--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 10:01:15 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2659/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1446.77         -1451.09
2      -1446.73         -1450.01
--------------------------------------
TOTAL    -1446.75         -1450.69
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.899213    0.087078    0.374652    1.477138    0.866113   1501.00   1501.00    1.003
r(A<->C){all}   0.164700    0.017427    0.000001    0.412857    0.134192    169.54    208.65    1.000
r(A<->G){all}   0.172620    0.021062    0.000021    0.455991    0.135891    179.71    182.23    1.006
r(A<->T){all}   0.167407    0.019618    0.000125    0.437982    0.132397    152.04    196.91    1.003
r(C<->G){all}   0.160343    0.019081    0.000013    0.438950    0.123693    102.06    152.72    1.007
r(C<->T){all}   0.172581    0.021753    0.000093    0.479313    0.133334    223.01    238.99    1.001
r(G<->T){all}   0.162349    0.017358    0.000030    0.428979    0.132177    301.52    309.52    1.002
pi(A){all}      0.187703    0.000148    0.164153    0.211451    0.187694   1404.95   1426.42    1.000
pi(C){all}      0.292651    0.000215    0.264262    0.321011    0.292430   1250.79   1309.08    1.001
pi(G){all}      0.317760    0.000203    0.289162    0.344480    0.317485   1259.44   1262.37    1.000
pi(T){all}      0.201885    0.000155    0.177079    0.225388    0.201623   1289.29   1395.14    1.000
alpha{1,2}      0.419714    0.240862    0.000139    1.405847    0.251566   1121.48   1190.66    1.000
alpha{3}        0.462653    0.253491    0.000103    1.443979    0.292625   1321.50   1411.25    1.000
pinvar{all}     0.998578    0.000003    0.995541    1.000000    0.999124    979.98   1164.20    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1394.57163
Model 2: PositiveSelection	-1394.571628
Model 0: one-ratio	-1394.571646
Model 7: beta	-1394.571661
Model 8: beta&w>1	-1394.571599


Model 0 vs 1	3.200000037395512E-5

Model 2 vs 1	3.999999989900971E-6

Model 8 vs 7	1.239999996869301E-4
>C1
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C2
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C3
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C4
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C5
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C6
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=354 

C1              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C2              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C3              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C4              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C5              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C6              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
                **************************************************

C1              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C2              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C3              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C4              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C5              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C6              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
                **************************************************

C1              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C2              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C3              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C4              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C5              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C6              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
                **************************************************

C1              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C2              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C3              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C4              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C5              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C6              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
                **************************************************

C1              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C2              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C3              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C4              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C5              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C6              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
                **************************************************

C1              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C2              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C3              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C4              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C5              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C6              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
                **************************************************

C1              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C2              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C3              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C4              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C5              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C6              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
                **************************************************

C1              GPPA
C2              GPPA
C3              GPPA
C4              GPPA
C5              GPPA
C6              GPPA
                ****




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  354 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  354 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10620]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [10620]--->[10620]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.521 Mb, Max= 30.926 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C2              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C3              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C4              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C5              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C6              MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
                **************************************************

C1              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C2              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C3              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C4              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C5              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C6              LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
                **************************************************

C1              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C2              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C3              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C4              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C5              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C6              TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
                **************************************************

C1              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C2              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C3              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C4              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C5              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C6              EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
                **************************************************

C1              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C2              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C3              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C4              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C5              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C6              APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
                **************************************************

C1              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C2              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C3              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C4              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C5              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C6              AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
                **************************************************

C1              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C2              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C3              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C4              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C5              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C6              DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
                **************************************************

C1              GPPA
C2              GPPA
C3              GPPA
C4              GPPA
C5              GPPA
C6              GPPA
                ****




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
C2              ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
C3              ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
C4              ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
C5              ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
C6              ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
                **************************************************

C1              ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
C2              ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
C3              ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
C4              ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
C5              ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
C6              ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
                **************************************************

C1              CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
C2              CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
C3              CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
C4              CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
C5              CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
C6              CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
                **************************************************

C1              CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
C2              CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
C3              CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
C4              CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
C5              CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
C6              CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
                **************************************************

C1              CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
C2              CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
C3              CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
C4              CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
C5              CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
C6              CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
                **************************************************

C1              TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
C2              TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
C3              TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
C4              TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
C5              TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
C6              TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
                **************************************************

C1              ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
C2              ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
C3              ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
C4              ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
C5              ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
C6              ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
                **************************************************

C1              CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
C2              CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
C3              CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
C4              CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
C5              CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
C6              CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
                **************************************************

C1              GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
C2              GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
C3              GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
C4              GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
C5              GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
C6              GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
                **************************************************

C1              GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
C2              GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
C3              GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
C4              GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
C5              GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
C6              GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
                **************************************************

C1              CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
C2              CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
C3              CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
C4              CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
C5              CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
C6              CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
                **************************************************

C1              AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
C2              AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
C3              AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
C4              AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
C5              AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
C6              AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
                **************************************************

C1              GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
C2              GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
C3              GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
C4              GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
C5              GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
C6              GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
                **************************************************

C1              TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
C2              TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
C3              TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
C4              TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
C5              TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
C6              TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
                **************************************************

C1              GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
C2              GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
C3              GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
C4              GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
C5              GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
C6              GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
                **************************************************

C1              GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
C2              GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
C3              GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
C4              GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
C5              GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
C6              GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
                **************************************************

C1              CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
C2              CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
C3              CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
C4              CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
C5              CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
C6              CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
                **************************************************

C1              CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
C2              CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
C3              CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
C4              CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
C5              CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
C6              CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
                **************************************************

C1              GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
C2              GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
C3              GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
C4              GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
C5              GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
C6              GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
                **************************************************

C1              GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
C2              GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
C3              GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
C4              GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
C5              GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
C6              GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
                **************************************************

C1              ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
C2              ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
C3              ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
C4              ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
C5              ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
C6              ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
                **************************************************

C1              GGACCTCCAGCT
C2              GGACCTCCAGCT
C3              GGACCTCCAGCT
C4              GGACCTCCAGCT
C5              GGACCTCCAGCT
C6              GGACCTCCAGCT
                ************



>C1
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C2
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C3
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C4
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C5
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C6
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C1
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C2
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C3
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C4
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C5
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C6
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1062 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859992
      Setting output file names to "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 251696473
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5927439121
      Seed = 1691571732
      Swapseed = 1579859992
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2376.806775 -- -24.965149
         Chain 2 -- -2376.806775 -- -24.965149
         Chain 3 -- -2376.806550 -- -24.965149
         Chain 4 -- -2376.806912 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2376.806775 -- -24.965149
         Chain 2 -- -2376.806912 -- -24.965149
         Chain 3 -- -2376.806912 -- -24.965149
         Chain 4 -- -2376.806912 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2376.807] (-2376.807) (-2376.807) (-2376.807) * [-2376.807] (-2376.807) (-2376.807) (-2376.807) 
        500 -- (-1460.445) (-1460.537) (-1472.435) [-1467.717] * (-1467.196) (-1474.976) [-1454.691] (-1461.149) -- 0:00:00
       1000 -- [-1461.425] (-1451.327) (-1464.957) (-1463.080) * [-1462.243] (-1452.716) (-1453.165) (-1463.048) -- 0:00:00
       1500 -- (-1465.305) (-1453.603) [-1459.615] (-1460.379) * [-1453.786] (-1451.298) (-1458.954) (-1461.069) -- 0:00:00
       2000 -- (-1458.184) [-1453.695] (-1453.398) (-1456.272) * (-1460.162) [-1462.270] (-1457.369) (-1451.604) -- 0:00:00
       2500 -- (-1452.946) [-1454.223] (-1459.183) (-1461.392) * (-1453.424) (-1463.202) [-1455.005] (-1456.812) -- 0:00:00
       3000 -- (-1456.543) (-1453.270) [-1451.757] (-1461.687) * (-1458.232) [-1452.646] (-1456.816) (-1463.057) -- 0:00:00
       3500 -- (-1456.697) (-1457.738) [-1454.142] (-1463.031) * (-1456.268) (-1464.285) (-1453.864) [-1456.451] -- 0:00:00
       4000 -- (-1454.957) (-1459.004) (-1456.489) [-1458.038] * (-1455.804) (-1460.621) (-1454.697) [-1455.482] -- 0:00:00
       4500 -- (-1466.160) (-1456.506) [-1452.484] (-1454.231) * (-1456.216) (-1455.292) [-1457.216] (-1459.777) -- 0:00:00
       5000 -- [-1458.092] (-1450.595) (-1459.619) (-1456.720) * (-1469.604) [-1454.375] (-1452.177) (-1451.227) -- 0:00:00

      Average standard deviation of split frequencies: 0.067344

       5500 -- [-1456.391] (-1453.248) (-1458.379) (-1456.464) * (-1448.345) (-1455.304) [-1453.455] (-1459.362) -- 0:00:00
       6000 -- [-1455.405] (-1465.265) (-1459.905) (-1453.795) * (-1446.390) (-1455.927) [-1451.958] (-1461.459) -- 0:00:00
       6500 -- (-1453.426) (-1468.455) [-1457.448] (-1457.610) * (-1445.679) (-1455.145) [-1456.081] (-1458.667) -- 0:00:00
       7000 -- (-1461.336) (-1460.075) (-1455.982) [-1454.500] * [-1445.739] (-1458.107) (-1454.323) (-1468.189) -- 0:00:00
       7500 -- (-1452.287) (-1458.223) [-1456.508] (-1453.792) * [-1446.718] (-1458.564) (-1454.302) (-1457.573) -- 0:00:00
       8000 -- (-1466.302) [-1451.249] (-1455.447) (-1456.872) * (-1445.664) [-1467.639] (-1468.921) (-1462.284) -- 0:00:00
       8500 -- (-1449.724) [-1452.792] (-1459.614) (-1455.325) * [-1446.045] (-1458.733) (-1460.146) (-1459.018) -- 0:00:00
       9000 -- (-1447.337) (-1457.879) [-1455.084] (-1455.922) * (-1445.290) (-1469.581) (-1467.890) [-1451.592] -- 0:01:50
       9500 -- [-1447.338] (-1462.237) (-1464.609) (-1458.148) * (-1445.348) (-1452.582) (-1457.035) [-1454.390] -- 0:01:44
      10000 -- (-1446.567) (-1453.815) [-1454.812] (-1458.780) * (-1447.750) [-1452.905] (-1460.759) (-1460.832) -- 0:01:39

      Average standard deviation of split frequencies: 0.053498

      10500 -- (-1446.116) (-1459.604) [-1453.553] (-1455.296) * (-1448.459) [-1447.941] (-1455.408) (-1452.214) -- 0:01:34
      11000 -- (-1446.199) (-1459.761) [-1452.843] (-1460.884) * (-1445.532) [-1447.718] (-1457.733) (-1446.306) -- 0:01:29
      11500 -- [-1448.119] (-1455.380) (-1470.673) (-1464.115) * (-1446.032) [-1446.863] (-1460.080) (-1445.878) -- 0:01:25
      12000 -- (-1446.493) (-1463.320) (-1454.751) [-1451.466] * (-1446.298) (-1448.154) (-1455.552) [-1445.542] -- 0:01:22
      12500 -- (-1446.689) (-1461.180) [-1453.008] (-1465.558) * (-1448.291) (-1450.444) (-1455.683) [-1446.913] -- 0:01:19
      13000 -- (-1448.115) (-1460.792) [-1454.057] (-1458.219) * (-1446.835) [-1446.794] (-1460.040) (-1446.750) -- 0:01:15
      13500 -- (-1448.280) (-1451.841) (-1453.575) [-1456.872] * (-1447.954) [-1447.216] (-1458.352) (-1447.608) -- 0:01:13
      14000 -- (-1450.031) [-1450.594] (-1456.167) (-1459.267) * [-1449.347] (-1446.322) (-1453.978) (-1446.357) -- 0:01:10
      14500 -- [-1445.419] (-1449.245) (-1452.588) (-1454.812) * (-1446.429) [-1447.234] (-1458.792) (-1446.243) -- 0:01:07
      15000 -- (-1447.128) [-1450.120] (-1456.163) (-1455.325) * (-1446.662) [-1447.033] (-1463.637) (-1445.602) -- 0:01:05

      Average standard deviation of split frequencies: 0.052723

      15500 -- [-1447.146] (-1448.675) (-1457.987) (-1455.546) * [-1446.153] (-1446.726) (-1460.358) (-1445.816) -- 0:01:03
      16000 -- (-1446.307) [-1450.175] (-1458.379) (-1455.377) * (-1446.431) (-1448.560) (-1450.391) [-1445.859] -- 0:01:01
      16500 -- (-1446.962) [-1446.508] (-1459.676) (-1455.294) * (-1446.307) (-1447.486) [-1457.542] (-1447.097) -- 0:00:59
      17000 -- (-1446.670) [-1447.773] (-1475.568) (-1466.464) * [-1447.649] (-1447.737) (-1461.630) (-1446.203) -- 0:00:57
      17500 -- (-1445.889) [-1448.967] (-1457.273) (-1455.455) * (-1447.670) [-1448.292] (-1455.614) (-1446.754) -- 0:00:56
      18000 -- (-1447.476) (-1448.616) (-1463.125) [-1452.564] * [-1447.050] (-1449.721) (-1463.306) (-1445.715) -- 0:00:54
      18500 -- (-1445.449) [-1445.242] (-1458.393) (-1453.574) * [-1452.799] (-1445.848) (-1465.352) (-1448.588) -- 0:00:53
      19000 -- (-1445.412) [-1447.992] (-1452.826) (-1462.005) * (-1447.431) (-1445.588) [-1456.304] (-1447.511) -- 0:00:51
      19500 -- [-1445.566] (-1448.466) (-1455.655) (-1464.792) * (-1446.770) (-1451.613) [-1451.869] (-1446.635) -- 0:00:50
      20000 -- (-1445.567) (-1447.157) (-1459.395) [-1454.434] * [-1447.188] (-1447.001) (-1459.584) (-1445.119) -- 0:00:49

      Average standard deviation of split frequencies: 0.046887

      20500 -- (-1446.701) (-1445.688) (-1455.716) [-1450.857] * (-1448.958) (-1446.465) [-1457.616] (-1446.937) -- 0:00:47
      21000 -- (-1449.382) (-1445.589) (-1456.167) [-1450.824] * (-1448.333) (-1446.238) (-1464.873) [-1452.396] -- 0:00:46
      21500 -- [-1451.421] (-1445.984) (-1455.622) (-1459.276) * [-1448.062] (-1445.294) (-1454.183) (-1450.628) -- 0:00:45
      22000 -- (-1448.225) (-1447.745) (-1455.592) [-1456.517] * (-1449.909) (-1448.832) [-1456.347] (-1451.268) -- 0:00:44
      22500 -- (-1447.820) [-1447.042] (-1459.822) (-1455.926) * [-1449.243] (-1450.568) (-1456.641) (-1446.221) -- 0:00:43
      23000 -- (-1447.708) (-1445.508) (-1459.755) [-1457.773] * [-1446.434] (-1449.428) (-1461.917) (-1445.506) -- 0:01:24
      23500 -- (-1448.310) (-1446.389) (-1454.839) [-1455.488] * (-1447.099) [-1447.896] (-1463.077) (-1445.627) -- 0:01:23
      24000 -- [-1445.844] (-1445.737) (-1455.799) (-1460.541) * (-1445.825) [-1446.426] (-1457.854) (-1446.079) -- 0:01:21
      24500 -- (-1446.689) (-1447.222) (-1460.180) [-1451.961] * (-1447.616) [-1445.787] (-1452.783) (-1445.888) -- 0:01:19
      25000 -- (-1448.749) (-1446.951) (-1463.698) [-1460.561] * (-1448.970) (-1445.440) [-1455.293] (-1445.877) -- 0:01:18

      Average standard deviation of split frequencies: 0.039715

      25500 -- [-1445.863] (-1449.818) (-1452.139) (-1456.753) * (-1446.762) (-1445.865) [-1458.035] (-1448.020) -- 0:01:16
      26000 -- (-1445.554) [-1447.181] (-1458.516) (-1454.411) * [-1448.111] (-1445.822) (-1462.435) (-1446.024) -- 0:01:14
      26500 -- (-1447.454) (-1445.513) [-1451.162] (-1452.591) * (-1446.746) (-1451.620) (-1460.372) [-1445.975] -- 0:01:13
      27000 -- (-1447.277) (-1445.497) (-1456.397) [-1458.919] * (-1451.157) (-1446.752) (-1459.787) [-1447.339] -- 0:01:12
      27500 -- (-1445.924) (-1446.720) [-1458.833] (-1457.320) * (-1452.074) (-1448.422) [-1453.373] (-1446.510) -- 0:01:10
      28000 -- (-1448.088) [-1448.065] (-1457.399) (-1455.316) * (-1447.146) (-1449.578) [-1453.957] (-1446.630) -- 0:01:09
      28500 -- (-1450.401) (-1447.288) (-1446.250) [-1455.095] * (-1449.360) [-1449.726] (-1459.792) (-1446.637) -- 0:01:08
      29000 -- (-1449.429) [-1448.958] (-1449.963) (-1456.965) * (-1448.454) (-1449.624) [-1454.867] (-1447.203) -- 0:01:06
      29500 -- [-1446.094] (-1447.456) (-1448.057) (-1455.115) * (-1447.336) (-1450.957) [-1451.194] (-1446.738) -- 0:01:05
      30000 -- (-1446.523) (-1448.075) [-1453.664] (-1460.422) * [-1446.004] (-1448.826) (-1460.878) (-1449.720) -- 0:01:04

      Average standard deviation of split frequencies: 0.041504

      30500 -- (-1446.427) (-1445.632) (-1450.100) [-1455.924] * (-1445.486) (-1447.297) [-1456.322] (-1451.172) -- 0:01:03
      31000 -- (-1446.557) (-1446.321) (-1449.785) [-1453.687] * [-1446.393] (-1445.906) (-1449.444) (-1447.641) -- 0:01:02
      31500 -- [-1446.980] (-1448.301) (-1448.886) (-1457.740) * (-1447.611) (-1446.437) [-1457.555] (-1446.653) -- 0:01:01
      32000 -- [-1450.022] (-1456.864) (-1445.715) (-1454.226) * (-1445.625) (-1447.311) [-1455.805] (-1449.137) -- 0:01:00
      32500 -- (-1448.656) (-1450.815) (-1445.402) [-1462.225] * (-1445.433) (-1447.788) (-1463.388) [-1446.386] -- 0:00:59
      33000 -- (-1451.005) (-1448.692) (-1448.879) [-1455.365] * (-1448.315) [-1449.843] (-1464.703) (-1451.029) -- 0:00:58
      33500 -- (-1446.296) [-1448.071] (-1446.556) (-1450.632) * (-1447.946) (-1447.677) (-1466.286) [-1447.889] -- 0:00:57
      34000 -- [-1446.876] (-1447.403) (-1449.487) (-1458.461) * (-1448.224) (-1449.272) [-1454.047] (-1448.428) -- 0:00:56
      34500 -- (-1446.843) (-1448.366) (-1445.700) [-1446.821] * [-1447.367] (-1448.562) (-1456.860) (-1447.504) -- 0:00:55
      35000 -- [-1447.696] (-1447.944) (-1446.389) (-1446.112) * (-1447.088) [-1449.704] (-1456.647) (-1448.180) -- 0:00:55

