -- 0:00:02
961500 -- [-1017.711] (-1018.762) (-1013.565) (-1014.309) * (-1017.600) [-1014.809] (-1016.205) (-1017.007) -- 0:00:02
962000 -- (-1017.325) (-1018.821) [-1014.094] (-1013.863) * (-1016.692) (-1018.413) (-1016.728) [-1012.993] -- 0:00:02
962500 -- (-1015.763) (-1015.533) (-1013.940) [-1017.031] * (-1015.551) (-1016.802) (-1016.562) [-1016.182] -- 0:00:02
963000 -- (-1022.011) [-1014.912] (-1013.844) (-1016.419) * [-1013.224] (-1016.021) (-1016.801) (-1014.929) -- 0:00:02
963500 -- (-1014.585) [-1015.399] (-1016.890) (-1019.707) * [-1016.250] (-1014.112) (-1016.512) (-1013.834) -- 0:00:02
964000 -- (-1013.772) [-1014.641] (-1016.264) (-1017.571) * (-1019.451) (-1014.519) [-1013.609] (-1013.319) -- 0:00:02
964500 -- [-1019.764] (-1014.136) (-1014.377) (-1019.676) * (-1017.940) (-1015.524) (-1017.058) [-1016.127] -- 0:00:02
965000 -- (-1013.676) (-1014.251) (-1017.675) [-1018.963] * (-1017.644) (-1015.851) [-1014.617] (-1013.565) -- 0:00:02
Average standard deviation of split frequencies: 0.008101
965500 -- (-1019.403) (-1013.984) (-1018.502) [-1018.590] * (-1016.687) (-1012.888) (-1017.178) [-1014.243] -- 0:00:02
966000 -- [-1017.766] (-1014.314) (-1013.375) (-1017.052) * (-1014.364) (-1014.680) (-1017.950) [-1014.573] -- 0:00:02
966500 -- (-1018.867) [-1015.128] (-1013.101) (-1016.554) * [-1013.966] (-1013.757) (-1015.307) (-1015.131) -- 0:00:02
967000 -- (-1019.501) (-1014.748) [-1015.088] (-1014.805) * (-1018.060) (-1015.171) [-1012.992] (-1015.335) -- 0:00:02
967500 -- (-1016.381) [-1014.660] (-1013.908) (-1016.475) * [-1017.645] (-1014.939) (-1016.272) (-1014.054) -- 0:00:02
968000 -- (-1016.444) (-1015.655) (-1014.154) [-1013.434] * (-1018.007) [-1016.618] (-1016.992) (-1014.836) -- 0:00:02
968500 -- (-1013.925) [-1013.189] (-1013.248) (-1013.539) * [-1013.479] (-1017.762) (-1015.035) (-1019.198) -- 0:00:01
969000 -- (-1015.854) (-1013.205) [-1014.197] (-1013.435) * (-1013.399) (-1017.147) [-1017.336] (-1019.195) -- 0:00:01
969500 -- (-1014.885) (-1013.928) [-1013.706] (-1016.722) * (-1018.945) [-1016.545] (-1014.413) (-1018.597) -- 0:00:01
970000 -- (-1015.344) [-1014.125] (-1014.354) (-1013.923) * (-1024.531) (-1013.860) [-1014.497] (-1018.159) -- 0:00:01
Average standard deviation of split frequencies: 0.007673
970500 -- (-1017.503) [-1015.017] (-1019.419) (-1018.406) * (-1017.949) [-1013.568] (-1014.482) (-1014.158) -- 0:00:01
971000 -- (-1018.651) (-1013.256) (-1017.839) [-1016.171] * (-1015.722) (-1013.795) [-1013.574] (-1016.774) -- 0:00:01
971500 -- (-1013.949) [-1017.229] (-1015.161) (-1016.070) * (-1016.357) (-1014.767) [-1015.475] (-1013.292) -- 0:00:01
972000 -- (-1016.181) (-1014.297) [-1014.789] (-1014.634) * (-1017.128) (-1014.912) [-1013.408] (-1018.174) -- 0:00:01
972500 -- (-1017.735) [-1014.936] (-1014.415) (-1014.485) * (-1015.363) (-1013.972) [-1014.610] (-1014.189) -- 0:00:01
973000 -- [-1015.341] (-1013.637) (-1020.924) (-1014.234) * (-1014.657) [-1014.174] (-1014.643) (-1016.558) -- 0:00:01
973500 -- [-1014.724] (-1013.781) (-1017.009) (-1014.513) * (-1014.658) (-1014.888) (-1013.651) [-1014.914] -- 0:00:01
974000 -- [-1014.832] (-1012.771) (-1017.380) (-1016.138) * [-1014.067] (-1016.507) (-1013.770) (-1016.184) -- 0:00:01
974500 -- (-1014.238) [-1013.423] (-1017.904) (-1014.730) * (-1013.867) [-1014.860] (-1015.079) (-1014.300) -- 0:00:01
975000 -- (-1017.434) [-1015.804] (-1015.712) (-1016.735) * (-1016.899) [-1015.290] (-1015.120) (-1013.713) -- 0:00:01
Average standard deviation of split frequencies: 0.007760
975500 -- [-1014.573] (-1015.165) (-1017.265) (-1019.187) * (-1014.553) (-1015.887) (-1013.887) [-1017.712] -- 0:00:01
976000 -- (-1013.000) [-1015.060] (-1016.640) (-1015.575) * (-1014.126) (-1016.834) [-1014.621] (-1017.809) -- 0:00:01
976500 -- (-1013.563) [-1013.629] (-1015.440) (-1015.497) * [-1014.684] (-1016.100) (-1016.875) (-1015.670) -- 0:00:01
977000 -- (-1016.060) (-1015.007) (-1015.462) [-1015.272] * (-1016.529) (-1013.586) (-1014.469) [-1018.042] -- 0:00:01
977500 -- (-1021.742) (-1014.124) (-1013.180) [-1016.580] * (-1015.350) (-1016.885) [-1016.006] (-1019.159) -- 0:00:01
978000 -- (-1015.168) (-1015.163) (-1015.153) [-1018.273] * [-1014.019] (-1013.206) (-1013.922) (-1020.555) -- 0:00:01
978500 -- (-1018.551) (-1015.937) (-1015.380) [-1014.405] * (-1012.992) (-1014.661) [-1013.090] (-1018.444) -- 0:00:01
979000 -- (-1018.236) [-1013.216] (-1020.428) (-1016.362) * (-1014.066) [-1013.308] (-1015.291) (-1014.696) -- 0:00:01
979500 -- (-1015.874) (-1015.824) [-1013.750] (-1016.797) * (-1014.943) [-1012.826] (-1016.637) (-1017.631) -- 0:00:01
980000 -- [-1013.503] (-1014.929) (-1013.178) (-1017.492) * (-1014.202) (-1017.262) (-1015.874) [-1015.902] -- 0:00:01
Average standard deviation of split frequencies: 0.007531
980500 -- [-1013.508] (-1018.716) (-1014.884) (-1014.657) * [-1016.098] (-1017.267) (-1013.954) (-1016.180) -- 0:00:01
981000 -- (-1014.000) [-1016.093] (-1015.055) (-1014.827) * (-1016.158) (-1015.601) [-1014.139] (-1015.320) -- 0:00:01
981500 -- [-1014.935] (-1013.261) (-1016.103) (-1015.165) * (-1014.979) (-1015.920) (-1015.571) [-1014.673] -- 0:00:01
982000 -- (-1014.604) (-1015.432) [-1016.385] (-1013.406) * (-1016.515) [-1014.208] (-1015.113) (-1024.705) -- 0:00:01
982500 -- (-1014.456) (-1015.711) (-1015.633) [-1015.487] * [-1015.287] (-1015.472) (-1014.546) (-1018.239) -- 0:00:01
983000 -- (-1015.531) [-1014.591] (-1017.489) (-1014.475) * (-1015.281) (-1020.949) (-1014.134) [-1014.468] -- 0:00:01
983500 -- [-1014.773] (-1014.676) (-1018.093) (-1015.377) * (-1015.716) (-1014.504) (-1015.260) [-1014.553] -- 0:00:01
984000 -- (-1015.030) (-1013.520) (-1019.812) [-1014.710] * (-1015.765) [-1014.221] (-1015.371) (-1015.827) -- 0:00:01
984500 -- (-1017.011) [-1012.647] (-1015.264) (-1016.745) * (-1014.958) [-1017.561] (-1015.938) (-1014.616) -- 0:00:00
985000 -- (-1013.456) [-1015.021] (-1019.575) (-1017.986) * (-1015.104) (-1018.450) (-1013.762) [-1015.979] -- 0:00:00
Average standard deviation of split frequencies: 0.007331
985500 -- (-1020.378) [-1013.930] (-1013.333) (-1012.779) * (-1014.671) [-1016.672] (-1014.246) (-1017.388) -- 0:00:00
986000 -- (-1019.156) (-1014.743) [-1014.297] (-1015.434) * (-1012.954) (-1013.114) (-1015.013) [-1016.066] -- 0:00:00
986500 -- (-1016.076) (-1015.692) (-1013.890) [-1014.660] * (-1014.721) (-1013.756) (-1013.646) [-1013.727] -- 0:00:00
987000 -- (-1015.760) (-1016.283) [-1016.643] (-1016.994) * (-1013.524) (-1013.739) (-1017.347) [-1014.535] -- 0:00:00
987500 -- (-1013.429) (-1018.135) [-1019.324] (-1015.413) * [-1014.159] (-1015.002) (-1015.031) (-1018.309) -- 0:00:00
988000 -- (-1014.363) (-1015.970) (-1014.749) [-1014.772] * [-1013.889] (-1017.939) (-1015.489) (-1018.502) -- 0:00:00
988500 -- [-1014.486] (-1018.090) (-1014.478) (-1014.433) * (-1015.916) (-1014.823) (-1015.112) [-1013.981] -- 0:00:00
989000 -- (-1013.958) (-1016.729) [-1013.811] (-1019.310) * (-1019.638) [-1014.804] (-1016.245) (-1014.536) -- 0:00:00
989500 -- [-1013.428] (-1016.229) (-1013.700) (-1023.064) * (-1013.625) (-1014.309) (-1015.262) [-1014.169] -- 0:00:00
990000 -- (-1016.283) (-1016.372) [-1014.519] (-1018.679) * (-1016.800) (-1013.598) (-1013.198) [-1013.314] -- 0:00:00
Average standard deviation of split frequencies: 0.007296
990500 -- (-1013.777) (-1015.511) [-1015.076] (-1017.246) * (-1014.113) (-1014.298) [-1014.076] (-1013.253) -- 0:00:00
991000 -- [-1015.658] (-1014.443) (-1017.521) (-1022.173) * [-1013.629] (-1013.423) (-1014.403) (-1016.923) -- 0:00:00
991500 -- (-1018.052) [-1014.008] (-1016.115) (-1016.417) * (-1013.921) (-1016.632) [-1016.412] (-1014.145) -- 0:00:00
992000 -- (-1015.605) [-1014.442] (-1015.160) (-1015.269) * (-1016.016) (-1018.078) [-1015.377] (-1014.266) -- 0:00:00
992500 -- (-1019.510) [-1014.526] (-1015.699) (-1014.193) * (-1017.911) [-1014.827] (-1019.492) (-1014.124) -- 0:00:00
993000 -- [-1016.229] (-1014.203) (-1017.453) (-1013.501) * [-1014.401] (-1015.025) (-1015.733) (-1016.400) -- 0:00:00
993500 -- [-1013.522] (-1017.055) (-1013.834) (-1014.823) * (-1016.788) (-1016.125) (-1016.367) [-1015.452] -- 0:00:00
994000 -- [-1014.857] (-1013.536) (-1015.093) (-1018.484) * (-1020.606) (-1017.077) [-1015.789] (-1018.954) -- 0:00:00
994500 -- (-1016.009) (-1014.974) [-1013.717] (-1019.526) * (-1016.061) (-1015.790) [-1019.673] (-1014.830) -- 0:00:00