      Average standard deviation of split frequencies: 0.041903

      35500 -- (-1446.139) [-1446.649] (-1445.807) (-1446.791) * (-1448.991) (-1449.359) [-1456.051] (-1448.491) -- 0:00:54
      36000 -- (-1446.523) (-1446.882) (-1446.587) [-1447.904] * (-1449.649) (-1447.021) [-1456.993] (-1446.270) -- 0:00:53
      36500 -- (-1445.497) (-1449.659) [-1445.986] (-1447.456) * (-1448.103) [-1447.564] (-1454.205) (-1446.786) -- 0:00:52
      37000 -- (-1447.584) [-1449.419] (-1446.247) (-1447.373) * (-1449.075) (-1450.900) [-1456.309] (-1446.508) -- 0:00:52
      37500 -- (-1445.888) [-1446.220] (-1445.939) (-1448.957) * (-1447.160) (-1448.159) (-1457.643) [-1446.297] -- 0:01:17
      38000 -- (-1445.734) [-1446.653] (-1447.635) (-1448.606) * (-1447.549) (-1447.024) (-1458.470) [-1446.309] -- 0:01:15
      38500 -- (-1449.446) [-1449.873] (-1447.334) (-1446.578) * (-1446.169) (-1447.014) [-1453.460] (-1447.318) -- 0:01:14
      39000 -- (-1448.463) (-1447.708) [-1447.369] (-1447.012) * [-1446.624] (-1446.971) (-1460.367) (-1446.834) -- 0:01:13
      39500 -- (-1448.549) [-1446.055] (-1446.727) (-1447.327) * [-1446.868] (-1447.433) (-1469.164) (-1448.476) -- 0:01:12
      40000 -- (-1450.914) (-1446.784) (-1446.608) [-1448.794] * [-1448.365] (-1448.690) (-1446.631) (-1448.669) -- 0:01:12

      Average standard deviation of split frequencies: 0.028980

      40500 -- (-1452.660) (-1446.580) [-1449.266] (-1450.020) * (-1447.309) (-1449.330) (-1447.889) [-1446.367] -- 0:01:11
      41000 -- [-1448.416] (-1446.216) (-1449.748) (-1450.295) * (-1447.379) (-1448.981) (-1449.792) [-1447.169] -- 0:01:10
      41500 -- [-1449.119] (-1447.211) (-1447.475) (-1447.835) * (-1447.737) [-1449.894] (-1448.092) (-1448.506) -- 0:01:09
      42000 -- (-1448.929) [-1449.292] (-1447.841) (-1447.137) * (-1452.501) [-1448.628] (-1449.310) (-1448.637) -- 0:01:08
      42500 -- (-1448.074) (-1448.620) [-1446.297] (-1446.150) * (-1447.984) (-1450.185) [-1447.043] (-1446.558) -- 0:01:07
      43000 -- [-1450.129] (-1449.756) (-1446.929) (-1448.510) * (-1446.764) (-1447.224) (-1450.370) [-1446.484] -- 0:01:06
      43500 -- (-1449.534) [-1446.749] (-1446.993) (-1450.755) * (-1449.528) (-1447.134) [-1445.740] (-1446.804) -- 0:01:05
      44000 -- (-1449.797) (-1446.114) [-1446.618] (-1453.349) * (-1448.797) [-1446.747] (-1446.110) (-1449.881) -- 0:01:05
      44500 -- (-1447.482) (-1447.026) (-1447.226) [-1447.387] * [-1447.387] (-1446.215) (-1448.477) (-1449.370) -- 0:01:04
      45000 -- (-1447.181) (-1446.594) [-1446.505] (-1448.962) * (-1447.994) (-1446.156) (-1450.065) [-1449.703] -- 0:01:03

      Average standard deviation of split frequencies: 0.029768

      45500 -- [-1447.142] (-1451.715) (-1446.085) (-1453.138) * [-1448.691] (-1448.724) (-1449.588) (-1450.519) -- 0:01:02
      46000 -- [-1446.179] (-1449.494) (-1446.261) (-1454.181) * (-1452.782) (-1447.244) (-1446.166) [-1457.005] -- 0:01:02
      46500 -- (-1446.325) [-1447.038] (-1447.883) (-1455.980) * (-1448.692) (-1449.648) [-1447.632] (-1453.296) -- 0:01:01
      47000 -- [-1449.087] (-1451.562) (-1456.027) (-1453.140) * [-1447.158] (-1448.828) (-1446.813) (-1449.266) -- 0:01:00
      47500 -- (-1449.588) (-1447.780) [-1450.438] (-1448.024) * (-1450.276) (-1445.517) [-1447.900] (-1447.223) -- 0:01:00
      48000 -- (-1447.290) (-1446.369) [-1446.632] (-1448.382) * (-1446.804) (-1446.512) [-1450.398] (-1451.096) -- 0:00:59
      48500 -- [-1446.241] (-1447.449) (-1447.372) (-1448.225) * [-1452.996] (-1450.162) (-1450.736) (-1447.923) -- 0:00:58
      49000 -- [-1447.863] (-1447.301) (-1446.059) (-1451.271) * (-1446.718) (-1446.776) (-1450.066) [-1450.740] -- 0:00:58
      49500 -- (-1446.848) (-1447.253) [-1445.928] (-1450.197) * (-1448.073) (-1448.755) [-1447.813] (-1447.944) -- 0:00:57
      50000 -- [-1446.272] (-1448.198) (-1447.384) (-1446.669) * (-1447.834) (-1446.477) [-1446.133] (-1448.310) -- 0:00:57

      Average standard deviation of split frequencies: 0.025586

      50500 -- (-1446.516) (-1451.351) (-1445.833) [-1446.984] * (-1446.019) (-1445.219) [-1445.402] (-1451.788) -- 0:00:56
      51000 -- (-1447.671) (-1448.872) [-1446.871] (-1447.926) * [-1446.358] (-1445.597) (-1446.974) (-1448.673) -- 0:00:55
      51500 -- [-1449.518] (-1449.926) (-1446.168) (-1448.931) * (-1446.306) (-1447.987) (-1447.656) [-1448.617] -- 0:00:55
      52000 -- (-1448.716) [-1445.953] (-1446.861) (-1447.329) * (-1448.734) (-1449.260) [-1453.035] (-1448.832) -- 0:00:54
      52500 -- (-1445.646) [-1446.114] (-1446.727) (-1452.185) * [-1445.370] (-1449.103) (-1449.501) (-1446.403) -- 0:00:54
      53000 -- [-1446.235] (-1445.804) (-1450.415) (-1454.071) * [-1445.370] (-1449.066) (-1446.647) (-1445.856) -- 0:00:53
      53500 -- [-1445.585] (-1451.130) (-1450.305) (-1450.113) * (-1445.254) (-1448.034) [-1445.448] (-1450.732) -- 0:01:10
      54000 -- (-1450.605) [-1448.114] (-1450.418) (-1449.350) * (-1445.551) [-1447.747] (-1446.413) (-1451.934) -- 0:01:10
      54500 -- (-1446.947) [-1446.165] (-1452.146) (-1447.291) * (-1446.725) (-1447.864) [-1445.816] (-1448.811) -- 0:01:09
      55000 -- (-1446.428) (-1446.472) (-1446.896) [-1446.543] * [-1447.505] (-1447.603) (-1447.015) (-1449.276) -- 0:01:08

      Average standard deviation of split frequencies: 0.028355

      55500 -- [-1446.310] (-1446.434) (-1448.445) (-1450.490) * (-1447.635) (-1447.904) (-1447.148) [-1448.681] -- 0:01:08
      56000 -- (-1447.527) (-1445.867) [-1446.667] (-1446.353) * (-1447.074) [-1446.418] (-1451.054) (-1449.582) -- 0:01:07
      56500 -- (-1447.149) [-1447.039] (-1447.247) (-1446.615) * (-1447.131) (-1446.863) [-1448.497] (-1447.780) -- 0:01:06
      57000 -- (-1446.620) (-1447.648) (-1447.056) [-1446.893] * [-1446.048] (-1446.138) (-1446.737) (-1446.672) -- 0:01:06
      57500 -- (-1446.752) [-1446.349] (-1447.385) (-1445.689) * (-1447.051) (-1446.421) (-1449.441) [-1445.774] -- 0:01:05
      58000 -- (-1446.661) [-1446.716] (-1446.909) (-1448.141) * (-1447.801) (-1445.916) [-1448.110] (-1446.033) -- 0:01:04
      58500 -- [-1445.784] (-1446.283) (-1447.014) (-1446.674) * (-1455.314) [-1445.384] (-1449.716) (-1446.874) -- 0:01:04
      59000 -- (-1451.509) [-1446.284] (-1447.550) (-1447.800) * [-1450.073] (-1446.490) (-1445.973) (-1446.113) -- 0:01:03
      59500 -- (-1451.503) [-1447.968] (-1447.081) (-1446.745) * (-1451.244) (-1453.068) [-1445.973] (-1448.873) -- 0:01:03
      60000 -- (-1449.450) (-1447.582) [-1449.701] (-1446.660) * [-1448.510] (-1446.845) (-1447.899) (-1452.210) -- 0:01:02

      Average standard deviation of split frequencies: 0.027425

      60500 -- (-1446.018) (-1449.774) (-1450.555) [-1446.031] * (-1448.178) [-1446.734] (-1447.599) (-1449.939) -- 0:01:02
      61000 -- (-1446.858) [-1451.962] (-1447.080) (-1448.133) * (-1450.324) (-1446.132) [-1446.658] (-1447.322) -- 0:01:01
      61500 -- (-1446.513) (-1449.166) (-1450.529) [-1446.670] * (-1451.885) [-1445.520] (-1447.491) (-1445.535) -- 0:01:01
      62000 -- (-1446.773) [-1445.670] (-1448.907) (-1447.184) * (-1448.043) [-1446.892] (-1446.151) (-1446.122) -- 0:01:00
      62500 -- (-1447.906) [-1447.707] (-1452.880) (-1448.281) * (-1447.865) (-1447.020) [-1445.601] (-1448.815) -- 0:01:00
      63000 -- (-1445.992) (-1449.204) [-1446.812] (-1446.589) * (-1449.276) (-1447.176) [-1446.396] (-1446.164) -- 0:00:59
      63500 -- (-1450.900) [-1450.338] (-1447.374) (-1447.939) * (-1450.444) (-1445.990) (-1446.396) [-1446.899] -- 0:00:58
      64000 -- [-1445.701] (-1446.515) (-1449.300) (-1447.934) * (-1451.464) (-1446.636) [-1445.689] (-1447.128) -- 0:00:58
      64500 -- (-1447.502) (-1448.362) (-1449.274) [-1451.537] * (-1447.714) (-1446.753) [-1445.682] (-1446.037) -- 0:00:58
      65000 -- (-1446.508) [-1450.236] (-1448.724) (-1450.494) * (-1445.427) [-1446.182] (-1445.650) (-1446.180) -- 0:00:57

      Average standard deviation of split frequencies: 0.022179

      65500 -- (-1448.278) (-1449.367) [-1450.112] (-1449.937) * (-1445.427) (-1452.159) (-1445.045) [-1449.568] -- 0:00:57
      66000 -- (-1448.898) (-1447.959) [-1449.694] (-1453.257) * (-1445.561) (-1445.621) (-1449.556) [-1449.582] -- 0:00:56
      66500 -- (-1447.370) (-1447.959) [-1451.313] (-1449.524) * (-1446.866) [-1445.081] (-1446.620) (-1449.722) -- 0:00:56
      67000 -- (-1446.470) (-1451.095) (-1446.683) [-1449.358] * (-1446.386) (-1446.661) [-1447.160] (-1450.947) -- 0:00:55
      67500 -- (-1447.036) (-1447.917) (-1447.811) [-1450.241] * (-1446.325) [-1449.455] (-1447.279) (-1451.533) -- 0:00:55
      68000 -- (-1445.970) (-1446.118) (-1449.022) [-1447.933] * (-1446.894) (-1447.434) [-1445.545] (-1451.868) -- 0:00:54
      68500 -- (-1446.234) [-1446.675] (-1448.894) (-1447.906) * [-1446.892] (-1445.968) (-1448.716) (-1452.184) -- 0:00:54
      69000 -- (-1445.800) (-1447.119) (-1449.851) [-1449.969] * (-1448.741) (-1450.320) [-1448.716] (-1451.152) -- 0:00:53
      69500 -- (-1446.657) (-1452.373) [-1446.571] (-1447.692) * (-1446.162) [-1446.821] (-1449.359) (-1448.856) -- 0:00:53
      70000 -- (-1445.818) (-1452.791) (-1447.371) [-1448.457] * (-1450.163) (-1447.365) [-1447.577] (-1448.871) -- 0:01:06

      Average standard deviation of split frequencies: 0.022470

      70500 -- (-1446.675) (-1447.538) (-1447.315) [-1446.890] * (-1452.458) (-1447.304) (-1453.393) [-1448.882] -- 0:01:05
      71000 -- [-1446.324] (-1449.632) (-1447.407) (-1446.851) * (-1447.874) [-1447.574] (-1453.149) (-1454.282) -- 0:01:05
      71500 -- (-1446.687) (-1447.392) (-1447.599) [-1447.215] * (-1448.136) (-1447.154) [-1447.353] (-1446.827) -- 0:01:04
      72000 -- (-1446.796) [-1450.790] (-1448.283) (-1445.766) * (-1449.256) [-1447.128] (-1446.051) (-1449.782) -- 0:01:04
      72500 -- (-1450.449) (-1448.542) [-1447.641] (-1447.129) * (-1450.685) (-1447.121) [-1447.010] (-1445.337) -- 0:01:03
      73000 -- (-1452.669) (-1449.562) (-1451.281) [-1447.660] * (-1451.506) [-1446.640] (-1450.189) (-1447.032) -- 0:01:03
      73500 -- (-1449.756) (-1447.853) [-1449.670] (-1448.177) * (-1448.047) (-1447.228) [-1448.196] (-1446.365) -- 0:01:03
      74000 -- [-1446.545] (-1449.279) (-1452.012) (-1449.508) * (-1447.250) (-1446.072) (-1448.457) [-1445.762] -- 0:01:02
      74500 -- (-1450.358) (-1447.411) (-1448.211) [-1449.602] * (-1446.874) (-1449.084) (-1448.150) [-1446.077] -- 0:01:02
      75000 -- [-1445.875] (-1446.930) (-1448.217) (-1449.043) * (-1445.801) (-1447.444) (-1448.334) [-1446.086] -- 0:01:01

      Average standard deviation of split frequencies: 0.027096

      75500 -- [-1446.236] (-1447.359) (-1451.869) (-1446.719) * (-1447.322) (-1448.115) (-1448.477) [-1445.703] -- 0:01:01
      76000 -- (-1447.465) (-1447.873) (-1449.637) [-1447.765] * (-1451.174) [-1449.348] (-1446.974) (-1446.556) -- 0:01:00
      76500 -- (-1450.341) [-1446.372] (-1445.994) (-1446.562) * (-1447.232) (-1446.616) [-1447.549] (-1446.665) -- 0:01:00
      77000 -- (-1447.659) (-1447.195) [-1445.687] (-1447.783) * [-1448.617] (-1446.721) (-1449.295) (-1446.661) -- 0:00:59
      77500 -- (-1448.375) [-1449.257] (-1445.687) (-1450.164) * (-1450.530) (-1447.261) [-1450.621] (-1451.352) -- 0:00:59
      78000 -- (-1452.404) [-1451.461] (-1447.229) (-1447.040) * (-1450.056) [-1452.783] (-1451.218) (-1454.206) -- 0:00:59
      78500 -- (-1449.069) (-1448.698) (-1451.421) [-1447.453] * [-1447.776] (-1449.574) (-1452.449) (-1446.815) -- 0:00:58
      79000 -- (-1450.943) (-1446.638) (-1447.632) [-1445.583] * [-1450.738] (-1451.735) (-1447.740) (-1447.517) -- 0:00:58
      79500 -- (-1447.573) (-1446.407) (-1446.276) [-1446.551] * (-1451.682) (-1449.303) (-1446.922) [-1454.528] -- 0:00:57
      80000 -- (-1446.418) (-1446.164) [-1446.351] (-1450.929) * (-1450.272) (-1446.690) [-1446.475] (-1448.110) -- 0:00:57

      Average standard deviation of split frequencies: 0.025528

      80500 -- [-1446.003] (-1447.710) (-1446.331) (-1449.116) * (-1449.370) [-1449.424] (-1447.096) (-1447.780) -- 0:00:57
      81000 -- (-1450.549) (-1449.722) [-1447.206] (-1451.730) * (-1450.096) (-1450.357) (-1446.799) [-1447.312] -- 0:00:56
      81500 -- (-1447.032) [-1448.126] (-1448.162) (-1448.288) * (-1447.175) (-1452.074) (-1448.724) [-1448.647] -- 0:00:56
      82000 -- [-1449.336] (-1446.979) (-1448.383) (-1449.715) * [-1446.817] (-1450.544) (-1447.459) (-1448.264) -- 0:00:55
      82500 -- [-1446.531] (-1446.360) (-1452.743) (-1449.766) * [-1446.714] (-1448.491) (-1446.826) (-1447.867) -- 0:00:55
      83000 -- (-1453.345) [-1448.145] (-1447.507) (-1448.228) * (-1445.974) (-1448.588) (-1447.094) [-1451.520] -- 0:00:55
      83500 -- (-1447.699) (-1447.000) (-1446.722) [-1446.789] * (-1447.517) (-1446.852) (-1446.472) [-1449.603] -- 0:00:54
      84000 -- [-1450.582] (-1449.208) (-1446.221) (-1445.977) * (-1447.805) [-1446.604] (-1446.639) (-1446.782) -- 0:00:54
      84500 -- (-1448.366) (-1447.116) (-1448.430) [-1446.047] * (-1447.339) (-1446.615) (-1446.451) [-1445.681] -- 0:00:54
      85000 -- (-1448.297) [-1447.471] (-1451.616) (-1449.720) * [-1449.897] (-1446.343) (-1447.117) (-1445.710) -- 0:00:53