995000 -- (-1014.106) (-1013.900) [-1013.205] (-1020.005) * (-1014.005) (-1016.007) [-1014.349] (-1014.490) -- 0:00:00
Average standard deviation of split frequencies: 0.007383
995500 -- (-1015.051) (-1017.683) (-1013.285) [-1014.600] * (-1015.323) (-1014.638) [-1015.226] (-1013.798) -- 0:00:00
996000 -- [-1017.453] (-1017.030) (-1014.478) (-1015.358) * (-1015.527) [-1014.263] (-1014.614) (-1015.843) -- 0:00:00
996500 -- (-1014.573) (-1020.665) (-1016.438) [-1013.845] * (-1016.750) (-1014.889) [-1018.151] (-1015.990) -- 0:00:00
997000 -- (-1015.381) (-1018.322) [-1015.159] (-1015.306) * (-1016.947) [-1013.475] (-1017.762) (-1018.952) -- 0:00:00
997500 -- (-1013.641) (-1017.492) [-1016.884] (-1014.035) * (-1014.867) (-1014.697) [-1013.495] (-1015.647) -- 0:00:00
998000 -- [-1014.465] (-1014.246) (-1015.497) (-1014.672) * (-1017.763) [-1013.933] (-1015.936) (-1015.602) -- 0:00:00
998500 -- (-1018.258) [-1016.786] (-1013.999) (-1015.981) * [-1014.890] (-1016.759) (-1014.718) (-1014.216) -- 0:00:00
999000 -- (-1014.426) [-1020.201] (-1014.100) (-1018.138) * (-1016.867) [-1014.231] (-1015.412) (-1015.187) -- 0:00:00
999500 -- (-1013.999) (-1015.177) [-1014.872] (-1014.542) * (-1017.284) [-1014.666] (-1016.088) (-1013.149) -- 0:00:00
1000000 -- (-1014.344) (-1014.927) [-1015.863] (-1014.815) * (-1015.235) (-1017.609) (-1014.129) [-1013.928] -- 0:00:00
Average standard deviation of split frequencies: 0.007443
Analysis completed in 1 mins 3 seconds
Analysis used 61.87 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1012.61
Likelihood of best state for "cold" chain of run 2 was -1012.61
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.3 % ( 27 %) Dirichlet(Pi{all})
29.7 % ( 17 %) Slider(Pi{all})
79.2 % ( 55 %) Multiplier(Alpha{1,2})
78.3 % ( 50 %) Multiplier(Alpha{3})
19.9 % ( 22 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 94 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.7 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 78 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.7 % ( 15 %) Dirichlet(Pi{all})
29.3 % ( 22 %) Slider(Pi{all})
79.0 % ( 62 %) Multiplier(Alpha{1,2})
77.8 % ( 53 %) Multiplier(Alpha{3})
20.3 % ( 18 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 19 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166007 0.82 0.67
3 | 166572 166505 0.84
4 | 167059 166974 166883
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166399 0.82 0.67
3 | 167023 166843 0.84
4 | 166530 166985 166220
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1014.32
| 1 |
| 1 |
| 11 1 |
| 1 2 2 1 |
| 2 2 2221 2 2 2 2|
| 2 1 2 1 2 1 11 22 1 2 2 1 1 |
|2 1221 121*2 11 21 11 111 2*212 |
| 1 2 1 1 2 1 * 2 2 2 1 2 1 2 |
| 2 1 1 1 2 1 1 2 2 1 21 1 1|
| 2 1 * 2 2 |
| 2 2 22 1 2 1 2 2 2 |
| 1 2 2 2 2 2 1 |
|1 1 1 1 |
| 1 |
| 1 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1015.89
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1014.32 -1017.49
2 -1014.34 -1017.60
--------------------------------------
TOTAL -1014.33 -1017.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.905719 0.087922 0.373105 1.474480 0.879212 1501.00 1501.00 1.000
r(A<->C){all} 0.162913 0.020120 0.000178 0.460089 0.121007 151.35 235.56 1.000
r(A<->G){all} 0.171198 0.022876 0.000098 0.489225 0.126825 199.05 242.68 1.001
r(A<->T){all} 0.167486 0.020016 0.000159 0.440580 0.131230 265.93 425.08 1.000
r(C<->G){all} 0.165496 0.019914 0.000030 0.451304 0.127426 289.16 297.74 1.000
r(C<->T){all} 0.161103 0.017794 0.000012 0.428981 0.126170 174.47 218.96 1.001
r(G<->T){all} 0.171804 0.018203 0.000012 0.439484 0.143065 233.62 255.08 1.000
pi(A){all} 0.243196 0.000251 0.212630 0.274769 0.243203 1037.50 1122.24 1.000
pi(C){all} 0.300421 0.000270 0.269159 0.332068 0.299997 1151.04 1238.04 1.000
pi(G){all} 0.248311 0.000253 0.218013 0.279435 0.248364 1374.03 1398.28 1.000
pi(T){all} 0.208072 0.000218 0.179961 0.238491 0.207820 1352.34 1426.67 1.001
alpha{1,2} 0.419156 0.228408 0.000100 1.413318 0.244223 1159.72 1238.17 1.001
alpha{3} 0.464923 0.229214 0.000225 1.421277 0.313509 1353.77 1421.47 1.000
pinvar{all} 0.997884 0.000006 0.993281 1.000000 0.998615 1131.56 1208.46 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- .*..*.
9 -- ..**..
10 -- ...**.
11 -- .*.*..
12 -- ..****
13 -- .****.
14 -- ..*.*.
15 -- .*.***
16 -- ....**
17 -- ...*.*
18 -- .***.*
19 -- .**.**
20 -- ..*..*
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 464 0.154564 0.013191 0.145237 0.163891 2
8 451 0.150233 0.001413 0.149234 0.151233 2
9 439 0.146236 0.008009 0.140573 0.151899 2
10 438 0.145903 0.003769 0.143238 0.148568 2
11 434 0.144570 0.003769 0.141905 0.147235 2
12 431 0.143571 0.001413 0.142572 0.144570 2
13 430 0.143238 0.001884 0.141905 0.144570 2
14 428 0.142572 0.005653 0.138574 0.146569 2
15 426 0.141905 0.012248 0.133245 0.150566 2
16 426 0.141905 0.007537 0.136576 0.147235 2
17 425 0.141572 0.005182 0.137908 0.145237 2
18 422 0.140573 0.019786 0.126582 0.154564 2
19 421 0.140240 0.013662 0.130580 0.149900 2
20 415 0.138241 0.003298 0.135909 0.140573 2
21 395 0.131579 0.010835 0.123917 0.139241 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097265 0.009407 0.000020 0.291668 0.065573 1.000 2
length{all}[2] 0.099597 0.009267 0.000017 0.289695 0.070970 1.001 2
length{all}[3] 0.100103 0.009872 0.000027 0.296863 0.069777 1.000 2
length{all}[4] 0.101204 0.010130 0.000005 0.295711 0.072184 1.000 2
length{all}[5] 0.100701 0.009686 0.000069 0.299052 0.069173 1.000 2
length{all}[6] 0.099336 0.010072 0.000031 0.303787 0.066903 1.000 2
length{all}[7] 0.099734 0.008865 0.000111 0.295854 0.070739 0.998 2
length{all}[8] 0.101189 0.009973 0.000597 0.305347 0.069039 0.999 2
length{all}[9] 0.103527 0.012469 0.000101 0.343324 0.065437 1.001 2
length{all}[10] 0.097493 0.006975 0.000037 0.253230 0.077628 0.998 2
length{all}[11] 0.106433 0.010287 0.000248 0.283287 0.078565 1.002 2
length{all}[12] 0.098658 0.009029 0.000218 0.279113 0.068843 0.998 2
length{all}[13] 0.113899 0.011883 0.000066 0.305066 0.086511 0.998 2
length{all}[14] 0.093014 0.007380 0.000047 0.266164 0.064957 1.000 2
length{all}[15] 0.095553 0.008718 0.000101 0.280106 0.068074 0.998 2
length{all}[16] 0.106781 0.012033 0.000122 0.309852 0.069096 0.998 2
length{all}[17] 0.101402 0.008424 0.000230 0.301303 0.072884 0.998 2
length{all}[18] 0.105125 0.010876 0.000116 0.350372 0.076104 1.006 2
length{all}[19] 0.106261 0.010177 0.000203 0.332776 0.078225 0.998 2
length{all}[20] 0.099336 0.009955 0.000019 0.307233 0.070595 1.000 2
length{all}[21] 0.097058 0.009080 0.000020 0.287844 0.066254 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007443
Maximum standard deviation of split frequencies = 0.019786
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 735
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 245 / 245 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 245 / 245 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046859 0.029736 0.058797 0.055109 0.043038 0.088823 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1038.230173
Iterating by ming2
Initial: fx= 1038.230173
x= 0.04686 0.02974 0.05880 0.05511 0.04304 0.08882 0.30000 1.30000
1 h-m-p 0.0000 0.0001 589.7032 ++ 995.358356 m 0.0001 13 | 1/8
2 h-m-p 0.0030 0.0189 22.3718 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 540.8773 ++ 979.207021 m 0.0001 45 | 2/8
4 h-m-p 0.0020 0.1730 13.3111 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 484.6420 ++ 975.482232 m 0.0000 77 | 3/8
6 h-m-p 0.0156 7.7891 11.0406 -------------.. | 3/8
7 h-m-p 0.0000 0.0000 419.6023 ++ 969.442330 m 0.0000 110 | 4/8
8 h-m-p 0.0160 8.0000 8.8270 -------------.. | 4/8
9 h-m-p 0.0000 0.0000 342.7339 ++ 967.640528 m 0.0000 143 | 5/8
10 h-m-p 0.0160 8.0000 6.0603 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 241.8229 ++ 960.276239 m 0.0001 176 | 6/8
12 h-m-p 0.1148 8.0000 0.0000 ++++ 960.276239 m 8.0000 189 | 6/8
13 h-m-p 0.0691 8.0000 0.0012 ++++ 960.276239 m 8.0000 204 | 6/8
14 h-m-p 0.0220 7.7171 0.4232 +++Y 960.276237 0 1.0317 220 | 6/8
15 h-m-p 1.6000 8.0000 0.0140 Y 960.276237 0 1.0678 233 | 6/8
16 h-m-p 1.6000 8.0000 0.0004 --------C 960.276237 0 0.0000 254
Out..