      Average standard deviation of split frequencies: 0.025580

      85500 -- [-1446.727] (-1450.981) (-1448.022) (-1449.457) * (-1446.223) (-1445.940) [-1446.103] (-1446.024) -- 0:00:53
      86000 -- (-1447.249) (-1447.934) [-1447.422] (-1447.803) * (-1446.049) (-1446.707) [-1447.154] (-1449.490) -- 0:01:03
      86500 -- (-1447.249) (-1447.115) [-1445.844] (-1445.456) * [-1446.906] (-1447.857) (-1445.948) (-1450.609) -- 0:01:03
      87000 -- (-1447.729) (-1449.117) [-1445.914] (-1447.292) * [-1446.531] (-1445.841) (-1447.121) (-1450.847) -- 0:01:02
      87500 -- [-1447.170] (-1450.232) (-1445.914) (-1447.686) * (-1450.301) [-1446.340] (-1445.386) (-1445.839) -- 0:01:02
      88000 -- (-1449.462) [-1446.838] (-1449.106) (-1447.994) * (-1450.282) [-1447.899] (-1447.275) (-1445.695) -- 0:01:02
      88500 -- [-1446.077] (-1447.175) (-1447.934) (-1448.033) * (-1447.230) [-1448.411] (-1448.625) (-1451.151) -- 0:01:01
      89000 -- (-1446.550) (-1446.896) (-1448.469) [-1445.593] * (-1447.306) (-1447.421) (-1448.492) [-1446.609] -- 0:01:01
      89500 -- (-1447.877) (-1446.463) [-1448.801] (-1446.403) * [-1447.546] (-1447.208) (-1448.378) (-1445.674) -- 0:01:01
      90000 -- (-1449.651) [-1448.011] (-1448.800) (-1446.292) * (-1446.259) (-1448.454) (-1449.523) [-1447.383] -- 0:01:00

      Average standard deviation of split frequencies: 0.024355

      90500 -- (-1447.467) (-1445.579) [-1445.647] (-1445.681) * (-1448.703) (-1445.578) (-1451.016) [-1448.053] -- 0:01:00
      91000 -- (-1448.524) [-1445.547] (-1451.864) (-1447.145) * (-1447.581) (-1446.136) (-1450.678) [-1446.779] -- 0:00:59
      91500 -- [-1448.840] (-1445.547) (-1446.606) (-1446.017) * (-1447.857) (-1446.136) [-1448.754] (-1445.765) -- 0:00:59
      92000 -- [-1448.224] (-1446.672) (-1447.751) (-1447.826) * (-1448.191) (-1445.702) [-1449.175] (-1446.532) -- 0:00:59
      92500 -- (-1447.157) (-1447.136) (-1445.505) [-1445.997] * (-1453.042) (-1447.412) [-1447.233] (-1445.935) -- 0:00:58
      93000 -- (-1448.652) (-1452.501) [-1446.620] (-1448.092) * (-1451.519) (-1446.887) [-1449.170] (-1447.707) -- 0:00:58
      93500 -- (-1448.216) (-1447.781) [-1446.968] (-1445.886) * (-1446.413) [-1450.260] (-1447.494) (-1447.639) -- 0:00:58
      94000 -- (-1448.077) (-1447.698) (-1446.214) [-1445.428] * (-1451.799) [-1449.678] (-1447.384) (-1450.005) -- 0:00:57
      94500 -- (-1451.876) (-1447.466) (-1447.181) [-1448.936] * (-1451.701) (-1450.750) (-1448.969) [-1445.783] -- 0:00:57
      95000 -- (-1449.666) [-1448.489] (-1448.402) (-1446.928) * (-1450.649) [-1446.787] (-1453.935) (-1447.771) -- 0:00:57

      Average standard deviation of split frequencies: 0.020417

      95500 -- [-1446.691] (-1447.635) (-1447.781) (-1447.191) * (-1448.915) (-1448.099) (-1448.343) [-1448.758] -- 0:00:56
      96000 -- [-1447.081] (-1447.059) (-1446.947) (-1445.382) * (-1450.361) [-1446.428] (-1448.797) (-1445.656) -- 0:00:56
      96500 -- (-1450.567) (-1450.034) [-1445.947] (-1446.656) * [-1446.287] (-1447.465) (-1447.847) (-1446.299) -- 0:00:56
      97000 -- (-1445.720) (-1446.693) [-1447.831] (-1448.057) * [-1448.083] (-1447.333) (-1447.166) (-1446.406) -- 0:00:55
      97500 -- (-1445.923) (-1447.925) (-1447.723) [-1450.502] * (-1452.607) [-1448.860] (-1446.677) (-1447.698) -- 0:00:55
      98000 -- [-1445.774] (-1448.033) (-1448.922) (-1452.252) * (-1451.681) (-1447.211) (-1447.630) [-1448.076] -- 0:00:55
      98500 -- [-1445.607] (-1447.030) (-1447.400) (-1449.536) * (-1448.227) [-1447.371] (-1447.660) (-1447.423) -- 0:00:54
      99000 -- (-1446.870) (-1448.540) (-1446.859) [-1446.697] * [-1447.712] (-1447.680) (-1446.605) (-1446.538) -- 0:00:54
      99500 -- [-1446.045] (-1449.383) (-1449.127) (-1445.529) * (-1447.894) (-1448.232) (-1447.513) [-1446.441] -- 0:00:54
      100000 -- (-1445.368) [-1447.349] (-1449.257) (-1445.228) * (-1447.073) (-1447.805) [-1450.446] (-1446.954) -- 0:00:54

      Average standard deviation of split frequencies: 0.023154

      100500 -- (-1451.892) [-1445.523] (-1447.547) (-1445.789) * (-1446.372) (-1446.494) [-1447.330] (-1447.824) -- 0:00:53
      101000 -- (-1446.623) (-1445.642) (-1449.423) [-1445.965] * (-1451.645) [-1446.340] (-1447.287) (-1447.463) -- 0:01:02
      101500 -- (-1446.779) (-1447.657) (-1448.253) [-1445.794] * [-1450.155] (-1449.312) (-1448.171) (-1448.315) -- 0:01:01
      102000 -- (-1451.783) (-1448.298) [-1449.009] (-1448.642) * [-1449.905] (-1447.924) (-1452.378) (-1453.283) -- 0:01:01
      102500 -- (-1445.849) (-1451.413) (-1447.836) [-1447.592] * (-1451.366) (-1448.531) (-1452.036) [-1446.748] -- 0:01:01
      103000 -- (-1448.539) [-1446.763] (-1453.469) (-1445.947) * (-1447.848) (-1448.452) (-1446.841) [-1446.882] -- 0:01:00
      103500 -- (-1447.870) (-1446.634) (-1446.116) [-1446.514] * (-1449.284) (-1446.698) (-1448.577) [-1446.876] -- 0:01:00
      104000 -- (-1445.310) (-1448.871) (-1446.768) [-1446.277] * (-1448.796) (-1447.086) [-1448.011] (-1451.247) -- 0:01:00
      104500 -- [-1445.420] (-1447.371) (-1447.398) (-1450.102) * [-1445.981] (-1449.733) (-1446.793) (-1454.507) -- 0:00:59
      105000 -- (-1446.621) [-1446.606] (-1445.866) (-1447.302) * [-1447.196] (-1445.913) (-1447.262) (-1448.883) -- 0:00:59

      Average standard deviation of split frequencies: 0.021768

      105500 -- (-1446.965) (-1450.713) (-1445.488) [-1446.126] * (-1446.655) [-1445.914] (-1448.536) (-1449.355) -- 0:00:59
      106000 -- [-1445.836] (-1445.862) (-1445.493) (-1446.020) * (-1445.599) [-1447.218] (-1449.672) (-1447.649) -- 0:00:59
      106500 -- (-1450.974) (-1446.152) [-1445.950] (-1446.385) * (-1445.852) [-1446.678] (-1448.865) (-1447.523) -- 0:00:58
      107000 -- (-1447.887) (-1448.465) (-1446.574) [-1446.097] * (-1446.287) (-1446.877) (-1454.350) [-1446.106] -- 0:00:58
      107500 -- (-1448.995) (-1449.336) (-1448.989) [-1446.410] * [-1445.903] (-1446.650) (-1451.968) (-1445.616) -- 0:00:58
      108000 -- [-1447.593] (-1448.096) (-1448.464) (-1446.002) * (-1449.896) (-1447.889) (-1450.358) [-1445.846] -- 0:00:57
      108500 -- [-1447.345] (-1451.980) (-1448.282) (-1446.330) * (-1447.597) [-1446.771] (-1448.302) (-1451.543) -- 0:00:57
      109000 -- (-1447.486) [-1447.747] (-1446.771) (-1451.273) * [-1446.244] (-1447.368) (-1446.515) (-1448.726) -- 0:00:57
      109500 -- (-1447.596) (-1447.521) [-1447.756] (-1447.204) * (-1447.131) (-1451.121) (-1450.648) [-1446.659] -- 0:00:56
      110000 -- (-1447.219) (-1448.018) [-1447.988] (-1449.604) * (-1446.786) [-1451.308] (-1447.105) (-1449.769) -- 0:00:56

      Average standard deviation of split frequencies: 0.021523

      110500 -- (-1447.795) (-1451.061) [-1446.529] (-1450.017) * (-1446.898) (-1447.405) (-1446.849) [-1447.466] -- 0:00:56
      111000 -- (-1445.923) (-1452.439) [-1447.336] (-1447.276) * (-1447.355) (-1446.855) [-1453.690] (-1446.901) -- 0:00:56
      111500 -- (-1446.660) (-1451.081) [-1449.077] (-1448.439) * (-1446.954) [-1448.037] (-1454.492) (-1446.712) -- 0:00:55
      112000 -- (-1446.860) (-1447.243) [-1447.148] (-1446.685) * (-1446.061) (-1448.322) [-1446.203] (-1446.256) -- 0:00:55
      112500 -- (-1455.308) (-1450.404) [-1446.646] (-1449.820) * (-1445.875) [-1447.465] (-1447.815) (-1446.278) -- 0:00:55
      113000 -- (-1448.210) (-1449.350) (-1447.699) [-1449.652] * (-1445.737) (-1447.640) (-1446.006) [-1445.900] -- 0:00:54
      113500 -- (-1448.293) [-1446.960] (-1447.248) (-1447.146) * (-1447.282) (-1446.925) [-1445.355] (-1449.197) -- 0:00:54
      114000 -- (-1447.503) (-1448.967) [-1448.113] (-1446.080) * (-1448.829) [-1446.533] (-1446.290) (-1447.815) -- 0:00:54
      114500 -- (-1449.462) (-1445.415) [-1449.135] (-1446.088) * (-1447.038) (-1448.290) (-1446.142) [-1445.636] -- 0:00:54
      115000 -- (-1448.347) (-1446.550) (-1447.447) [-1446.781] * [-1445.516] (-1448.312) (-1451.442) (-1449.026) -- 0:00:53

      Average standard deviation of split frequencies: 0.018897

      115500 -- (-1448.224) [-1448.451] (-1449.146) (-1447.460) * [-1446.069] (-1447.051) (-1450.231) (-1448.766) -- 0:00:53
      116000 -- [-1448.495] (-1448.198) (-1449.702) (-1447.999) * (-1448.495) [-1446.257] (-1447.681) (-1449.576) -- 0:01:00
      116500 -- (-1445.874) (-1447.162) (-1447.260) [-1446.025] * (-1456.273) (-1448.117) (-1448.197) [-1448.948] -- 0:01:00
      117000 -- (-1445.823) (-1450.993) [-1447.894] (-1448.175) * (-1455.785) [-1447.014] (-1447.208) (-1449.683) -- 0:01:00
      117500 -- (-1453.120) (-1447.213) [-1447.667] (-1449.396) * (-1447.200) [-1449.950] (-1447.768) (-1448.653) -- 0:01:00
      118000 -- (-1450.358) (-1445.649) (-1448.806) [-1450.377] * (-1447.595) (-1448.753) [-1447.034] (-1448.588) -- 0:00:59
      118500 -- [-1448.015] (-1447.231) (-1447.855) (-1448.817) * (-1448.384) [-1447.238] (-1448.397) (-1448.964) -- 0:00:59
      119000 -- [-1447.964] (-1445.878) (-1450.051) (-1448.718) * [-1450.858] (-1447.950) (-1446.821) (-1452.340) -- 0:00:59
      119500 -- (-1450.819) [-1449.163] (-1450.866) (-1448.406) * (-1448.086) (-1447.475) (-1446.878) [-1446.750] -- 0:00:58
      120000 -- [-1447.452] (-1446.733) (-1448.978) (-1448.759) * [-1445.730] (-1448.719) (-1447.026) (-1447.932) -- 0:00:58

      Average standard deviation of split frequencies: 0.020150

      120500 -- (-1447.742) (-1446.332) (-1448.973) [-1446.369] * (-1447.613) (-1449.302) (-1446.507) [-1446.697] -- 0:00:58
      121000 -- [-1449.028] (-1447.275) (-1447.899) (-1446.033) * [-1445.662] (-1453.004) (-1448.950) (-1447.258) -- 0:00:58
      121500 -- (-1448.115) [-1448.882] (-1445.523) (-1446.442) * (-1448.154) (-1448.161) (-1448.063) [-1445.517] -- 0:00:57
      122000 -- (-1446.121) (-1446.139) (-1447.122) [-1445.226] * [-1446.764] (-1447.734) (-1447.171) (-1448.980) -- 0:00:57
      122500 -- [-1448.501] (-1447.051) (-1447.769) (-1446.661) * (-1446.867) (-1447.902) [-1445.754] (-1451.843) -- 0:00:57
      123000 -- (-1445.865) [-1446.420] (-1446.733) (-1448.266) * (-1449.379) (-1447.799) [-1445.784] (-1447.637) -- 0:00:57
      123500 -- (-1447.197) [-1446.591] (-1446.627) (-1449.177) * (-1446.917) (-1445.673) [-1445.324] (-1447.592) -- 0:00:56
      124000 -- [-1445.200] (-1447.270) (-1446.069) (-1451.408) * (-1448.928) [-1445.789] (-1446.385) (-1447.019) -- 0:00:56
      124500 -- (-1445.216) (-1447.506) (-1450.038) [-1446.578] * (-1448.757) (-1448.417) [-1445.472] (-1449.317) -- 0:00:56
      125000 -- (-1446.785) (-1445.717) [-1448.294] (-1450.121) * (-1448.160) (-1446.199) [-1447.426] (-1448.331) -- 0:00:56

      Average standard deviation of split frequencies: 0.018116

      125500 -- [-1447.496] (-1449.067) (-1446.098) (-1448.053) * (-1446.538) (-1446.107) (-1448.239) [-1447.908] -- 0:00:55
      126000 -- (-1446.775) (-1446.908) [-1445.540] (-1448.524) * [-1451.514] (-1446.143) (-1446.265) (-1448.315) -- 0:00:55
      126500 -- (-1446.634) [-1448.058] (-1446.857) (-1447.679) * (-1451.339) [-1446.296] (-1446.765) (-1447.303) -- 0:00:55
      127000 -- (-1445.959) [-1450.116] (-1447.922) (-1450.122) * (-1447.079) [-1445.533] (-1447.099) (-1447.851) -- 0:00:54
      127500 -- [-1446.235] (-1448.522) (-1446.415) (-1454.782) * (-1453.371) (-1445.955) [-1446.328] (-1446.464) -- 0:00:54
      128000 -- (-1446.159) [-1450.344] (-1447.856) (-1448.654) * (-1449.116) (-1445.859) [-1446.160] (-1447.524) -- 0:00:54
      128500 -- (-1447.609) (-1447.894) (-1450.411) [-1446.935] * [-1450.433] (-1446.269) (-1447.059) (-1449.029) -- 0:00:54
      129000 -- (-1446.446) [-1447.780] (-1447.930) (-1449.519) * (-1445.356) (-1447.994) (-1449.124) [-1448.127] -- 0:00:54
      129500 -- (-1447.097) [-1447.785] (-1449.716) (-1448.977) * (-1445.165) (-1449.606) (-1448.283) [-1449.803] -- 0:00:53
      130000 -- [-1445.931] (-1449.339) (-1449.711) (-1446.158) * (-1447.372) (-1448.552) (-1447.457) [-1447.927] -- 0:00:53

      Average standard deviation of split frequencies: 0.017089

      130500 -- [-1446.706] (-1447.942) (-1446.950) (-1450.928) * (-1448.657) (-1448.158) (-1446.725) [-1446.206] -- 0:00:53
      131000 -- (-1447.119) (-1447.405) [-1446.460] (-1448.533) * (-1448.572) (-1447.956) (-1447.239) [-1445.482] -- 0:00:53
      131500 -- [-1445.495] (-1446.707) (-1447.756) (-1447.777) * (-1449.310) (-1450.243) (-1446.964) [-1445.688] -- 0:00:52
      132000 -- (-1447.342) (-1450.333) [-1445.176] (-1451.407) * (-1449.177) [-1449.151] (-1446.442) (-1451.267) -- 0:00:59
      132500 -- (-1445.438) (-1447.012) [-1449.075] (-1452.078) * (-1450.862) (-1448.864) (-1447.188) [-1446.970] -- 0:00:58
      133000 -- (-1445.623) (-1446.315) [-1452.524] (-1448.603) * (-1449.147) (-1447.331) (-1448.273) [-1447.132] -- 0:00:58
      133500 -- (-1448.954) (-1449.171) (-1448.000) [-1446.526] * (-1447.931) (-1446.945) (-1447.206) [-1446.293] -- 0:00:58
      134000 -- (-1448.446) (-1449.188) [-1448.366] (-1445.862) * (-1446.792) [-1449.932] (-1446.447) (-1446.441) -- 0:00:58
      134500 -- (-1451.152) (-1446.093) (-1446.470) [-1448.074] * (-1445.593) (-1448.801) (-1447.346) [-1446.394] -- 0:00:57
      135000 -- (-1448.066) (-1446.085) [-1447.530] (-1453.040) * [-1445.593] (-1446.696) (-1451.324) (-1446.514) -- 0:00:57