lnL = -960.276237
255 lfun, 255 eigenQcodon, 1530 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037304 0.064080 0.045109 0.086105 0.017834 0.086328 0.722997 0.878442 0.378339
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.921023
np = 9
lnL0 = -1040.741800
Iterating by ming2
Initial: fx= 1040.741800
x= 0.03730 0.06408 0.04511 0.08611 0.01783 0.08633 0.72300 0.87844 0.37834
1 h-m-p 0.0000 0.0001 575.4704 ++ 1015.653852 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 582.5947 ++ 992.316133 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 2576.8146 ++ 985.000790 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0002 397.9727 ++ 970.573835 m 0.0002 50 | 4/9
5 h-m-p 0.0000 0.0000 17367.3018 ++ 960.324600 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 463.2232 ++ 960.276260 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0004 ----------------.. | 6/9
8 h-m-p 0.0160 8.0000 0.0001 +++++ 960.276260 m 8.0000 118 | 6/9
9 h-m-p 0.0088 4.3958 0.2267 +++++ 960.276240 m 4.3958 136 | 7/9
10 h-m-p 1.6000 8.0000 0.0222 ++ 960.276240 m 8.0000 151 | 7/9
11 h-m-p 0.0339 0.1695 3.9316 ++ 960.276239 m 0.1695 165 | 7/9
12 h-m-p 0.0529 0.2645 4.0042 --------Y 960.276239 0 0.0000 185 | 7/9
13 h-m-p 0.3030 8.0000 0.0000 -C 960.276239 0 0.0189 198 | 8/9
14 h-m-p 0.0987 8.0000 0.0000 -Y 960.276239 0 0.0062 213
Out..
lnL = -960.276239
214 lfun, 642 eigenQcodon, 2568 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027147 0.020232 0.102509 0.030901 0.089547 0.063815 0.770095 1.127304 0.376950 0.218002 1.289018
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.731632
np = 11
lnL0 = -1037.044660
Iterating by ming2
Initial: fx= 1037.044660
x= 0.02715 0.02023 0.10251 0.03090 0.08955 0.06381 0.77009 1.12730 0.37695 0.21800 1.28902
1 h-m-p 0.0000 0.0001 532.9781 ++ 1010.299445 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0002 234.8733 ++ 1002.106300 m 0.0002 30 | 2/11
3 h-m-p 0.0000 0.0000 709.0571 ++ 998.962225 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0001 2106.6238 ++ 977.150747 m 0.0001 58 | 4/11
5 h-m-p 0.0000 0.0000 51965.9538 ++ 972.102406 m 0.0000 72 | 5/11
6 h-m-p 0.0014 0.0093 12.6199 -----------.. | 5/11
7 h-m-p 0.0000 0.0001 331.4083 ++ 963.860080 m 0.0001 109 | 6/11
8 h-m-p 0.0031 0.6355 5.5042 ------------.. | 6/11
9 h-m-p 0.0000 0.0001 240.4517 ++ 960.276254 m 0.0001 147 | 7/11
10 h-m-p 0.0548 8.0000 0.0000 ++++ 960.276254 m 8.0000 163 | 7/11
11 h-m-p 0.0160 8.0000 0.0136 +++++ 960.276252 m 8.0000 184 | 7/11
12 h-m-p 0.1202 2.1666 0.9039 ++Y 960.276243 0 1.6211 204 | 7/11
13 h-m-p 1.6000 8.0000 0.0570 C 960.276243 0 1.7575 222 | 7/11
14 h-m-p 1.6000 8.0000 0.0053 Y 960.276243 0 0.9129 240 | 7/11
15 h-m-p 1.6000 8.0000 0.0007 +C 960.276243 0 6.4000 259 | 7/11
16 h-m-p 1.6000 8.0000 0.0006 ++ 960.276243 m 8.0000 277 | 7/11
17 h-m-p 0.1488 8.0000 0.0313 ++C 960.276243 0 2.7994 297 | 7/11
18 h-m-p 1.6000 8.0000 0.0040 ++ 960.276242 m 8.0000 315 | 7/11
19 h-m-p 0.0381 0.8081 0.8362 --------------.. | 7/11
20 h-m-p 0.0160 8.0000 0.0000 ----N 960.276242 0 0.0000 367
Out..
lnL = -960.276242
368 lfun, 1472 eigenQcodon, 6624 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -960.283996 S = -960.271862 -0.004645
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:03
did 20 / 58 patterns 0:03
did 30 / 58 patterns 0:03
did 40 / 58 patterns 0:03
did 50 / 58 patterns 0:03
did 58 / 58 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072535 0.034183 0.085322 0.048821 0.046942 0.088858 0.220745 0.386308 1.114280
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.183337
np = 9
lnL0 = -1045.639602
Iterating by ming2
Initial: fx= 1045.639602
x= 0.07253 0.03418 0.08532 0.04882 0.04694 0.08886 0.22074 0.38631 1.11428
1 h-m-p 0.0000 0.0002 518.4294 ++ 1001.081262 m 0.0002 14 | 1/9
2 h-m-p 0.0010 0.0048 61.6937 ++ 985.592961 m 0.0048 26 | 2/9
3 h-m-p 0.0000 0.0000 1068.0770 ++ 984.389516 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 44074.7715 ++ 977.106740 m 0.0000 50 | 4/9
5 h-m-p 0.0001 0.0007 79.1044 ++ 973.257303 m 0.0007 62 | 5/9
6 h-m-p 0.0000 0.0001 129.3147 ++ 969.850539 m 0.0001 74 | 6/9
7 h-m-p 0.0001 0.0007 30.8067 ++ 969.197311 m 0.0007 86 | 7/9
8 h-m-p 0.0160 8.0000 2.5214 -------------.. | 7/9
9 h-m-p 0.0000 0.0002 232.4547 +++ 960.276241 m 0.0002 122 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 Y 960.276241 0 1.6000 134 | 8/9
11 h-m-p 0.0160 8.0000 0.0000 Y 960.276241 0 0.0160 147
Out..