      Average standard deviation of split frequencies: 0.015598

      135500 -- [-1451.002] (-1445.472) (-1445.091) (-1449.719) * (-1445.795) [-1446.438] (-1450.827) (-1447.945) -- 0:00:57
      136000 -- [-1447.851] (-1445.409) (-1445.091) (-1447.384) * [-1446.666] (-1446.436) (-1452.973) (-1449.023) -- 0:00:57
      136500 -- [-1445.359] (-1449.853) (-1447.984) (-1446.259) * (-1447.063) [-1447.817] (-1448.491) (-1447.698) -- 0:00:56
      137000 -- (-1446.420) (-1446.058) (-1447.843) [-1445.438] * (-1447.970) [-1445.517] (-1451.774) (-1447.482) -- 0:00:56
      137500 -- [-1445.634] (-1445.261) (-1450.816) (-1446.726) * [-1446.656] (-1447.561) (-1453.056) (-1449.946) -- 0:00:56
      138000 -- (-1445.635) (-1445.797) [-1449.170] (-1447.493) * (-1450.500) [-1448.418] (-1447.133) (-1450.274) -- 0:00:56
      138500 -- (-1449.171) (-1447.035) [-1448.523] (-1448.799) * (-1447.743) (-1446.623) (-1451.659) [-1448.327] -- 0:00:55
      139000 -- (-1446.144) [-1445.396] (-1447.048) (-1448.477) * (-1451.464) [-1446.147] (-1445.817) (-1447.078) -- 0:00:55
      139500 -- (-1446.787) (-1450.658) [-1447.106] (-1453.306) * (-1450.405) (-1446.638) (-1447.045) [-1446.913] -- 0:00:55
      140000 -- (-1446.146) (-1449.860) (-1450.056) [-1447.882] * (-1450.122) (-1449.130) [-1446.855] (-1447.993) -- 0:00:55

      Average standard deviation of split frequencies: 0.015080

      140500 -- (-1448.435) (-1446.962) [-1446.410] (-1449.203) * (-1448.966) (-1453.476) [-1446.372] (-1447.892) -- 0:00:55
      141000 -- (-1448.540) [-1445.850] (-1447.724) (-1455.301) * (-1447.694) (-1450.588) [-1446.695] (-1448.648) -- 0:00:54
      141500 -- (-1448.021) (-1446.238) (-1447.623) [-1450.746] * [-1445.152] (-1449.718) (-1448.712) (-1448.080) -- 0:00:54
      142000 -- (-1448.058) (-1446.446) (-1447.307) [-1450.427] * (-1446.194) (-1449.785) [-1449.886] (-1446.966) -- 0:00:54
      142500 -- (-1449.898) [-1446.455] (-1447.249) (-1450.144) * (-1447.200) (-1449.618) [-1449.636] (-1450.377) -- 0:00:54
      143000 -- (-1451.382) (-1446.653) (-1445.780) [-1451.244] * (-1447.335) (-1448.152) (-1450.325) [-1447.488] -- 0:00:53
      143500 -- (-1449.447) (-1447.454) [-1447.018] (-1447.710) * (-1448.785) (-1446.801) [-1447.993] (-1449.943) -- 0:00:53
      144000 -- (-1448.191) (-1446.474) (-1446.023) [-1446.517] * (-1448.288) [-1446.892] (-1447.218) (-1448.735) -- 0:00:53
      144500 -- (-1449.819) [-1447.414] (-1447.660) (-1447.039) * (-1446.594) [-1447.986] (-1448.502) (-1449.127) -- 0:00:53
      145000 -- [-1445.399] (-1447.381) (-1446.039) (-1448.689) * (-1448.770) (-1449.150) [-1446.648] (-1447.520) -- 0:00:53

      Average standard deviation of split frequencies: 0.014709

      145500 -- (-1445.398) (-1445.821) (-1446.005) [-1445.572] * (-1450.858) [-1449.995] (-1447.448) (-1451.748) -- 0:00:52
      146000 -- [-1445.920] (-1446.106) (-1447.110) (-1447.822) * (-1447.643) [-1449.564] (-1448.911) (-1447.113) -- 0:00:52
      146500 -- (-1447.779) [-1446.630] (-1448.453) (-1446.272) * (-1449.706) (-1450.114) [-1450.676] (-1449.779) -- 0:00:52
      147000 -- (-1448.896) [-1448.045] (-1450.387) (-1445.826) * (-1450.496) [-1447.246] (-1449.202) (-1446.216) -- 0:00:52
      147500 -- [-1446.756] (-1448.644) (-1449.503) (-1445.910) * (-1449.853) (-1447.626) [-1448.814] (-1448.869) -- 0:00:52
      148000 -- [-1446.806] (-1449.122) (-1453.610) (-1447.385) * (-1448.410) (-1450.755) [-1448.471] (-1448.009) -- 0:00:57
      148500 -- [-1449.789] (-1447.435) (-1446.885) (-1445.515) * (-1446.243) [-1448.507] (-1447.809) (-1449.072) -- 0:00:57
      149000 -- (-1448.335) (-1446.961) [-1447.526] (-1445.801) * (-1449.642) (-1448.415) [-1445.999] (-1446.226) -- 0:00:57
      149500 -- [-1446.725] (-1448.549) (-1448.840) (-1449.232) * [-1447.973] (-1445.785) (-1445.854) (-1446.967) -- 0:00:56
      150000 -- (-1446.271) [-1445.423] (-1450.257) (-1447.332) * (-1448.769) [-1445.525] (-1448.728) (-1445.561) -- 0:00:56

      Average standard deviation of split frequencies: 0.014949

      150500 -- (-1446.589) [-1445.282] (-1451.221) (-1446.089) * (-1447.878) [-1447.316] (-1448.072) (-1453.709) -- 0:00:56
      151000 -- (-1449.468) (-1446.930) [-1447.400] (-1446.049) * (-1447.570) (-1446.952) [-1448.822] (-1453.175) -- 0:00:56
      151500 -- (-1448.539) (-1446.930) (-1448.094) [-1446.037] * [-1447.544] (-1446.231) (-1447.692) (-1447.428) -- 0:00:56
      152000 -- (-1445.554) (-1447.773) (-1447.304) [-1446.164] * (-1447.060) (-1446.111) (-1447.762) [-1447.329] -- 0:00:55
      152500 -- [-1445.435] (-1445.678) (-1447.133) (-1447.438) * [-1448.987] (-1445.989) (-1446.514) (-1450.440) -- 0:00:55
      153000 -- (-1446.156) (-1445.776) (-1446.706) [-1447.887] * [-1453.037] (-1448.821) (-1447.259) (-1447.310) -- 0:00:55
      153500 -- (-1446.388) [-1447.786] (-1452.700) (-1446.789) * (-1450.892) (-1449.869) [-1448.395] (-1447.090) -- 0:00:55
      154000 -- (-1453.076) [-1449.079] (-1449.164) (-1447.273) * (-1447.962) (-1448.210) [-1446.674] (-1446.901) -- 0:00:54
      154500 -- (-1448.702) (-1450.024) (-1447.193) [-1447.644] * [-1451.094] (-1449.258) (-1445.741) (-1447.337) -- 0:00:54
      155000 -- (-1448.088) [-1454.081] (-1446.904) (-1447.658) * (-1454.571) (-1446.731) [-1445.605] (-1447.210) -- 0:00:54

      Average standard deviation of split frequencies: 0.015109

      155500 -- (-1447.778) (-1450.297) [-1446.476] (-1448.506) * (-1446.225) [-1447.637] (-1445.527) (-1451.505) -- 0:00:54
      156000 -- (-1448.837) (-1448.234) [-1446.160] (-1448.078) * [-1445.734] (-1445.770) (-1450.400) (-1448.234) -- 0:00:54
      156500 -- [-1446.298] (-1447.786) (-1446.788) (-1446.903) * (-1445.531) (-1449.005) (-1453.361) [-1446.375] -- 0:00:53
      157000 -- [-1447.221] (-1445.985) (-1447.934) (-1447.151) * (-1446.744) [-1448.962] (-1452.986) (-1446.381) -- 0:00:53
      157500 -- (-1446.339) (-1446.855) [-1445.947] (-1446.351) * (-1447.616) [-1448.050] (-1449.543) (-1446.848) -- 0:00:53
      158000 -- (-1447.313) (-1449.378) (-1447.306) [-1446.469] * (-1446.388) (-1446.453) [-1448.757] (-1449.091) -- 0:00:53
      158500 -- (-1445.815) [-1447.317] (-1449.496) (-1446.900) * (-1446.219) (-1446.669) (-1445.922) [-1446.974] -- 0:00:53
      159000 -- (-1445.511) [-1447.588] (-1447.048) (-1447.206) * (-1445.788) (-1446.026) [-1446.210] (-1453.011) -- 0:00:52
      159500 -- (-1446.356) (-1446.509) [-1447.290] (-1447.521) * (-1449.041) [-1445.999] (-1446.369) (-1447.424) -- 0:00:52
      160000 -- (-1446.351) [-1447.091] (-1446.801) (-1448.474) * (-1449.034) [-1447.518] (-1445.851) (-1450.507) -- 0:00:52

      Average standard deviation of split frequencies: 0.016396

      160500 -- (-1446.384) [-1448.349] (-1450.288) (-1446.298) * (-1445.843) (-1446.918) (-1445.600) [-1447.467] -- 0:00:52
      161000 -- (-1447.055) (-1445.525) [-1446.235] (-1446.529) * (-1446.976) (-1445.821) [-1446.211] (-1446.391) -- 0:00:52
      161500 -- (-1450.113) [-1445.605] (-1447.264) (-1446.936) * [-1447.020] (-1449.879) (-1446.203) (-1447.948) -- 0:00:51
      162000 -- [-1445.830] (-1451.061) (-1446.196) (-1454.656) * (-1446.155) [-1446.333] (-1445.125) (-1449.439) -- 0:00:51
      162500 -- (-1446.431) (-1447.330) (-1447.794) [-1446.006] * (-1450.035) (-1448.921) [-1445.946] (-1445.792) -- 0:00:51
      163000 -- (-1448.309) (-1447.998) (-1450.054) [-1447.500] * [-1445.712] (-1447.710) (-1450.052) (-1449.211) -- 0:00:51
      163500 -- (-1448.945) (-1449.245) [-1447.157] (-1449.242) * (-1445.664) (-1446.422) (-1446.493) [-1448.146] -- 0:00:51
      164000 -- (-1451.616) (-1447.902) (-1446.467) [-1450.113] * (-1445.831) [-1446.524] (-1445.429) (-1447.153) -- 0:00:56
      164500 -- (-1453.722) [-1448.692] (-1446.430) (-1448.384) * (-1445.830) (-1447.243) (-1445.825) [-1449.439] -- 0:00:55
      165000 -- (-1449.528) (-1448.052) [-1445.486] (-1448.760) * (-1447.268) [-1446.499] (-1448.957) (-1447.583) -- 0:00:55

      Average standard deviation of split frequencies: 0.016881

      165500 -- [-1446.266] (-1446.210) (-1445.641) (-1447.101) * (-1447.384) [-1449.922] (-1449.248) (-1452.030) -- 0:00:55
      166000 -- (-1446.546) (-1446.144) [-1446.124] (-1448.652) * [-1448.224] (-1448.625) (-1448.518) (-1450.233) -- 0:00:55
      166500 -- (-1452.143) [-1446.101] (-1446.224) (-1448.745) * (-1448.726) [-1450.536] (-1450.081) (-1446.458) -- 0:00:55
      167000 -- (-1447.255) (-1447.858) (-1446.889) [-1446.545] * (-1447.042) (-1447.497) (-1451.943) [-1447.397] -- 0:00:54
      167500 -- [-1448.512] (-1446.289) (-1447.842) (-1446.305) * (-1447.054) (-1449.706) (-1448.592) [-1448.970] -- 0:00:54
      168000 -- [-1446.519] (-1447.773) (-1447.313) (-1449.964) * (-1447.082) (-1449.041) [-1446.969] (-1446.467) -- 0:00:54
      168500 -- (-1447.596) (-1447.042) [-1446.824] (-1446.718) * (-1445.589) (-1449.147) [-1448.363] (-1449.358) -- 0:00:54
      169000 -- [-1449.208] (-1448.447) (-1448.407) (-1447.706) * (-1446.628) [-1449.451] (-1448.718) (-1451.976) -- 0:00:54
      169500 -- (-1446.368) (-1449.841) [-1446.609] (-1450.360) * (-1448.726) (-1447.635) [-1447.333] (-1449.244) -- 0:00:53
      170000 -- (-1446.659) [-1450.002] (-1448.639) (-1449.673) * (-1447.680) (-1448.342) (-1445.836) [-1452.788] -- 0:00:53

      Average standard deviation of split frequencies: 0.016880

      170500 -- (-1446.874) (-1450.025) [-1448.821] (-1446.765) * (-1447.512) (-1447.157) (-1448.335) [-1449.464] -- 0:00:53
      171000 -- (-1448.147) (-1445.881) (-1448.786) [-1446.085] * (-1453.446) (-1447.607) (-1448.105) [-1446.209] -- 0:00:53
      171500 -- (-1447.818) [-1446.754] (-1456.679) (-1446.250) * (-1448.733) (-1447.226) [-1446.341] (-1447.988) -- 0:00:53
      172000 -- (-1448.512) [-1446.617] (-1451.051) (-1449.673) * (-1447.439) (-1449.963) (-1446.038) [-1449.388] -- 0:00:52
      172500 -- (-1448.435) (-1447.024) [-1450.405] (-1449.269) * [-1446.630] (-1450.138) (-1447.292) (-1449.942) -- 0:00:52
      173000 -- (-1447.712) (-1446.396) (-1452.522) [-1446.193] * [-1446.485] (-1449.902) (-1445.428) (-1447.029) -- 0:00:52
      173500 -- [-1448.533] (-1445.688) (-1452.188) (-1447.039) * (-1446.415) (-1446.093) [-1446.254] (-1448.334) -- 0:00:52
      174000 -- (-1446.679) (-1446.691) (-1447.055) [-1449.095] * (-1447.078) (-1445.597) (-1448.266) [-1448.439] -- 0:00:52
      174500 -- [-1447.368] (-1447.208) (-1448.657) (-1449.079) * [-1447.622] (-1445.923) (-1447.579) (-1446.719) -- 0:00:52
      175000 -- [-1448.377] (-1446.983) (-1452.007) (-1448.774) * (-1447.777) (-1452.686) [-1449.891] (-1447.946) -- 0:00:51

      Average standard deviation of split frequencies: 0.017331

      175500 -- (-1446.880) [-1446.014] (-1446.929) (-1447.485) * (-1446.481) (-1452.740) (-1446.723) [-1447.152] -- 0:00:51
      176000 -- [-1447.831] (-1445.927) (-1447.449) (-1448.390) * (-1446.748) (-1448.897) (-1449.280) [-1447.111] -- 0:00:51
      176500 -- (-1447.482) (-1450.448) (-1454.291) [-1447.821] * (-1446.603) [-1445.630] (-1445.989) (-1449.201) -- 0:00:51
      177000 -- [-1448.211] (-1447.723) (-1450.199) (-1447.768) * (-1450.127) [-1446.014] (-1447.233) (-1448.470) -- 0:00:51
      177500 -- (-1450.794) (-1449.449) (-1447.103) [-1451.094] * [-1448.889] (-1446.520) (-1446.852) (-1447.189) -- 0:00:50
      178000 -- (-1451.584) (-1448.965) (-1445.902) [-1447.368] * (-1446.531) (-1446.533) [-1445.178] (-1446.736) -- 0:00:50
      178500 -- (-1447.600) (-1446.599) [-1447.303] (-1446.852) * (-1448.812) [-1445.836] (-1446.459) (-1446.160) -- 0:00:50
      179000 -- (-1447.612) (-1446.651) [-1446.240] (-1450.160) * (-1449.384) (-1445.833) [-1446.897] (-1449.366) -- 0:00:50
      179500 -- [-1447.764] (-1453.292) (-1448.088) (-1450.158) * [-1446.846] (-1445.664) (-1448.800) (-1446.173) -- 0:00:54
      180000 -- (-1452.025) (-1446.455) (-1448.148) [-1449.020] * (-1447.734) (-1446.248) [-1446.246] (-1445.787) -- 0:00:54

      Average standard deviation of split frequencies: 0.018265

      180500 -- (-1450.244) (-1446.558) (-1446.070) [-1448.027] * (-1448.822) [-1445.828] (-1447.685) (-1445.497) -- 0:00:54
      181000 -- (-1450.324) [-1446.889] (-1450.287) (-1449.360) * (-1450.619) (-1449.248) (-1446.033) [-1446.764] -- 0:00:54
      181500 -- (-1450.621) [-1453.372] (-1448.467) (-1449.274) * [-1449.904] (-1448.955) (-1446.032) (-1449.050) -- 0:00:54
      182000 -- (-1449.149) (-1448.499) [-1446.966] (-1449.499) * [-1448.038] (-1447.368) (-1445.528) (-1446.499) -- 0:00:53
      182500 -- [-1447.540] (-1448.233) (-1446.242) (-1449.991) * [-1445.519] (-1446.554) (-1445.684) (-1447.088) -- 0:00:53
      183000 -- (-1447.736) (-1447.758) (-1446.899) [-1448.324] * (-1445.664) (-1448.988) (-1446.882) [-1447.088] -- 0:00:53
      183500 -- (-1447.751) [-1447.463] (-1446.432) (-1448.346) * (-1452.139) (-1447.590) (-1446.882) [-1448.273] -- 0:00:53
      184000 -- [-1447.800] (-1448.427) (-1449.633) (-1447.309) * (-1447.315) [-1447.571] (-1446.287) (-1446.272) -- 0:00:53
      184500 -- [-1449.541] (-1446.953) (-1452.515) (-1447.155) * [-1446.322] (-1449.161) (-1446.476) (-1448.579) -- 0:00:53
      185000 -- (-1447.906) (-1446.185) [-1447.508] (-1447.313) * (-1446.508) (-1447.643) (-1447.397) [-1449.230] -- 0:00:52

      Average standard deviation of split frequencies: 0.018188

      185500 -- (-1456.782) [-1446.175] (-1445.806) (-1449.204) * [-1445.074] (-1447.594) (-1446.859) (-1449.926) -- 0:00:52
      186000 -- [-1449.670] (-1447.091) (-1445.885) (-1448.687) * (-1450.246) [-1447.261] (-1450.842) (-1448.430) -- 0:00:52
      186500 -- (-1446.963) (-1446.826) (-1449.100) [-1446.703] * (-1446.592) (-1446.932) (-1451.108) [-1446.863] -- 0:00:52
      187000 -- (-1445.903) (-1447.633) (-1447.688) [-1446.050] * (-1446.918) (-1447.803) (-1450.243) [-1445.977] -- 0:00:52
      187500 -- (-1446.586) [-1448.434] (-1447.926) (-1447.691) * (-1447.213) (-1445.235) (-1453.249) [-1448.020] -- 0:00:52
      188000 -- (-1448.656) (-1445.740) [-1448.407] (-1451.499) * (-1446.470) (-1447.120) (-1448.597) [-1446.550] -- 0:00:51
      188500 -- (-1447.523) (-1445.740) [-1449.657] (-1447.465) * (-1448.698) (-1449.955) (-1447.634) [-1447.797] -- 0:00:51
      189000 -- (-1446.660) (-1447.751) [-1446.582] (-1446.117) * (-1447.921) (-1447.372) [-1446.508] (-1448.586) -- 0:00:51
      189500 -- [-1447.074] (-1446.573) (-1445.965) (-1445.428) * (-1446.916) (-1447.558) [-1448.930] (-1447.785) -- 0:00:51
      190000 -- (-1446.746) [-1447.049] (-1447.288) (-1445.656) * (-1447.293) (-1447.467) [-1449.319] (-1449.904) -- 0:00:51

      Average standard deviation of split frequencies: 0.019779

      190500 -- [-1447.737] (-1446.797) (-1447.741) (-1446.782) * [-1447.207] (-1445.566) (-1445.834) (-1448.835) -- 0:00:50
      191000 -- [-1446.872] (-1445.402) (-1448.385) (-1448.120) * (-1450.636) (-1450.014) (-1446.787) [-1447.243] -- 0:00:50
      191500 -- (-1447.315) (-1452.149) [-1449.854] (-1445.680) * (-1450.072) [-1447.217] (-1448.454) (-1447.700) -- 0:00:50
      192000 -- (-1447.923) (-1448.007) (-1447.851) [-1446.313] * (-1446.361) (-1446.377) (-1450.385) [-1447.840] -- 0:00:50
      192500 -- (-1451.446) [-1447.127] (-1447.405) (-1447.583) * (-1448.311) (-1446.110) (-1449.457) [-1447.299] -- 0:00:50
      193000 -- (-1450.586) [-1445.705] (-1447.721) (-1446.988) * (-1450.656) (-1447.638) [-1449.033] (-1447.101) -- 0:00:50
      193500 -- (-1449.673) (-1448.301) [-1448.686] (-1447.125) * [-1450.162] (-1447.165) (-1448.885) (-1447.103) -- 0:00:50
      194000 -- (-1446.580) (-1445.778) (-1448.459) [-1448.461] * (-1448.495) (-1445.837) (-1446.059) [-1449.773] -- 0:00:49
      194500 -- (-1446.076) (-1446.545) (-1446.603) [-1450.085] * (-1446.467) (-1447.076) (-1446.514) [-1446.156] -- 0:00:49
      195000 -- [-1446.605] (-1450.347) (-1447.348) (-1447.802) * (-1447.431) [-1447.646] (-1447.684) (-1445.839) -- 0:00:49

      Average standard deviation of split frequencies: 0.019107

      195500 -- (-1450.754) (-1449.064) [-1447.848] (-1446.451) * (-1448.343) (-1447.835) (-1446.818) [-1448.466] -- 0:00:53
      196000 -- (-1451.136) (-1446.999) [-1446.029] (-1446.933) * [-1446.140] (-1449.073) (-1446.979) (-1446.591) -- 0:00:53
      196500 -- (-1448.143) (-1445.907) [-1446.526] (-1446.480) * [-1446.161] (-1448.979) (-1446.980) (-1446.098) -- 0:00:53
      197000 -- (-1446.646) (-1447.214) (-1447.705) [-1447.316] * (-1446.121) [-1446.523] (-1448.543) (-1447.414) -- 0:00:52
      197500 -- (-1448.772) [-1447.241] (-1448.151) (-1446.218) * [-1449.028] (-1446.820) (-1448.077) (-1445.233) -- 0:00:52
      198000 -- (-1448.918) (-1447.686) (-1450.510) [-1450.422] * (-1446.926) (-1447.558) [-1449.090] (-1450.130) -- 0:00:52
      198500 -- (-1448.016) (-1447.696) [-1448.566] (-1449.961) * [-1446.076] (-1447.258) (-1446.422) (-1449.460) -- 0:00:52
      199000 -- (-1450.001) (-1447.179) (-1448.985) [-1449.478] * (-1445.468) (-1449.628) [-1446.422] (-1453.347) -- 0:00:52
      199500 -- (-1452.106) (-1445.983) (-1448.539) [-1448.467] * (-1445.505) [-1451.818] (-1447.422) (-1452.671) -- 0:00:52
      200000 -- (-1447.054) [-1445.485] (-1447.802) (-1450.336) * [-1448.905] (-1445.675) (-1448.104) (-1450.810) -- 0:00:51

      Average standard deviation of split frequencies: 0.016183

      200500 -- (-1448.226) [-1448.023] (-1446.341) (-1447.696) * (-1446.334) [-1446.054] (-1448.334) (-1448.701) -- 0:00:51
      201000 -- (-1451.220) [-1446.956] (-1446.418) (-1448.340) * (-1450.227) (-1445.745) [-1448.160] (-1447.979) -- 0:00:51
      201500 -- (-1448.905) (-1446.190) (-1446.274) [-1445.830] * (-1447.747) [-1445.891] (-1448.809) (-1447.725) -- 0:00:51
      202000 -- (-1447.344) (-1449.104) (-1445.652) [-1446.624] * (-1449.950) [-1447.274] (-1449.113) (-1446.029) -- 0:00:51
      202500 -- [-1446.997] (-1446.497) (-1447.434) (-1446.299) * (-1447.292) [-1446.425] (-1447.058) (-1445.521) -- 0:00:51
      203000 -- (-1447.411) (-1446.099) (-1445.415) [-1448.267] * (-1449.330) [-1446.560] (-1449.461) (-1445.445) -- 0:00:51
      203500 -- (-1447.441) (-1446.419) (-1445.628) [-1448.903] * (-1448.976) (-1446.428) [-1448.827] (-1445.375) -- 0:00:50
      204000 -- (-1447.869) [-1447.408] (-1447.359) (-1450.594) * (-1447.531) [-1445.969] (-1450.989) (-1445.375) -- 0:00:50
      204500 -- (-1450.204) (-1448.703) (-1448.047) [-1445.905] * [-1450.347] (-1446.005) (-1448.676) (-1447.267) -- 0:00:50
      205000 -- [-1450.226] (-1447.575) (-1446.408) (-1447.147) * (-1449.372) [-1445.187] (-1446.078) (-1445.737) -- 0:00:50

      Average standard deviation of split frequencies: 0.015764

      205500 -- (-1447.688) (-1453.585) [-1447.402] (-1454.295) * (-1447.903) [-1445.754] (-1446.017) (-1446.777) -- 0:00:50
      206000 -- (-1447.402) [-1449.049] (-1448.588) (-1455.802) * (-1447.134) [-1446.707] (-1445.629) (-1453.652) -- 0:00:50
      206500 -- [-1446.793] (-1449.854) (-1451.133) (-1448.673) * (-1446.456) (-1448.072) [-1445.899] (-1449.411) -- 0:00:49
      207000 -- (-1446.022) [-1448.454] (-1446.578) (-1448.254) * (-1447.927) (-1449.796) [-1446.373] (-1446.029) -- 0:00:49
      207500 -- (-1448.948) [-1449.614] (-1447.436) (-1449.224) * (-1447.602) [-1450.206] (-1447.898) (-1447.486) -- 0:00:49
      208000 -- (-1446.070) (-1450.530) (-1446.636) [-1451.323] * (-1447.726) (-1446.685) [-1445.972] (-1447.331) -- 0:00:49
      208500 -- (-1446.799) [-1448.257] (-1448.883) (-1448.921) * (-1448.165) (-1446.071) [-1446.010] (-1448.385) -- 0:00:49
      209000 -- (-1445.572) (-1448.573) (-1448.080) [-1446.926] * (-1447.795) (-1446.204) [-1446.039] (-1447.499) -- 0:00:49
      209500 -- (-1446.729) (-1447.076) [-1447.287] (-1447.196) * (-1447.089) [-1446.320] (-1449.295) (-1446.824) -- 0:00:49
      210000 -- (-1446.484) (-1449.510) [-1446.949] (-1447.196) * (-1446.939) [-1447.252] (-1446.152) (-1446.894) -- 0:00:48

      Average standard deviation of split frequencies: 0.014048

      210500 -- (-1449.503) (-1450.077) [-1448.329] (-1445.494) * (-1447.048) (-1446.608) (-1448.754) [-1446.933] -- 0:00:52
      211000 -- (-1450.878) [-1447.291] (-1446.381) (-1446.446) * (-1446.736) (-1446.609) [-1451.703] (-1449.282) -- 0:00:52
      211500 -- (-1449.485) (-1449.769) (-1450.289) [-1447.504] * [-1449.083] (-1449.439) (-1446.716) (-1446.154) -- 0:00:52
      212000 -- (-1447.274) (-1451.880) (-1446.270) [-1446.281] * (-1447.541) [-1447.228] (-1447.859) (-1447.691) -- 0:00:52
      212500 -- (-1446.568) (-1454.155) [-1448.011] (-1449.882) * (-1446.931) (-1446.007) [-1445.753] (-1446.480) -- 0:00:51
      213000 -- (-1449.241) [-1447.855] (-1447.909) (-1445.384) * (-1450.956) (-1445.055) (-1449.453) [-1446.773] -- 0:00:51
      213500 -- (-1448.334) (-1447.258) (-1446.072) [-1446.276] * [-1450.421] (-1445.455) (-1447.232) (-1445.822) -- 0:00:51
      214000 -- (-1447.372) (-1449.659) (-1448.363) [-1448.250] * [-1447.312] (-1446.179) (-1448.932) (-1445.949) -- 0:00:51
      214500 -- (-1448.212) [-1450.348] (-1445.104) (-1446.010) * (-1450.229) (-1449.003) [-1446.695] (-1446.385) -- 0:00:51
      215000 -- (-1449.305) (-1446.107) (-1446.471) [-1446.239] * (-1453.326) [-1446.581] (-1447.424) (-1446.433) -- 0:00:51

      Average standard deviation of split frequencies: 0.014378

      215500 -- (-1447.122) (-1446.941) [-1446.342] (-1448.988) * (-1450.520) (-1446.273) [-1446.554] (-1447.246) -- 0:00:50
      216000 -- (-1447.275) (-1446.847) [-1446.093] (-1449.426) * (-1449.172) (-1449.868) [-1445.844] (-1446.025) -- 0:00:50
      216500 -- (-1447.432) [-1447.458] (-1450.676) (-1448.460) * (-1446.247) [-1454.940] (-1446.892) (-1448.946) -- 0:00:50
      217000 -- (-1448.447) (-1446.547) (-1457.302) [-1447.793] * (-1447.947) (-1451.584) [-1447.954] (-1448.093) -- 0:00:50
      217500 -- (-1447.821) (-1447.330) [-1447.857] (-1449.714) * (-1448.301) (-1448.565) [-1446.389] (-1449.806) -- 0:00:50
      218000 -- [-1447.557] (-1446.305) (-1447.633) (-1448.865) * (-1448.870) (-1445.842) (-1449.115) [-1452.766] -- 0:00:50
      218500 -- (-1448.436) (-1447.018) (-1451.030) [-1446.410] * [-1448.187] (-1446.039) (-1446.591) (-1445.891) -- 0:00:50
      219000 -- (-1452.453) (-1446.145) (-1449.671) [-1445.323] * [-1446.717] (-1445.230) (-1450.296) (-1446.260) -- 0:00:49
      219500 -- [-1447.601] (-1451.047) (-1447.072) (-1446.377) * (-1446.180) (-1446.324) (-1451.033) [-1446.953] -- 0:00:49
      220000 -- (-1445.828) (-1451.123) [-1449.079] (-1446.473) * (-1445.995) (-1446.834) (-1449.635) [-1446.141] -- 0:00:49

      Average standard deviation of split frequencies: 0.015457

      220500 -- (-1445.623) [-1447.605] (-1447.579) (-1445.578) * (-1447.881) (-1447.985) (-1451.342) [-1447.276] -- 0:00:49
      221000 -- (-1447.316) (-1451.518) (-1445.935) [-1447.613] * (-1446.994) [-1448.692] (-1449.587) (-1449.515) -- 0:00:49
      221500 -- (-1446.299) [-1449.814] (-1447.418) (-1446.399) * (-1447.770) (-1448.852) [-1448.921] (-1449.891) -- 0:00:49
      222000 -- (-1446.102) [-1446.544] (-1446.410) (-1445.668) * (-1449.180) [-1448.662] (-1448.671) (-1447.491) -- 0:00:49
      222500 -- (-1446.156) [-1449.572] (-1446.143) (-1447.409) * (-1447.333) (-1447.270) (-1449.004) [-1447.864] -- 0:00:48
      223000 -- (-1446.179) [-1446.121] (-1445.949) (-1447.056) * (-1447.072) (-1445.910) [-1446.333] (-1447.244) -- 0:00:48
      223500 -- (-1450.707) (-1445.289) (-1446.306) [-1447.282] * (-1448.145) (-1447.147) (-1447.262) [-1447.887] -- 0:00:48
      224000 -- (-1446.278) (-1448.996) [-1446.306] (-1445.362) * (-1446.472) [-1446.684] (-1447.804) (-1446.226) -- 0:00:48
      224500 -- [-1446.387] (-1451.238) (-1446.301) (-1445.337) * [-1447.018] (-1447.015) (-1445.281) (-1445.337) -- 0:00:48
      225000 -- (-1445.975) (-1451.001) [-1449.041] (-1447.640) * (-1446.199) (-1447.542) (-1450.487) [-1445.148] -- 0:00:48

      Average standard deviation of split frequencies: 0.016319

      225500 -- (-1447.879) (-1451.195) (-1447.795) [-1447.187] * (-1450.515) [-1445.937] (-1449.660) (-1446.529) -- 0:00:48
      226000 -- (-1450.255) [-1446.132] (-1446.749) (-1449.236) * [-1451.732] (-1445.554) (-1451.602) (-1446.537) -- 0:00:47
      226500 -- (-1447.617) (-1447.015) [-1446.640] (-1450.613) * (-1445.951) (-1446.713) [-1445.797] (-1451.457) -- 0:00:51
      227000 -- [-1447.511] (-1447.202) (-1445.583) (-1454.573) * [-1446.102] (-1449.028) (-1451.185) (-1451.700) -- 0:00:51
      227500 -- (-1449.123) (-1449.215) [-1447.721] (-1451.348) * (-1447.234) [-1445.721] (-1451.497) (-1450.916) -- 0:00:50
      228000 -- [-1445.797] (-1449.965) (-1449.136) (-1451.135) * (-1449.452) (-1446.501) (-1449.356) [-1448.954] -- 0:00:50
      228500 -- [-1446.701] (-1451.642) (-1446.780) (-1449.928) * (-1446.121) (-1451.242) (-1447.240) [-1448.561] -- 0:00:50
      229000 -- [-1448.063] (-1451.252) (-1447.624) (-1447.970) * (-1449.686) (-1448.338) (-1448.261) [-1445.800] -- 0:00:50
      229500 -- [-1446.772] (-1447.982) (-1451.168) (-1448.638) * (-1449.755) (-1447.774) (-1450.077) [-1445.663] -- 0:00:50
      230000 -- [-1446.396] (-1448.906) (-1448.656) (-1447.679) * (-1453.574) (-1446.793) (-1449.278) [-1445.716] -- 0:00:50

      Average standard deviation of split frequencies: 0.018961

      230500 -- (-1448.215) (-1446.769) (-1447.517) [-1445.813] * (-1445.832) (-1446.110) [-1449.006] (-1449.140) -- 0:00:50
      231000 -- [-1451.107] (-1446.763) (-1448.375) (-1446.088) * (-1447.568) [-1446.229] (-1447.335) (-1449.168) -- 0:00:49
      231500 -- (-1451.068) (-1449.716) [-1449.191] (-1449.551) * (-1448.432) (-1446.229) [-1447.395] (-1445.484) -- 0:00:49
      232000 -- (-1447.062) (-1447.131) (-1449.141) [-1448.701] * (-1446.556) (-1445.372) (-1449.905) [-1445.516] -- 0:00:49
      232500 -- (-1446.630) [-1449.771] (-1450.751) (-1447.256) * (-1449.892) [-1445.810] (-1447.741) (-1447.483) -- 0:00:49
      233000 -- (-1446.101) [-1449.739] (-1447.889) (-1447.941) * [-1447.996] (-1445.476) (-1450.763) (-1447.874) -- 0:00:49
      233500 -- (-1446.150) (-1451.093) [-1448.065] (-1450.828) * (-1447.383) (-1446.297) [-1446.611] (-1448.343) -- 0:00:49
      234000 -- [-1446.452] (-1450.617) (-1452.262) (-1450.008) * (-1448.203) (-1446.297) [-1447.592] (-1448.527) -- 0:00:49
      234500 -- (-1448.318) [-1447.631] (-1448.432) (-1451.206) * (-1446.006) [-1445.587] (-1448.504) (-1449.860) -- 0:00:48
      235000 -- (-1447.338) (-1445.954) [-1450.956] (-1451.829) * [-1447.376] (-1448.833) (-1448.164) (-1448.343) -- 0:00:48

      Average standard deviation of split frequencies: 0.019152

      235500 -- (-1448.600) (-1448.811) (-1450.308) [-1450.345] * (-1447.254) (-1450.292) [-1448.303] (-1448.403) -- 0:00:48
      236000 -- (-1446.832) [-1447.803] (-1448.929) (-1446.056) * (-1450.575) (-1446.616) [-1447.159] (-1447.660) -- 0:00:48
      236500 -- [-1448.859] (-1448.211) (-1451.278) (-1448.234) * [-1448.471] (-1446.810) (-1446.829) (-1452.081) -- 0:00:48
      237000 -- (-1449.404) (-1453.800) [-1446.019] (-1448.514) * (-1448.472) [-1448.070] (-1446.501) (-1448.317) -- 0:00:48
      237500 -- (-1445.569) (-1451.335) [-1446.336] (-1450.282) * (-1446.402) [-1449.019] (-1448.720) (-1445.624) -- 0:00:48
      238000 -- (-1445.768) [-1449.462] (-1446.972) (-1451.933) * (-1446.891) [-1446.697] (-1452.228) (-1445.722) -- 0:00:48
      238500 -- [-1446.100] (-1451.474) (-1446.998) (-1453.809) * (-1448.010) [-1446.867] (-1456.167) (-1445.319) -- 0:00:47
      239000 -- [-1447.059] (-1446.881) (-1446.143) (-1451.409) * (-1447.419) (-1447.751) (-1448.725) [-1445.286] -- 0:00:47
      239500 -- [-1446.628] (-1446.782) (-1446.416) (-1451.388) * (-1447.324) (-1448.275) [-1449.776] (-1447.421) -- 0:00:47
      240000 -- [-1448.383] (-1450.550) (-1447.671) (-1446.857) * [-1447.082] (-1445.634) (-1448.525) (-1447.514) -- 0:00:47