lnL = -960.276241
148 lfun, 1628 eigenQcodon, 8880 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.029384 0.074844 0.019248 0.055327 0.095775 0.014423 0.000100 0.900000 1.102371 1.882896 1.117082
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.731016
np = 11
lnL0 = -1027.374289
Iterating by ming2
Initial: fx= 1027.374289
x= 0.02938 0.07484 0.01925 0.05533 0.09578 0.01442 0.00011 0.90000 1.10237 1.88290 1.11708
1 h-m-p 0.0000 0.0000 546.3364 ++ 1026.479501 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0016 123.4589 ++++ 1005.320488 m 0.0016 32 | 2/11
3 h-m-p 0.0000 0.0001 393.7736 ++ 999.486294 m 0.0001 46 | 3/11
4 h-m-p 0.0002 0.0012 130.6521 ++ 991.646318 m 0.0012 60 | 4/11
5 h-m-p 0.0000 0.0002 804.0564 ++ 976.203348 m 0.0002 74 | 5/11
6 h-m-p 0.0002 0.0008 505.7890 ++ 966.218539 m 0.0008 88 | 6/11
7 h-m-p 0.0000 0.0000 48478.4073 ++ 960.276244 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 960.276244 m 8.0000 116 | 7/11
9 h-m-p 1.1849 8.0000 0.0003 ++ 960.276244 m 8.0000 134 | 7/11
10 h-m-p 0.0037 1.8491 0.8657 +++++ 960.276243 m 1.8491 155 | 8/11
11 h-m-p 0.1969 0.9844 0.3412 ++ 960.276243 m 0.9844 173 | 9/11
12 h-m-p 0.0317 0.1584 9.6879 +
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143482e-160 2000 rounds
+ 960.276241 m 0.1584 190
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143482e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143482e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143482e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143482e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143482e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143482e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143482e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143482e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27735) = 1.183400e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143481e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27735) = 1.143482e-160 2000 rounds
| 10/11
13 h-m-p 1.6000 8.0000 0.1271
QuantileBeta(0.15, 0.00500, 2.22653) = 1.176254e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.26465) = 1.151504e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27418) = 1.145477e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27656) = 1.143980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27636) = 1.144104e-160 2000 rounds
C 960.276241 0 0.0063 207
QuantileBeta(0.15, 0.00500, 2.27656) = 1.143980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27656) = 1.143980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27656) = 1.143980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27656) = 1.143980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27656) = 1.143980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27656) = 1.143980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27656) = 1.143980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27656) = 1.143980e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27656) = 1.183916e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27668) = 1.143902e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27644) = 1.144058e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27656) = 1.143980e-160 2000 rounds
| 10/11
14 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144004e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144078e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27650) = 1.144018e-160 2000 rounds
C 960.276241 0 1.6000 222
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144004e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144004e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144004e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144004e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144004e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144004e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144004e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144004e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27652) = 1.183941e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27664) = 1.143926e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144004e-160 2000 rounds
| 10/11
15 h-m-p 0.0160 8.0000 4.8904
QuantileBeta(0.15, 0.00500, 2.35477) = 1.096894e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29608) = 1.131855e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.28141) = 1.140943e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27774) = 1.143237e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27683) = 1.143812e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27660) = 1.143956e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27654) = 1.143992e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27652) = 1.144003e-160 2000 rounds
N 960.276241 0 0.0000 243
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.183938e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144000e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
| 10/11
16 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
N 960.276241 0 1.6000 257
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.183938e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27665) = 1.143923e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27640) = 1.144079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
| 10/11
17 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
N 960.276241 0 0.0010 273
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
Out..
lnL = -960.276241
274 lfun, 3288 eigenQcodon, 18084 P(t)
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -960.356847 S = -960.277506 -0.035440
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:10
did 20 / 58 patterns 0:10
did 30 / 58 patterns 0:10
did 40 / 58 patterns 0:11
did 50 / 58 patterns 0:11
did 58 / 58 patterns 0:11
QuantileBeta(0.15, 0.00500, 2.27653) = 1.144001e-160 2000 rounds
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=245
NC_011896_1_WP_010908907_1_2619_MLBR_RS12460 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
NC_002677_1_NP_302588_1_1460_ML2450 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA
**************************************************
NC_011896_1_WP_010908907_1_2619_MLBR_RS12460 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
NC_002677_1_NP_302588_1_1460_ML2450 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805 TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD
**************************************************
NC_011896_1_WP_010908907_1_2619_MLBR_RS12460 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