      Average standard deviation of split frequencies: 0.017629

      240500 -- (-1447.729) [-1448.527] (-1448.731) (-1448.866) * (-1446.977) (-1445.849) [-1451.045] (-1447.657) -- 0:00:47
      241000 -- [-1447.068] (-1451.075) (-1447.819) (-1448.276) * (-1447.453) (-1447.077) (-1452.325) [-1448.121] -- 0:00:47
      241500 -- (-1448.476) (-1446.832) [-1450.217] (-1446.940) * (-1447.146) (-1452.449) (-1448.488) [-1449.824] -- 0:00:47
      242000 -- [-1448.250] (-1446.520) (-1449.446) (-1448.875) * (-1450.130) (-1448.080) [-1446.257] (-1448.618) -- 0:00:46
      242500 -- (-1445.869) [-1446.366] (-1449.110) (-1445.882) * [-1447.049] (-1448.910) (-1446.663) (-1445.466) -- 0:00:49
      243000 -- [-1446.684] (-1450.857) (-1448.419) (-1445.867) * (-1445.595) (-1448.292) (-1447.129) [-1445.524] -- 0:00:49
      243500 -- (-1446.493) (-1449.099) [-1448.673] (-1445.768) * (-1446.509) (-1445.751) (-1447.837) [-1449.418] -- 0:00:49
      244000 -- (-1445.747) [-1449.961] (-1451.522) (-1447.006) * (-1446.759) [-1446.221] (-1447.857) (-1448.593) -- 0:00:49
      244500 -- (-1445.911) (-1447.247) (-1449.000) [-1449.375] * (-1445.445) [-1448.452] (-1447.188) (-1449.294) -- 0:00:49
      245000 -- (-1450.643) [-1446.399] (-1451.462) (-1452.355) * [-1447.352] (-1447.084) (-1446.150) (-1447.992) -- 0:00:49

      Average standard deviation of split frequencies: 0.015650

      245500 -- (-1445.962) (-1447.061) (-1449.770) [-1451.454] * (-1445.651) [-1447.831] (-1445.994) (-1448.082) -- 0:00:49
      246000 -- [-1446.728] (-1448.408) (-1447.152) (-1449.809) * (-1447.724) (-1450.168) (-1446.299) [-1450.747] -- 0:00:49
      246500 -- (-1447.302) [-1447.812] (-1446.869) (-1446.228) * (-1445.948) (-1446.277) [-1447.316] (-1447.880) -- 0:00:48
      247000 -- (-1446.685) (-1448.139) [-1445.320] (-1446.301) * (-1447.214) [-1448.285] (-1447.374) (-1451.083) -- 0:00:48
      247500 -- [-1447.019] (-1447.146) (-1446.912) (-1446.737) * [-1448.007] (-1447.355) (-1448.146) (-1450.170) -- 0:00:48
      248000 -- (-1448.541) (-1447.301) [-1446.394] (-1450.349) * (-1447.803) (-1446.969) [-1447.176] (-1451.202) -- 0:00:48
      248500 -- (-1449.100) (-1446.952) [-1445.744] (-1448.606) * (-1448.034) [-1447.370] (-1447.923) (-1447.142) -- 0:00:48
      249000 -- [-1447.648] (-1448.856) (-1446.928) (-1450.106) * [-1450.073] (-1447.652) (-1447.763) (-1447.142) -- 0:00:48
      249500 -- (-1446.945) [-1447.687] (-1446.129) (-1451.450) * (-1450.951) [-1447.182] (-1447.768) (-1446.261) -- 0:00:48
      250000 -- (-1448.921) (-1448.021) (-1448.341) [-1451.526] * (-1447.147) [-1445.406] (-1447.867) (-1451.326) -- 0:00:48

      Average standard deviation of split frequencies: 0.015881

      250500 -- (-1448.557) [-1448.442] (-1446.840) (-1449.504) * (-1447.918) (-1446.030) (-1449.172) [-1446.417] -- 0:00:47
      251000 -- (-1454.518) [-1448.879] (-1446.515) (-1449.032) * (-1451.115) [-1445.876] (-1446.097) (-1447.542) -- 0:00:47
      251500 -- (-1451.039) (-1445.887) [-1445.973] (-1447.718) * (-1450.940) (-1448.067) [-1446.469] (-1445.759) -- 0:00:47
      252000 -- (-1451.142) (-1447.006) (-1447.535) [-1448.082] * [-1447.795] (-1447.777) (-1448.905) (-1446.874) -- 0:00:47
      252500 -- [-1447.216] (-1445.603) (-1448.019) (-1449.343) * (-1447.943) (-1447.880) (-1449.196) [-1451.958] -- 0:00:47
      253000 -- [-1451.003] (-1446.898) (-1447.110) (-1449.416) * (-1449.116) [-1446.343] (-1447.532) (-1447.910) -- 0:00:47
      253500 -- (-1450.680) [-1447.480] (-1448.521) (-1446.837) * [-1448.260] (-1446.370) (-1446.762) (-1446.116) -- 0:00:47
      254000 -- (-1449.800) (-1449.077) [-1446.129] (-1445.501) * (-1447.630) (-1447.588) (-1446.007) [-1446.395] -- 0:00:46
      254500 -- [-1451.964] (-1447.705) (-1447.304) (-1445.487) * [-1447.885] (-1447.174) (-1448.139) (-1446.647) -- 0:00:46
      255000 -- (-1452.352) (-1448.713) [-1446.223] (-1445.467) * [-1448.414] (-1447.247) (-1452.522) (-1450.563) -- 0:00:46

      Average standard deviation of split frequencies: 0.016088

      255500 -- (-1446.518) (-1451.725) (-1445.904) [-1446.318] * [-1447.311] (-1449.135) (-1450.962) (-1448.441) -- 0:00:46
      256000 -- (-1447.630) (-1449.736) (-1446.743) [-1446.314] * (-1445.665) [-1449.727] (-1447.561) (-1447.481) -- 0:00:46
      256500 -- (-1447.202) (-1448.609) [-1448.155] (-1447.297) * (-1446.008) (-1449.325) (-1446.213) [-1446.658] -- 0:00:46
      257000 -- (-1446.211) (-1449.948) [-1447.269] (-1447.787) * [-1450.412] (-1447.865) (-1446.934) (-1448.528) -- 0:00:46
      257500 -- [-1447.071] (-1449.347) (-1446.885) (-1450.684) * [-1446.533] (-1448.906) (-1448.178) (-1455.500) -- 0:00:46
      258000 -- (-1451.726) (-1451.656) [-1446.271] (-1446.012) * [-1445.118] (-1449.099) (-1447.580) (-1447.046) -- 0:00:48
      258500 -- (-1452.338) (-1450.292) (-1446.363) [-1447.738] * (-1446.983) [-1448.069] (-1449.728) (-1447.473) -- 0:00:48
      259000 -- (-1449.678) (-1448.843) [-1447.856] (-1445.762) * (-1446.525) (-1450.730) (-1452.023) [-1445.327] -- 0:00:48
      259500 -- (-1450.181) (-1446.919) [-1447.002] (-1446.537) * [-1450.878] (-1446.966) (-1447.401) (-1452.952) -- 0:00:48
      260000 -- [-1447.598] (-1446.103) (-1446.271) (-1446.474) * [-1452.754] (-1449.223) (-1447.117) (-1446.827) -- 0:00:48

      Average standard deviation of split frequencies: 0.018185

      260500 -- (-1447.175) [-1446.956] (-1448.879) (-1448.850) * (-1449.404) (-1447.876) (-1446.671) [-1445.685] -- 0:00:48
      261000 -- (-1448.423) (-1446.099) (-1450.269) [-1446.922] * (-1450.653) (-1446.769) [-1448.017] (-1445.674) -- 0:00:48
      261500 -- (-1449.034) [-1449.747] (-1449.290) (-1446.776) * (-1450.128) (-1446.461) (-1448.259) [-1446.634] -- 0:00:48
      262000 -- (-1450.488) (-1448.246) (-1449.450) [-1448.967] * [-1447.324] (-1446.920) (-1446.183) (-1448.287) -- 0:00:47
      262500 -- (-1446.802) (-1447.595) [-1450.850] (-1447.922) * (-1451.424) (-1446.359) (-1447.532) [-1448.392] -- 0:00:47
      263000 -- [-1446.505] (-1446.746) (-1447.116) (-1449.115) * (-1450.814) [-1448.430] (-1447.708) (-1446.067) -- 0:00:47
      263500 -- [-1446.747] (-1447.149) (-1445.836) (-1446.279) * (-1449.357) (-1446.357) (-1449.008) [-1446.020] -- 0:00:47
      264000 -- (-1446.088) (-1448.949) (-1446.641) [-1451.366] * (-1448.297) [-1445.575] (-1447.596) (-1454.031) -- 0:00:47
      264500 -- (-1447.396) (-1445.939) [-1447.999] (-1447.141) * (-1452.781) (-1448.687) [-1447.821] (-1447.107) -- 0:00:47
      265000 -- (-1448.223) [-1446.779] (-1450.839) (-1447.215) * [-1445.965] (-1446.712) (-1448.216) (-1446.413) -- 0:00:47

      Average standard deviation of split frequencies: 0.017256

      265500 -- [-1446.020] (-1449.029) (-1448.564) (-1445.306) * (-1446.290) (-1446.710) (-1446.383) [-1445.632] -- 0:00:47
      266000 -- [-1447.618] (-1447.852) (-1451.095) (-1448.582) * (-1447.193) (-1445.190) (-1448.061) [-1445.674] -- 0:00:46
      266500 -- (-1448.580) (-1449.343) (-1448.492) [-1447.313] * (-1447.063) (-1447.798) (-1446.104) [-1445.518] -- 0:00:46
      267000 -- (-1448.070) [-1450.083] (-1448.081) (-1446.260) * (-1448.795) (-1445.827) [-1445.295] (-1445.322) -- 0:00:46
      267500 -- [-1445.959] (-1447.020) (-1450.547) (-1447.064) * (-1446.947) (-1446.692) (-1449.672) [-1445.736] -- 0:00:46
      268000 -- (-1446.896) (-1449.525) [-1447.116] (-1450.624) * (-1451.622) (-1447.375) (-1447.775) [-1446.974] -- 0:00:46
      268500 -- [-1450.484] (-1447.111) (-1451.037) (-1449.013) * (-1445.653) (-1448.935) (-1449.044) [-1446.831] -- 0:00:46
      269000 -- (-1446.569) (-1446.997) (-1448.521) [-1445.919] * [-1445.303] (-1447.551) (-1449.909) (-1445.429) -- 0:00:46
      269500 -- [-1448.685] (-1449.857) (-1448.316) (-1448.406) * [-1447.077] (-1445.268) (-1449.797) (-1446.442) -- 0:00:46
      270000 -- (-1447.768) (-1448.143) [-1448.066] (-1446.700) * (-1446.567) (-1445.637) [-1447.117] (-1446.574) -- 0:00:45

      Average standard deviation of split frequencies: 0.017900

      270500 -- (-1447.528) [-1448.454] (-1448.135) (-1448.712) * [-1446.473] (-1454.328) (-1449.516) (-1446.575) -- 0:00:45
      271000 -- (-1447.179) [-1447.233] (-1447.545) (-1448.712) * [-1445.927] (-1445.891) (-1449.814) (-1446.522) -- 0:00:45
      271500 -- (-1449.993) [-1447.243] (-1447.741) (-1447.675) * (-1445.319) [-1447.179] (-1449.380) (-1450.181) -- 0:00:45
      272000 -- (-1446.798) (-1447.706) [-1449.694] (-1448.230) * [-1448.795] (-1446.312) (-1449.575) (-1448.180) -- 0:00:45
      272500 -- (-1447.408) (-1447.474) [-1446.704] (-1450.771) * (-1446.563) (-1449.163) [-1445.965] (-1445.786) -- 0:00:45
      273000 -- (-1446.988) (-1447.913) [-1452.993] (-1450.819) * [-1448.000] (-1447.140) (-1447.278) (-1445.826) -- 0:00:45
      273500 -- [-1447.663] (-1446.573) (-1450.188) (-1445.316) * [-1448.054] (-1446.823) (-1447.288) (-1445.886) -- 0:00:45
      274000 -- (-1447.977) [-1445.441] (-1447.345) (-1446.253) * [-1452.546] (-1447.628) (-1449.406) (-1445.944) -- 0:00:47
      274500 -- (-1454.568) [-1445.982] (-1445.457) (-1447.909) * (-1446.863) (-1447.826) [-1449.379] (-1447.153) -- 0:00:47
      275000 -- (-1445.098) (-1447.683) [-1446.427] (-1445.080) * (-1446.508) [-1447.148] (-1447.357) (-1450.395) -- 0:00:47

      Average standard deviation of split frequencies: 0.017482

      275500 -- (-1446.990) [-1447.203] (-1446.598) (-1448.167) * (-1449.178) (-1449.886) [-1447.742] (-1446.152) -- 0:00:47
      276000 -- (-1449.625) (-1448.268) (-1446.542) [-1446.345] * [-1455.278] (-1445.988) (-1449.450) (-1445.823) -- 0:00:47
      276500 -- (-1451.090) (-1449.023) (-1449.082) [-1449.165] * [-1450.720] (-1448.199) (-1449.141) (-1447.171) -- 0:00:47
      277000 -- (-1453.828) [-1446.322] (-1445.832) (-1453.600) * [-1447.199] (-1447.637) (-1450.607) (-1448.900) -- 0:00:46
      277500 -- [-1445.653] (-1447.364) (-1448.442) (-1450.078) * (-1447.742) (-1449.425) [-1447.797] (-1446.370) -- 0:00:46
      278000 -- (-1451.726) (-1446.502) [-1449.467] (-1449.201) * (-1446.479) [-1447.298] (-1448.502) (-1447.692) -- 0:00:46
      278500 -- (-1446.300) [-1449.224] (-1450.208) (-1448.805) * (-1447.156) (-1449.595) [-1447.618] (-1446.197) -- 0:00:46
      279000 -- (-1449.595) (-1451.292) [-1449.041] (-1450.028) * [-1447.359] (-1453.767) (-1446.866) (-1445.506) -- 0:00:46
      279500 -- [-1445.245] (-1451.122) (-1447.373) (-1447.714) * (-1447.920) (-1451.631) (-1448.592) [-1445.710] -- 0:00:46
      280000 -- (-1448.280) [-1448.764] (-1446.301) (-1449.898) * (-1448.654) (-1450.887) (-1446.424) [-1445.173] -- 0:00:46

      Average standard deviation of split frequencies: 0.017636

      280500 -- (-1446.983) (-1448.012) (-1448.869) [-1450.825] * (-1448.797) (-1447.260) (-1449.425) [-1445.145] -- 0:00:46
      281000 -- (-1448.591) (-1446.243) (-1449.090) [-1448.218] * (-1446.726) (-1449.758) (-1447.992) [-1446.087] -- 0:00:46
      281500 -- (-1448.398) [-1445.932] (-1446.710) (-1447.251) * (-1447.147) [-1448.536] (-1448.811) (-1446.767) -- 0:00:45
      282000 -- (-1452.365) (-1453.253) (-1450.953) [-1446.537] * (-1450.398) [-1445.871] (-1448.785) (-1448.996) -- 0:00:45
      282500 -- (-1447.084) (-1447.776) [-1452.964] (-1445.651) * (-1446.915) (-1445.621) (-1447.573) [-1445.866] -- 0:00:45
      283000 -- [-1447.526] (-1448.481) (-1448.986) (-1449.083) * (-1447.456) [-1445.830] (-1451.364) (-1446.411) -- 0:00:45
      283500 -- [-1447.360] (-1446.301) (-1449.243) (-1447.509) * (-1446.502) (-1448.607) [-1447.216] (-1445.622) -- 0:00:45
      284000 -- (-1450.003) (-1445.917) (-1449.002) [-1446.235] * (-1449.172) (-1447.142) [-1446.552] (-1446.108) -- 0:00:45
      284500 -- [-1445.626] (-1447.323) (-1448.777) (-1446.031) * (-1446.848) (-1446.613) (-1445.245) [-1446.336] -- 0:00:45
      285000 -- (-1445.672) (-1448.543) (-1447.550) [-1446.118] * (-1446.207) [-1447.145] (-1445.946) (-1447.164) -- 0:00:45

      Average standard deviation of split frequencies: 0.016941

      285500 -- (-1447.175) (-1448.873) [-1448.848] (-1446.378) * (-1446.425) (-1445.477) (-1447.140) [-1447.516] -- 0:00:45
      286000 -- (-1447.032) (-1446.522) (-1452.972) [-1447.141] * (-1446.916) (-1446.901) (-1450.304) [-1448.978] -- 0:00:44
      286500 -- [-1446.786] (-1450.287) (-1446.536) (-1445.788) * [-1447.328] (-1448.257) (-1449.948) (-1446.361) -- 0:00:44
      287000 -- (-1447.415) [-1446.627] (-1450.029) (-1446.104) * (-1446.552) [-1446.387] (-1448.331) (-1449.228) -- 0:00:44
      287500 -- (-1447.808) [-1446.737] (-1453.801) (-1447.018) * (-1448.799) [-1445.730] (-1451.884) (-1449.099) -- 0:00:44
      288000 -- (-1447.689) (-1446.112) (-1450.930) [-1448.231] * (-1449.367) (-1445.729) (-1448.870) [-1448.440] -- 0:00:44
      288500 -- (-1446.992) (-1446.269) (-1450.208) [-1448.427] * (-1447.431) [-1447.928] (-1447.281) (-1446.254) -- 0:00:44
      289000 -- (-1448.255) (-1446.523) [-1447.488] (-1449.674) * (-1448.544) [-1450.607] (-1447.813) (-1447.866) -- 0:00:44
      289500 -- [-1445.770] (-1447.044) (-1449.398) (-1447.142) * [-1449.169] (-1446.332) (-1448.295) (-1455.007) -- 0:00:44
      290000 -- (-1445.622) [-1447.162] (-1449.106) (-1448.361) * (-1450.430) [-1447.548] (-1447.052) (-1451.004) -- 0:00:44

      Average standard deviation of split frequencies: 0.015073

      290500 -- (-1446.441) (-1448.569) (-1449.228) [-1446.554] * [-1448.249] (-1448.721) (-1445.989) (-1448.324) -- 0:00:46
      291000 -- (-1452.215) (-1449.783) (-1449.032) [-1446.118] * (-1447.559) (-1448.441) (-1445.743) [-1447.096] -- 0:00:46
      291500 -- (-1447.606) (-1459.208) [-1447.606] (-1446.396) * (-1448.968) (-1450.085) (-1448.263) [-1449.341] -- 0:00:46
      292000 -- (-1449.604) (-1455.419) (-1445.485) [-1451.449] * [-1447.502] (-1447.315) (-1449.051) (-1451.647) -- 0:00:46
      292500 -- (-1448.595) (-1451.073) (-1446.148) [-1446.121] * (-1446.461) (-1446.815) (-1450.676) [-1447.122] -- 0:00:45
      293000 -- (-1446.792) (-1451.632) [-1446.036] (-1446.842) * [-1445.951] (-1449.539) (-1447.807) (-1446.163) -- 0:00:45
      293500 -- (-1448.618) [-1449.377] (-1447.551) (-1447.446) * (-1446.605) (-1450.758) [-1450.135] (-1446.517) -- 0:00:45
      294000 -- (-1446.253) (-1449.753) [-1446.451] (-1447.116) * [-1445.713] (-1446.976) (-1449.939) (-1447.244) -- 0:00:45
      294500 -- (-1447.307) (-1447.000) (-1447.170) [-1447.134] * (-1445.841) (-1447.233) (-1450.077) [-1446.483] -- 0:00:45
      295000 -- (-1445.567) (-1446.994) [-1445.857] (-1448.340) * (-1449.347) [-1446.615] (-1451.066) (-1447.582) -- 0:00:45

      Average standard deviation of split frequencies: 0.014521

      295500 -- [-1445.454] (-1448.582) (-1447.984) (-1448.345) * (-1445.353) [-1446.157] (-1448.953) (-1449.832) -- 0:00:45
      296000 -- (-1446.736) [-1446.792] (-1447.698) (-1448.620) * (-1449.418) [-1445.700] (-1448.159) (-1448.360) -- 0:00:45
      296500 -- (-1447.723) (-1447.543) (-1447.834) [-1445.939] * (-1447.298) [-1445.537] (-1450.208) (-1446.707) -- 0:00:45
      297000 -- (-1446.048) (-1446.743) (-1448.230) [-1445.632] * [-1445.843] (-1447.816) (-1449.568) (-1448.313) -- 0:00:44
      297500 -- (-1447.211) (-1446.001) [-1448.110] (-1446.592) * (-1446.538) (-1447.055) [-1447.518] (-1449.810) -- 0:00:44
      298000 -- (-1445.645) (-1445.933) (-1446.580) [-1448.493] * [-1446.224] (-1447.259) (-1447.475) (-1448.893) -- 0:00:44
      298500 -- (-1446.174) (-1447.867) (-1447.505) [-1447.418] * (-1448.138) (-1448.512) (-1448.872) [-1447.361] -- 0:00:44
      299000 -- (-1447.301) (-1447.538) (-1448.560) [-1448.808] * [-1447.685] (-1447.868) (-1448.279) (-1448.904) -- 0:00:44
      299500 -- (-1449.810) (-1446.975) (-1446.090) [-1446.596] * (-1446.595) (-1448.742) [-1447.711] (-1447.585) -- 0:00:44
      300000 -- [-1450.984] (-1447.316) (-1451.535) (-1445.919) * (-1445.926) (-1446.932) (-1449.588) [-1447.912] -- 0:00:44

      Average standard deviation of split frequencies: 0.014203

      300500 -- (-1448.560) [-1447.800] (-1446.942) (-1445.917) * [-1445.845] (-1447.519) (-1448.728) (-1452.016) -- 0:00:44
      301000 -- (-1448.515) (-1446.424) [-1445.998] (-1450.073) * [-1445.911] (-1448.878) (-1449.378) (-1447.666) -- 0:00:44
      301500 -- [-1445.416] (-1446.942) (-1446.168) (-1446.835) * (-1447.415) [-1447.559] (-1447.267) (-1448.817) -- 0:00:44
      302000 -- (-1445.353) (-1448.557) (-1446.363) [-1447.324] * (-1446.602) (-1448.611) [-1454.088] (-1448.033) -- 0:00:43
      302500 -- (-1446.733) (-1446.519) [-1450.895] (-1451.220) * (-1445.625) (-1447.573) (-1450.223) [-1450.516] -- 0:00:43
      303000 -- (-1446.733) (-1453.383) [-1448.724] (-1446.930) * [-1446.121] (-1447.414) (-1447.756) (-1449.262) -- 0:00:43
      303500 -- (-1446.999) (-1451.113) [-1446.875] (-1448.615) * [-1446.618] (-1448.018) (-1447.579) (-1446.785) -- 0:00:43
      304000 -- [-1446.133] (-1451.220) (-1446.110) (-1448.149) * (-1447.992) (-1446.619) (-1446.926) [-1446.156] -- 0:00:43
      304500 -- (-1448.903) (-1448.217) [-1446.067] (-1450.011) * (-1449.597) (-1448.395) [-1447.526] (-1446.836) -- 0:00:43
      305000 -- [-1447.888] (-1446.877) (-1446.132) (-1448.373) * (-1449.638) (-1446.579) [-1446.780] (-1446.161) -- 0:00:43

      Average standard deviation of split frequencies: 0.013593

      305500 -- (-1446.914) (-1446.021) (-1446.700) [-1447.794] * [-1447.523] (-1447.004) (-1446.910) (-1447.265) -- 0:00:43
      306000 -- (-1446.013) (-1446.742) (-1449.806) [-1448.515] * (-1447.286) (-1450.818) (-1452.992) [-1448.471] -- 0:00:45
      306500 -- [-1449.535] (-1447.043) (-1447.507) (-1447.539) * (-1448.620) (-1448.316) (-1445.630) [-1448.425] -- 0:00:45
      307000 -- (-1448.733) (-1446.788) (-1450.038) [-1447.521] * (-1447.294) (-1447.305) [-1450.443] (-1447.461) -- 0:00:45
      307500 -- (-1447.568) (-1447.471) (-1450.694) [-1448.393] * [-1447.324] (-1447.642) (-1452.109) (-1450.242) -- 0:00:45
      308000 -- (-1446.061) [-1447.806] (-1447.578) (-1445.210) * (-1446.862) (-1450.481) (-1450.017) [-1445.285] -- 0:00:44
      308500 -- (-1448.989) (-1446.817) (-1445.985) [-1447.705] * (-1445.633) (-1446.006) [-1449.513] (-1446.691) -- 0:00:44
      309000 -- [-1449.435] (-1448.339) (-1446.661) (-1446.278) * (-1445.842) (-1446.004) [-1448.255] (-1450.084) -- 0:00:44
      309500 -- (-1446.205) (-1449.889) [-1446.067] (-1453.014) * [-1445.988] (-1447.552) (-1446.924) (-1446.510) -- 0:00:44
      310000 -- (-1448.437) (-1449.473) [-1445.775] (-1448.096) * (-1447.675) (-1448.343) (-1448.305) [-1446.375] -- 0:00:44

      Average standard deviation of split frequencies: 0.012729

      310500 -- (-1448.863) (-1448.696) [-1445.523] (-1448.964) * (-1451.772) [-1445.296] (-1448.082) (-1450.089) -- 0:00:44
      311000 -- (-1447.041) (-1448.655) [-1445.812] (-1447.745) * (-1449.169) [-1446.495] (-1451.150) (-1445.651) -- 0:00:44
      311500 -- (-1449.089) (-1447.749) [-1450.942] (-1446.858) * (-1446.305) [-1447.309] (-1447.828) (-1445.330) -- 0:00:44
      312000 -- (-1446.519) (-1447.522) (-1447.732) [-1446.104] * [-1446.379] (-1446.762) (-1445.803) (-1445.927) -- 0:00:44
      312500 -- [-1447.400] (-1446.212) (-1447.361) (-1445.598) * (-1447.568) [-1448.824] (-1448.227) (-1447.070) -- 0:00:44
      313000 -- (-1447.688) (-1447.794) [-1445.940] (-1446.655) * (-1445.764) [-1452.629] (-1448.725) (-1445.741) -- 0:00:43
      313500 -- (-1446.610) (-1450.463) (-1448.728) [-1446.480] * [-1445.579] (-1446.518) (-1446.632) (-1445.550) -- 0:00:43
      314000 -- (-1446.680) (-1448.064) [-1447.077] (-1445.927) * (-1445.709) (-1446.695) (-1446.736) [-1446.337] -- 0:00:43
      314500 -- [-1450.354] (-1447.367) (-1447.047) (-1447.945) * [-1445.821] (-1447.335) (-1448.533) (-1445.512) -- 0:00:43
      315000 -- (-1449.273) (-1446.885) (-1447.153) [-1447.702] * [-1445.487] (-1448.066) (-1449.222) (-1447.189) -- 0:00:43

      Average standard deviation of split frequencies: 0.012763

      315500 -- (-1447.112) (-1451.994) [-1446.694] (-1446.895) * (-1446.717) [-1447.875] (-1449.011) (-1447.879) -- 0:00:43
      316000 -- (-1446.886) (-1448.425) (-1447.959) [-1446.069] * (-1445.991) [-1446.078] (-1449.721) (-1447.646) -- 0:00:43
      316500 -- [-1447.956] (-1445.856) (-1451.526) (-1446.311) * (-1448.363) [-1446.014] (-1452.553) (-1451.227) -- 0:00:43
      317000 -- (-1446.460) (-1447.795) (-1446.055) [-1446.324] * (-1448.053) (-1446.229) [-1447.025] (-1452.343) -- 0:00:43
      317500 -- (-1448.166) [-1446.174] (-1450.763) (-1446.352) * (-1447.362) [-1446.628] (-1450.508) (-1453.490) -- 0:00:42
      318000 -- [-1448.396] (-1446.506) (-1446.541) (-1445.385) * (-1449.236) [-1446.864] (-1449.646) (-1448.026) -- 0:00:42
      318500 -- (-1447.915) [-1447.974] (-1447.191) (-1448.088) * (-1449.973) (-1447.089) [-1449.397] (-1446.718) -- 0:00:42
      319000 -- (-1447.380) [-1446.908] (-1448.771) (-1447.628) * (-1447.391) (-1448.163) [-1451.815] (-1446.879) -- 0:00:42
      319500 -- (-1447.890) (-1445.731) (-1448.836) [-1447.411] * (-1446.395) (-1450.240) (-1446.918) [-1448.283] -- 0:00:42
      320000 -- (-1446.270) (-1445.533) [-1446.570] (-1448.225) * (-1449.175) [-1450.964] (-1447.918) (-1448.451) -- 0:00:42

      Average standard deviation of split frequencies: 0.013067

      320500 -- (-1449.071) (-1450.535) [-1446.910] (-1447.749) * (-1447.919) (-1448.084) [-1448.055] (-1445.986) -- 0:00:42
      321000 -- (-1449.115) (-1447.312) [-1447.701] (-1448.988) * (-1452.024) [-1446.405] (-1447.092) (-1447.372) -- 0:00:42
      321500 -- (-1445.648) (-1450.328) (-1447.325) [-1449.705] * (-1452.347) (-1446.998) [-1449.423] (-1448.249) -- 0:00:42
      322000 -- [-1446.494] (-1452.354) (-1449.627) (-1447.447) * (-1449.218) (-1445.647) [-1446.960] (-1448.245) -- 0:00:44
      322500 -- (-1445.452) (-1447.261) [-1447.345] (-1446.714) * (-1447.022) [-1445.620] (-1446.019) (-1449.606) -- 0:00:44
      323000 -- (-1447.781) [-1446.026] (-1448.857) (-1446.276) * [-1448.962] (-1447.052) (-1446.581) (-1447.272) -- 0:00:44
      323500 -- (-1448.485) (-1447.559) [-1447.993] (-1446.153) * [-1449.819] (-1446.483) (-1446.991) (-1445.891) -- 0:00:43
      324000 -- [-1447.468] (-1449.363) (-1448.722) (-1448.660) * (-1447.085) (-1446.555) (-1450.098) [-1451.241] -- 0:00:43
      324500 -- [-1446.924] (-1454.806) (-1447.235) (-1448.179) * (-1448.299) [-1446.744] (-1449.621) (-1453.787) -- 0:00:43
      325000 -- (-1446.495) (-1451.606) (-1446.493) [-1447.233] * [-1447.498] (-1446.271) (-1448.549) (-1445.518) -- 0:00:43

      Average standard deviation of split frequencies: 0.014232

      325500 -- [-1446.488] (-1455.407) (-1450.568) (-1451.225) * (-1449.486) (-1449.345) [-1446.278] (-1446.335) -- 0:00:43
      326000 -- [-1445.196] (-1447.902) (-1447.042) (-1446.468) * (-1446.496) (-1448.953) (-1446.253) [-1446.018] -- 0:00:43
      326500 -- [-1445.548] (-1446.429) (-1447.225) (-1446.054) * (-1445.826) (-1449.692) [-1446.574] (-1448.812) -- 0:00:43
      327000 -- [-1445.902] (-1447.340) (-1449.353) (-1446.796) * (-1445.789) [-1450.222] (-1447.837) (-1447.878) -- 0:00:43
      327500 -- (-1445.858) (-1449.545) [-1450.754] (-1446.968) * (-1453.826) [-1445.726] (-1447.753) (-1447.974) -- 0:00:43
      328000 -- (-1449.657) (-1446.303) (-1447.441) [-1450.539] * [-1446.247] (-1447.632) (-1447.168) (-1448.073) -- 0:00:43
      328500 -- (-1445.469) (-1446.701) (-1447.716) [-1446.907] * (-1446.531) (-1448.312) [-1450.826] (-1448.585) -- 0:00:42
      329000 -- (-1446.382) [-1446.373] (-1445.131) (-1449.874) * (-1446.073) (-1447.372) [-1447.907] (-1451.042) -- 0:00:42
      329500 -- (-1448.675) (-1447.428) (-1446.799) [-1447.690] * (-1446.231) [-1446.639] (-1448.617) (-1447.765) -- 0:00:42
      330000 -- (-1451.648) [-1447.140] (-1450.232) (-1453.488) * (-1448.353) [-1446.981] (-1448.861) (-1448.512) -- 0:00:42

      Average standard deviation of split frequencies: 0.013656

      330500 -- (-1453.629) (-1449.236) (-1448.443) [-1450.444] * (-1446.770) (-1450.341) [-1447.600] (-1446.248) -- 0:00:42
      331000 -- (-1450.837) (-1447.412) [-1447.357] (-1448.996) * (-1445.670) (-1446.096) (-1446.005) [-1446.951] -- 0:00:42
      331500 -- [-1447.951] (-1447.438) (-1445.911) (-1448.490) * [-1447.669] (-1447.977) (-1452.073) (-1445.317) -- 0:00:42
      332000 -- (-1451.347) (-1451.287) [-1446.936] (-1445.910) * (-1446.445) (-1448.000) (-1452.726) [-1447.954] -- 0:00:42
      332500 -- (-1446.966) (-1447.951) (-1447.017) [-1445.364] * (-1445.842) (-1448.062) [-1448.723] (-1446.649) -- 0:00:42
      333000 -- [-1447.640] (-1448.053) (-1446.283) (-1448.983) * (-1446.328) (-1446.904) (-1448.476) [-1447.266] -- 0:00:42
      333500 -- (-1451.190) [-1449.521] (-1448.516) (-1447.230) * (-1445.439) (-1447.597) (-1448.346) [-1447.444] -- 0:00:41
      334000 -- [-1448.246] (-1447.689) (-1451.629) (-1446.776) * (-1445.593) [-1447.143] (-1449.470) (-1447.413) -- 0:00:41
      334500 -- (-1449.203) (-1448.814) (-1449.622) [-1446.776] * (-1446.602) [-1447.598] (-1446.788) (-1448.204) -- 0:00:41
      335000 -- (-1447.880) (-1450.813) (-1448.552) [-1446.817] * (-1446.969) (-1449.441) [-1445.452] (-1448.000) -- 0:00:41

      Average standard deviation of split frequencies: 0.013439

      335500 -- (-1448.015) [-1448.295] (-1449.812) (-1446.799) * (-1453.153) [-1446.902] (-1445.255) (-1446.974) -- 0:00:41
      336000 -- (-1446.418) (-1448.440) [-1447.879] (-1446.799) * (-1447.345) [-1447.129] (-1446.294) (-1450.368) -- 0:00:41
      336500 -- (-1445.950) (-1448.906) (-1446.702) [-1447.233] * [-1449.560] (-1446.335) (-1445.912) (-1446.117) -- 0:00:41
      337000 -- (-1445.744) (-1447.915) (-1449.485) [-1447.115] * [-1445.620] (-1445.581) (-1446.687) (-1447.076) -- 0:00:41
      337500 -- (-1448.279) (-1451.008) [-1449.455] (-1446.116) * [-1445.660] (-1448.714) (-1446.225) (-1450.492) -- 0:00:41
      338000 -- (-1448.907) (-1455.233) (-1447.025) [-1445.824] * (-1449.821) [-1445.234] (-1445.531) (-1450.418) -- 0:00:43
      338500 -- [-1447.402] (-1446.428) (-1451.395) (-1446.383) * (-1447.798) (-1445.211) [-1447.162] (-1448.633) -- 0:00:42
      339000 -- [-1447.983] (-1450.532) (-1447.274) (-1450.669) * (-1447.265) (-1446.209) (-1454.614) [-1448.173] -- 0:00:42
      339500 -- (-1445.515) (-1447.674) (-1450.981) [-1447.175] * [-1446.599] (-1449.177) (-1450.036) (-1448.168) -- 0:00:42
      340000 -- (-1446.612) [-1446.202] (-1447.170) (-1445.799) * (-1446.324) (-1449.253) [-1446.270] (-1448.182) -- 0:00:42

      Average standard deviation of split frequencies: 0.012838

      340500 -- (-1447.086) (-1448.825) [-1446.314] (-1446.677) * [-1447.257] (-1448.750) (-1448.402) (-1448.484) -- 0:00:42
      341000 -- (-1445.607) (-1450.320) [-1446.847] (-1445.718) * (-1446.207) [-1446.896] (-1450.241) (-1447.835) -- 0:00:42
      341500 -- [-1445.061] (-1448.822) (-1447.593) (-1450.356) * [-1451.255] (-1448.818) (-1448.556) (-1447.693) -- 0:00:42
      342000 -- [-1445.640] (-1448.523) (-1449.430) (-1447.563) * (-1448.274) (-1447.909) [-1447.108] (-1446.158) -- 0:00:42
      342500 -- [-1446.875] (-1445.604) (-1450.138) (-1446.897) * (-1448.278) [-1449.072] (-1450.048) (-1446.973) -- 0:00:42
      343000 -- [-1446.796] (-1445.397) (-1445.997) (-1446.674) * (-1452.174) [-1446.414] (-1450.569) (-1446.706) -- 0:00:42
      343500 -- (-1448.261) (-1445.730) [-1445.623] (-1447.125) * (-1446.788) (-1446.054) (-1450.005) [-1447.076] -- 0:00:42
      344000 -- (-1446.545) (-1446.998) [-1447.286] (-1447.211) * [-1447.907] (-1448.963) (-1449.365) (-1445.578) -- 0:00:41
      344500 -- (-1446.921) (-1447.635) (-1446.269) [-1446.133] * (-1448.283) [-1445.548] (-1449.586) (-1447.308) -- 0:00:41
      345000 -- [-1447.809] (-1446.848) (-1448.523) (-1449.984) * (-1449.308) [-1445.168] (-1448.657) (-1446.242) -- 0:00:41