NC_002677_1_NP_302588_1_1460_ML2450 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805 TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI
**************************************************
NC_011896_1_WP_010908907_1_2619_MLBR_RS12460 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
NC_002677_1_NP_302588_1_1460_ML2450 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805 ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL
**************************************************
NC_011896_1_WP_010908907_1_2619_MLBR_RS12460 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
NC_002677_1_NP_302588_1_1460_ML2450 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805 TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
*********************************************
>NC_011896_1_WP_010908907_1_2619_MLBR_RS12460 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC >NC_002677_1_NP_302588_1_1460_ML2450 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC >NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC >NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC >NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC >NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805 TTGCTTCGCGACCCACTCGCCATCGTCCTGATCTTGATCATAGTGGTTGC GCTCGTCATCAGCGGGCTAATCGGAGCCGAACTTTTTGCCCGCCACACCG CAAACAGCAAAGTCGCTAGAGTGGTGACCTGCGAGATCAAAGATCAGGCC ACCGCGAAGTTCGGTGTGACACCATTATTGCTCTGGCAGTTCGCTACCCA ACATTTCACCAACATCTCCGTGGAGACCGCAGGTAACCAGATTCGTGATG CCAAAGGCATGAAGATCGCGATAGACATTCAGAATGTGCAGATCAGAGAC ACTCCGACTTCGAGGGGCACGATCGGCGTGTTGGATGCCATCATCACCTG GTCTTCTGATGGCATCAGGCAATCGGTGCAGAACTCGATTCCGGTACTTG GCGGCGTTGTCACCACCAGTGTGACCACTCATCCCACCAATGGCACCATC GAGCTGAAAGGAATGCTGAACGACATTGTGGCTAAGCCGGTGGTGTCCAA CGGTGGCCTGCAGCTACAGATCGTCAGTTTTAATACACTGGGATTCTCGC TGCCGAAAGAGACCGTGCAATTCACCCTGGACGATTTCACCACCAACCTA ACCAAGAACTACCCCCTGGGCATCCACGCGGACAACGTGGAGGTCACTTC GACCGGCGTGACAAGCCACTTCTCAGCCCGGAACACTAATATCCCCAACA GCACAGGCGGTCAGGACCCCTGTTTCGCTAACCTC
>NC_011896_1_WP_010908907_1_2619_MLBR_RS12460 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL >NC_002677_1_NP_302588_1_1460_ML2450 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL >NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL >NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL >NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL >NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805 LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQA TAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRD TPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTI ELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNL TKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
#NEXUS
[ID: 5532125100]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908907_1_2619_MLBR_RS12460
NC_002677_1_NP_302588_1_1460_ML2450
NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235
NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660
NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475
NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908907_1_2619_MLBR_RS12460,
2 NC_002677_1_NP_302588_1_1460_ML2450,
3 NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235,
4 NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660,
5 NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475,
6 NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0655725,2:0.07097027,3:0.0697768,4:0.07218447,5:0.0691726,6:0.06690331);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0655725,2:0.07097027,3:0.0697768,4:0.07218447,5:0.0691726,6:0.06690331);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1014.32 -1017.49
2 -1014.34 -1017.60
--------------------------------------
TOTAL -1014.33 -1017.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2450/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.905719 0.087922 0.373105 1.474480 0.879212 1501.00 1501.00 1.000
r(A<->C){all} 0.162913 0.020120 0.000178 0.460089 0.121007 151.35 235.56 1.000
r(A<->G){all} 0.171198 0.022876 0.000098 0.489225 0.126825 199.05 242.68 1.001
r(A<->T){all} 0.167486 0.020016 0.000159 0.440580 0.131230 265.93 425.08 1.000
r(C<->G){all} 0.165496 0.019914 0.000030 0.451304 0.127426 289.16 297.74 1.000
r(C<->T){all} 0.161103 0.017794 0.000012 0.428981 0.126170 174.47 218.96 1.001
r(G<->T){all} 0.171804 0.018203 0.000012 0.439484 0.143065 233.62 255.08 1.000
pi(A){all} 0.243196 0.000251 0.212630 0.274769 0.243203 1037.50 1122.24 1.000
pi(C){all} 0.300421 0.000270 0.269159 0.332068 0.299997 1151.04 1238.04 1.000
pi(G){all} 0.248311 0.000253 0.218013 0.279435 0.248364 1374.03 1398.28 1.000
pi(T){all} 0.208072 0.000218 0.179961 0.238491 0.207820 1352.34 1426.67 1.001
alpha{1,2} 0.419156 0.228408 0.000100 1.413318 0.244223 1159.72 1238.17 1.001
alpha{3} 0.464923 0.229214 0.000225 1.421277 0.313509 1353.77 1421.47 1.000
pinvar{all} 0.997884 0.000006 0.993281 1.000000 0.998615 1131.56 1208.46 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2450/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 245
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 8 8 8 8 8 8 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 4 4 4 4 4 4 | CCC 4 4 4 4 4 4 | CAC 3 3 3 3 3 3 | CGC 2 2 2 2 2 2
CTA 3 3 3 3 3 3 | CCA 2 2 2 2 2 2 | Gln CAA 3 3 3 3 3 3 | CGA 0 0 0 0 0 0
CTG 8 8 8 8 8 8 | CCG 4 4 4 4 4 4 | CAG 9 9 9 9 9 9 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 5 5 5 5 5 5 | Asn AAT 4 4 4 4 4 4 | Ser AGT 2 2 2 2 2 2
ATC 17 17 17 17 17 17 | ACC 18 18 18 18 18 18 | AAC 12 12 12 12 12 12 | AGC 4 4 4 4 4 4
ATA 2 2 2 2 2 2 | ACA 4 4 4 4 4 4 | Lys AAA 5 5 5 5 5 5 | Arg AGA 2 2 2 2 2 2
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 4 4 4 4 4 4 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 4 4 4 4 4 4 | Asp GAT 5 5 5 5 5 5 | Gly GGT 4 4 4 4 4 4
GTC 6 6 6 6 6 6 | GCC 7 7 7 7 7 7 | GAC 7 7 7 7 7 7 | GGC 11 11 11 11 11 11
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 1 1 1 1 1 1 | GGA 3 3 3 3 3 3
GTG 15 15 15 15 15 15 | GCG 4 4 4 4 4 4 | GAG 5 5 5 5 5 5 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908907_1_2619_MLBR_RS12460
position 1: T:0.12245 C:0.20000 A:0.35918 G:0.31837
position 2: T:0.33469 C:0.26531 A:0.24898 G:0.15102
position 3: T:0.16735 C:0.43673 A:0.12245 G:0.27347
Average T:0.20816 C:0.30068 A:0.24354 G:0.24762
#2: NC_002677_1_NP_302588_1_1460_ML2450
position 1: T:0.12245 C:0.20000 A:0.35918 G:0.31837
position 2: T:0.33469 C:0.26531 A:0.24898 G:0.15102
position 3: T:0.16735 C:0.43673 A:0.12245 G:0.27347
Average T:0.20816 C:0.30068 A:0.24354 G:0.24762
#3: NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235
position 1: T:0.12245 C:0.20000 A:0.35918 G:0.31837
position 2: T:0.33469 C:0.26531 A:0.24898 G:0.15102
position 3: T:0.16735 C:0.43673 A:0.12245 G:0.27347
Average T:0.20816 C:0.30068 A:0.24354 G:0.24762
#4: NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660
position 1: T:0.12245 C:0.20000 A:0.35918 G:0.31837
position 2: T:0.33469 C:0.26531 A:0.24898 G:0.15102
position 3: T:0.16735 C:0.43673 A:0.12245 G:0.27347
Average T:0.20816 C:0.30068 A:0.24354 G:0.24762
#5: NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475
position 1: T:0.12245 C:0.20000 A:0.35918 G:0.31837
position 2: T:0.33469 C:0.26531 A:0.24898 G:0.15102
position 3: T:0.16735 C:0.43673 A:0.12245 G:0.27347
Average T:0.20816 C:0.30068 A:0.24354 G:0.24762
#6: NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805
position 1: T:0.12245 C:0.20000 A:0.35918 G:0.31837
position 2: T:0.33469 C:0.26531 A:0.24898 G:0.15102
position 3: T:0.16735 C:0.43673 A:0.12245 G:0.27347
Average T:0.20816 C:0.30068 A:0.24354 G:0.24762
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 12 | Tyr Y TAT 0 | Cys C TGT 6
TTC 48 | TCC 12 | TAC 6 | TGC 6
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 30 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 6
CTC 24 | CCC 24 | CAC 18 | CGC 12
CTA 18 | CCA 12 | Gln Q CAA 18 | CGA 0
CTG 48 | CCG 24 | CAG 54 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 30 | Asn N AAT 24 | Ser S AGT 12
ATC 102 | ACC 108 | AAC 72 | AGC 24
ATA 12 | ACA 24 | Lys K AAA 30 | Arg R AGA 12
Met M ATG 12 | ACG 6 | AAG 24 | AGG 12
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 24 | Asp D GAT 30 | Gly G GGT 24
GTC 36 | GCC 42 | GAC 42 | GGC 66
GTA 6 | GCA 12 | Glu E GAA 6 | GGA 18
GTG 90 | GCG 24 | GAG 30 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12245 C:0.20000 A:0.35918 G:0.31837
position 2: T:0.33469 C:0.26531 A:0.24898 G:0.15102
position 3: T:0.16735 C:0.43673 A:0.12245 G:0.27347
Average T:0.20816 C:0.30068 A:0.24354 G:0.24762
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -960.276237 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.722997 1.117082
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908907_1_2619_MLBR_RS12460: 0.000004, NC_002677_1_NP_302588_1_1460_ML2450: 0.000004, NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235: 0.000004, NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660: 0.000004, NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475: 0.000004, NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.72300
omega (dN/dS) = 1.11708
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 582.7 152.3 1.1171 0.0000 0.0000 0.0 0.0
7..2 0.000 582.7 152.3 1.1171 0.0000 0.0000 0.0 0.0
7..3 0.000 582.7 152.3 1.1171 0.0000 0.0000 0.0 0.0
7..4 0.000 582.7 152.3 1.1171 0.0000 0.0000 0.0 0.0
7..5 0.000 582.7 152.3 1.1171 0.0000 0.0000 0.0 0.0
7..6 0.000 582.7 152.3 1.1171 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -960.276239 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.770095 0.000010 0.000002
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908907_1_2619_MLBR_RS12460: 0.000004, NC_002677_1_NP_302588_1_1460_ML2450: 0.000004, NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235: 0.000004, NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660: 0.000004, NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475: 0.000004, NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.77009
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 582.1 152.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 582.1 152.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 582.1 152.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 582.1 152.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 582.1 152.9 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 582.1 152.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -960.276242 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.220745 0.187780 0.600768 0.000001 1.565511
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908907_1_2619_MLBR_RS12460: 0.000004, NC_002677_1_NP_302588_1_1460_ML2450: 0.000004, NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235: 0.000004, NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660: 0.000004, NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475: 0.000004, NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.22074
MLEs of dN/dS (w) for site classes (K=3)
p: 0.18778 0.60077 0.21145
w: 0.00000 1.00000 1.56551
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 591.7 143.3 0.9318 0.0000 0.0000 0.0 0.0
7..2 0.000 591.7 143.3 0.9318 0.0000 0.0000 0.0 0.0
7..3 0.000 591.7 143.3 0.9318 0.0000 0.0000 0.0 0.0
7..4 0.000 591.7 143.3 0.9318 0.0000 0.0000 0.0 0.0
7..5 0.000 591.7 143.3 0.9318 0.0000 0.0000 0.0 0.0
7..6 0.000 591.7 143.3 0.9318 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908907_1_2619_MLBR_RS12460)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908907_1_2619_MLBR_RS12460)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -960.276241 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.998687
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908907_1_2619_MLBR_RS12460: 0.000004, NC_002677_1_NP_302588_1_1460_ML2450: 0.000004, NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235: 0.000004, NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660: 0.000004, NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475: 0.000004, NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.99869
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -960.276241 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 2.276525 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908907_1_2619_MLBR_RS12460: 0.000004, NC_002677_1_NP_302588_1_1460_ML2450: 0.000004, NZ_LVXE01000039_1_WP_010908907_1_1686_A3216_RS10235: 0.000004, NZ_LYPH01000045_1_WP_010908907_1_1816_A8144_RS08660: 0.000004, NZ_CP029543_1_WP_010908907_1_2646_DIJ64_RS13475: 0.000004, NZ_AP014567_1_WP_010908907_1_2712_JK2ML_RS13805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.27653
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 597.2 137.8 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908907_1_2619_MLBR_RS12460)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.106 0.104 0.103 0.102 0.101 0.099 0.098 0.097 0.096 0.095
Time used: 0:11
Model 1: NearlyNeutral -960.276239 Model 2: PositiveSelection -960.276242 Model 0: one-ratio -960.276237 Model 7: beta -960.276241 Model 8: beta&w>1 -960.276241 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 5.999999984851456E-6 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