      Average standard deviation of split frequencies: 0.012836

      345500 -- (-1447.964) [-1448.954] (-1448.754) (-1446.816) * [-1445.811] (-1446.788) (-1458.641) (-1446.317) -- 0:00:41
      346000 -- [-1450.033] (-1445.767) (-1447.306) (-1447.952) * (-1445.453) [-1445.591] (-1450.025) (-1446.484) -- 0:00:41
      346500 -- [-1447.843] (-1446.006) (-1447.477) (-1449.717) * (-1447.364) [-1448.423] (-1448.715) (-1446.506) -- 0:00:41
      347000 -- (-1450.958) (-1446.437) [-1446.269] (-1447.809) * (-1445.541) (-1452.072) (-1447.903) [-1447.746] -- 0:00:41
      347500 -- (-1447.395) (-1447.142) (-1448.210) [-1446.506] * (-1448.450) (-1452.738) [-1448.180] (-1447.481) -- 0:00:41
      348000 -- (-1447.143) (-1454.013) (-1447.983) [-1445.602] * (-1446.529) [-1449.688] (-1448.143) (-1450.382) -- 0:00:41
      348500 -- (-1448.460) (-1446.581) [-1446.196] (-1447.063) * (-1446.417) (-1447.658) (-1446.771) [-1448.838] -- 0:00:41
      349000 -- [-1447.331] (-1445.900) (-1447.645) (-1447.084) * (-1447.386) (-1449.484) [-1447.539] (-1450.321) -- 0:00:41
      349500 -- [-1447.938] (-1445.760) (-1446.994) (-1446.043) * (-1448.380) (-1448.763) [-1448.082] (-1450.187) -- 0:00:40
      350000 -- (-1446.628) [-1446.774] (-1453.227) (-1451.784) * [-1447.323] (-1447.197) (-1449.844) (-1450.413) -- 0:00:40

      Average standard deviation of split frequencies: 0.013219

      350500 -- [-1446.801] (-1448.310) (-1448.010) (-1446.936) * (-1447.458) (-1446.855) (-1449.926) [-1449.006] -- 0:00:40
      351000 -- [-1448.129] (-1447.922) (-1451.673) (-1451.690) * [-1445.988] (-1447.139) (-1447.942) (-1452.228) -- 0:00:40
      351500 -- [-1446.738] (-1448.824) (-1448.934) (-1452.366) * [-1448.981] (-1447.139) (-1446.579) (-1448.308) -- 0:00:40
      352000 -- (-1446.258) [-1448.762] (-1449.476) (-1448.583) * (-1450.645) (-1447.304) [-1448.589] (-1448.425) -- 0:00:40
      352500 -- (-1445.221) (-1446.356) [-1446.442] (-1448.648) * [-1449.742] (-1447.451) (-1447.514) (-1449.207) -- 0:00:40
      353000 -- [-1445.920] (-1446.843) (-1447.346) (-1446.781) * (-1453.311) [-1446.225] (-1449.892) (-1447.030) -- 0:00:40
      353500 -- [-1446.362] (-1452.096) (-1449.145) (-1447.982) * (-1450.589) (-1445.828) [-1446.254] (-1447.704) -- 0:00:40
      354000 -- (-1448.282) (-1450.474) [-1450.193] (-1446.212) * [-1447.913] (-1446.354) (-1447.482) (-1449.581) -- 0:00:41
      354500 -- (-1448.675) (-1447.321) [-1446.893] (-1446.932) * (-1446.837) (-1447.111) [-1448.267] (-1451.405) -- 0:00:41
      355000 -- (-1450.404) (-1447.982) [-1445.474] (-1446.218) * (-1446.072) [-1448.343] (-1447.310) (-1448.466) -- 0:00:41

      Average standard deviation of split frequencies: 0.012545

      355500 -- (-1446.625) [-1447.087] (-1447.658) (-1448.393) * [-1447.865] (-1446.536) (-1448.627) (-1446.645) -- 0:00:41
      356000 -- (-1447.425) (-1446.287) [-1447.792] (-1448.578) * [-1447.725] (-1446.798) (-1446.708) (-1448.447) -- 0:00:41
      356500 -- (-1446.938) (-1445.748) (-1448.611) [-1447.902] * [-1446.492] (-1446.976) (-1446.487) (-1449.478) -- 0:00:41
      357000 -- (-1449.676) [-1449.368] (-1446.068) (-1452.065) * [-1445.627] (-1446.322) (-1446.236) (-1446.884) -- 0:00:41
      357500 -- (-1448.546) (-1446.467) [-1446.106] (-1450.229) * (-1446.250) [-1447.935] (-1445.751) (-1447.714) -- 0:00:41
      358000 -- [-1447.986] (-1449.068) (-1447.774) (-1447.131) * [-1446.227] (-1447.567) (-1445.707) (-1447.322) -- 0:00:41
      358500 -- (-1447.735) (-1450.230) [-1446.255] (-1447.901) * [-1445.949] (-1447.143) (-1448.008) (-1448.065) -- 0:00:41
      359000 -- (-1446.520) (-1450.529) [-1446.966] (-1448.517) * [-1446.657] (-1449.923) (-1445.947) (-1446.852) -- 0:00:41
      359500 -- (-1445.721) (-1455.220) [-1446.672] (-1446.326) * (-1448.915) (-1451.873) [-1445.589] (-1447.988) -- 0:00:40
      360000 -- (-1445.721) [-1457.967] (-1447.485) (-1453.332) * (-1450.621) [-1450.542] (-1449.674) (-1447.385) -- 0:00:40

      Average standard deviation of split frequencies: 0.013651

      360500 -- (-1447.437) (-1464.454) (-1447.222) [-1451.224] * [-1454.843] (-1449.124) (-1447.228) (-1447.930) -- 0:00:40
      361000 -- (-1451.111) (-1462.045) (-1451.553) [-1447.100] * (-1454.213) (-1448.969) [-1448.070] (-1449.609) -- 0:00:40
      361500 -- [-1447.183] (-1447.495) (-1452.243) (-1450.491) * (-1449.748) (-1448.908) [-1447.817] (-1447.516) -- 0:00:40
      362000 -- (-1452.313) [-1446.048] (-1450.430) (-1447.761) * (-1447.297) [-1446.497] (-1446.525) (-1448.415) -- 0:00:40
      362500 -- (-1449.334) (-1446.943) (-1448.966) [-1447.764] * (-1446.112) (-1447.693) (-1445.083) [-1448.981] -- 0:00:40
      363000 -- [-1448.746] (-1449.975) (-1449.026) (-1445.143) * [-1446.699] (-1446.507) (-1451.864) (-1446.593) -- 0:00:40
      363500 -- (-1447.748) (-1447.889) (-1445.757) [-1445.148] * [-1446.120] (-1446.277) (-1451.354) (-1447.518) -- 0:00:40
      364000 -- (-1446.893) (-1447.906) (-1445.322) [-1445.430] * [-1446.303] (-1446.153) (-1447.248) (-1448.774) -- 0:00:40
      364500 -- (-1459.656) [-1448.668] (-1447.184) (-1446.495) * [-1446.723] (-1445.960) (-1454.422) (-1449.721) -- 0:00:40
      365000 -- [-1448.040] (-1446.691) (-1446.532) (-1446.627) * (-1447.171) [-1446.080] (-1446.899) (-1446.406) -- 0:00:40

      Average standard deviation of split frequencies: 0.013023

      365500 -- (-1446.468) (-1451.307) (-1447.622) [-1446.234] * [-1449.086] (-1448.471) (-1449.465) (-1447.037) -- 0:00:39
      366000 -- (-1448.409) [-1448.315] (-1447.452) (-1445.949) * (-1449.340) [-1447.857] (-1446.631) (-1445.676) -- 0:00:39
      366500 -- (-1446.223) (-1448.087) (-1446.762) [-1446.995] * (-1451.105) (-1450.609) [-1445.649] (-1445.613) -- 0:00:39
      367000 -- (-1446.921) [-1445.357] (-1454.036) (-1446.550) * [-1446.503] (-1450.074) (-1447.264) (-1446.389) -- 0:00:39
      367500 -- (-1446.592) (-1445.549) (-1446.165) [-1445.387] * [-1447.162] (-1450.576) (-1450.272) (-1446.701) -- 0:00:39
      368000 -- (-1448.660) (-1447.415) [-1445.388] (-1450.516) * [-1446.800] (-1451.640) (-1449.808) (-1446.554) -- 0:00:39
      368500 -- [-1446.534] (-1445.997) (-1445.861) (-1451.053) * (-1448.768) (-1449.897) (-1447.451) [-1450.016] -- 0:00:39
      369000 -- (-1445.420) (-1445.847) [-1446.223] (-1450.607) * (-1447.742) [-1448.945] (-1451.178) (-1447.713) -- 0:00:39
      369500 -- [-1445.310] (-1447.256) (-1446.873) (-1449.463) * (-1447.844) [-1449.675] (-1450.794) (-1445.620) -- 0:00:39
      370000 -- (-1449.249) (-1450.467) [-1448.007] (-1450.149) * (-1449.514) (-1445.900) [-1445.793] (-1446.013) -- 0:00:40

      Average standard deviation of split frequencies: 0.012364

      370500 -- (-1446.217) [-1450.783] (-1448.163) (-1449.458) * [-1446.869] (-1446.641) (-1445.219) (-1446.482) -- 0:00:40
      371000 -- (-1450.966) (-1445.886) [-1446.789] (-1451.656) * [-1446.469] (-1446.057) (-1451.647) (-1448.460) -- 0:00:40
      371500 -- (-1451.779) (-1447.029) [-1445.557] (-1452.804) * (-1446.393) (-1447.333) [-1447.809] (-1448.338) -- 0:00:40
      372000 -- (-1450.034) (-1449.151) [-1445.722] (-1450.562) * (-1446.329) [-1445.664] (-1447.998) (-1446.746) -- 0:00:40
      372500 -- (-1446.122) [-1449.148] (-1447.468) (-1448.334) * [-1449.367] (-1446.217) (-1446.480) (-1446.220) -- 0:00:40
      373000 -- (-1446.054) [-1449.736] (-1451.008) (-1446.162) * [-1449.345] (-1447.632) (-1447.283) (-1446.354) -- 0:00:40
      373500 -- (-1445.643) (-1449.833) [-1446.852] (-1446.216) * (-1446.707) [-1447.581] (-1447.373) (-1445.683) -- 0:00:40
      374000 -- (-1446.370) [-1445.941] (-1448.775) (-1448.635) * (-1445.748) (-1447.874) [-1447.187] (-1445.675) -- 0:00:40
      374500 -- [-1446.892] (-1446.666) (-1447.851) (-1447.170) * [-1447.018] (-1448.788) (-1448.550) (-1445.396) -- 0:00:40
      375000 -- (-1446.937) (-1457.820) [-1447.801] (-1448.832) * [-1446.616] (-1447.577) (-1450.884) (-1447.077) -- 0:00:40

      Average standard deviation of split frequencies: 0.012746

      375500 -- (-1447.760) [-1447.490] (-1450.759) (-1446.013) * [-1447.851] (-1448.938) (-1448.169) (-1446.689) -- 0:00:39
      376000 -- (-1446.484) (-1446.801) (-1445.596) [-1447.062] * (-1448.346) (-1448.248) (-1447.450) [-1448.981] -- 0:00:39
      376500 -- (-1450.375) (-1446.245) (-1446.140) [-1452.366] * (-1448.040) (-1450.422) (-1446.698) [-1447.313] -- 0:00:39
      377000 -- (-1448.904) (-1446.789) (-1445.543) [-1448.968] * [-1446.909] (-1446.186) (-1450.543) (-1447.389) -- 0:00:39
      377500 -- (-1448.764) (-1447.566) [-1447.828] (-1455.242) * (-1448.448) [-1446.397] (-1446.166) (-1449.401) -- 0:00:39
      378000 -- (-1446.008) (-1450.388) [-1449.233] (-1451.358) * (-1445.358) (-1447.806) [-1447.939] (-1449.905) -- 0:00:39
      378500 -- (-1445.551) (-1448.290) (-1448.845) [-1445.695] * (-1447.486) (-1446.254) [-1446.955] (-1450.091) -- 0:00:39
      379000 -- [-1446.092] (-1451.903) (-1448.331) (-1445.758) * [-1449.247] (-1446.387) (-1448.234) (-1450.414) -- 0:00:39
      379500 -- [-1445.811] (-1451.795) (-1446.261) (-1448.336) * (-1449.066) [-1447.728] (-1445.610) (-1448.446) -- 0:00:39
      380000 -- [-1446.419] (-1447.910) (-1445.990) (-1452.416) * (-1447.489) (-1447.916) [-1449.649] (-1446.950) -- 0:00:39

      Average standard deviation of split frequencies: 0.013140

      380500 -- [-1445.774] (-1447.145) (-1445.984) (-1451.278) * (-1449.128) (-1448.963) [-1451.102] (-1447.247) -- 0:00:39
      381000 -- [-1445.761] (-1446.376) (-1447.724) (-1449.040) * (-1450.741) [-1447.999] (-1447.862) (-1448.669) -- 0:00:38
      381500 -- [-1447.565] (-1448.458) (-1449.985) (-1447.833) * (-1451.153) (-1447.000) (-1447.562) [-1447.296] -- 0:00:38
      382000 -- (-1447.526) (-1448.877) [-1447.412] (-1447.820) * (-1453.140) (-1447.203) (-1446.871) [-1447.021] -- 0:00:38
      382500 -- (-1451.910) [-1448.677] (-1448.124) (-1448.015) * [-1448.321] (-1446.281) (-1448.976) (-1449.966) -- 0:00:38
      383000 -- (-1446.857) (-1448.537) (-1446.888) [-1448.507] * (-1447.348) (-1445.981) (-1447.014) [-1453.442] -- 0:00:38
      383500 -- (-1446.332) (-1449.405) (-1446.229) [-1447.284] * (-1447.224) [-1445.484] (-1447.597) (-1451.621) -- 0:00:38
      384000 -- (-1446.183) [-1446.254] (-1446.943) (-1451.470) * (-1448.052) (-1446.163) (-1447.802) [-1449.591] -- 0:00:38
      384500 -- [-1450.214] (-1448.649) (-1448.081) (-1450.906) * (-1447.773) [-1446.506] (-1448.477) (-1448.693) -- 0:00:38
      385000 -- (-1445.892) [-1448.613] (-1450.710) (-1451.436) * [-1447.553] (-1446.104) (-1447.319) (-1445.995) -- 0:00:38

      Average standard deviation of split frequencies: 0.013502

      385500 -- [-1445.774] (-1448.440) (-1447.448) (-1446.643) * [-1448.348] (-1446.183) (-1447.906) (-1446.651) -- 0:00:38
      386000 -- (-1445.304) [-1445.964] (-1446.434) (-1451.988) * (-1446.070) [-1447.719] (-1447.395) (-1446.582) -- 0:00:39
      386500 -- (-1450.199) (-1446.829) [-1447.432] (-1449.586) * (-1448.020) (-1446.833) [-1446.221] (-1446.360) -- 0:00:39
      387000 -- (-1447.212) [-1454.155] (-1447.077) (-1450.283) * (-1445.281) (-1446.727) (-1446.542) [-1445.933] -- 0:00:39
      387500 -- [-1448.276] (-1451.020) (-1449.062) (-1450.094) * (-1445.614) [-1447.653] (-1448.601) (-1447.013) -- 0:00:39
      388000 -- [-1448.017] (-1448.306) (-1450.269) (-1446.482) * (-1446.047) [-1452.488] (-1449.241) (-1448.704) -- 0:00:39
      388500 -- (-1449.046) (-1449.227) [-1445.675] (-1447.596) * [-1447.632] (-1446.203) (-1445.892) (-1448.616) -- 0:00:39
      389000 -- (-1447.192) (-1455.500) [-1445.782] (-1448.755) * (-1445.785) [-1445.413] (-1445.262) (-1446.997) -- 0:00:39
      389500 -- (-1448.904) (-1450.002) [-1448.018] (-1446.522) * (-1447.404) [-1447.039] (-1445.794) (-1447.271) -- 0:00:39
      390000 -- [-1447.212] (-1451.387) (-1445.936) (-1447.398) * [-1447.487] (-1447.116) (-1449.031) (-1447.628) -- 0:00:39

      Average standard deviation of split frequencies: 0.013206

      390500 -- (-1446.737) (-1446.658) (-1446.716) [-1450.882] * (-1447.370) [-1448.499] (-1448.548) (-1447.020) -- 0:00:39
      391000 -- (-1446.940) (-1446.418) [-1450.920] (-1450.775) * (-1446.955) (-1447.020) (-1448.555) [-1446.598] -- 0:00:38
      391500 -- (-1447.788) (-1445.829) (-1446.093) [-1451.529] * [-1447.986] (-1447.049) (-1447.817) (-1446.309) -- 0:00:38
      392000 -- [-1448.207] (-1447.029) (-1446.490) (-1447.209) * [-1445.785] (-1449.785) (-1449.680) (-1446.675) -- 0:00:38
      392500 -- (-1447.243) (-1445.432) (-1446.605) [-1447.403] * (-1445.815) (-1446.871) [-1445.407] (-1446.388) -- 0:00:38
      393000 -- [-1446.521] (-1445.570) (-1448.249) (-1447.769) * [-1445.112] (-1447.515) (-1445.914) (-1447.803) -- 0:00:38
      393500 -- [-1448.587] (-1449.644) (-1448.894) (-1447.981) * (-1445.117) (-1447.170) (-1446.066) [-1448.484] -- 0:00:38
      394000 -- (-1446.561) (-1445.283) (-1446.319) [-1447.289] * [-1449.425] (-1446.570) (-1448.481) (-1446.978) -- 0:00:38
      394500 -- (-1446.531) (-1446.005) (-1447.819) [-1448.368] * (-1447.958) (-1445.590) (-1449.907) [-1445.394] -- 0:00:38
      395000 -- (-1446.457) (-1448.740) (-1448.683) [-1446.739] * (-1448.560) (-1446.529) [-1448.474] (-1445.889) -- 0:00:38

      Average standard deviation of split frequencies: 0.013095

      395500 -- (-1452.347) [-1446.719] (-1450.474) (-1445.532) * (-1448.145) (-1447.968) (-1448.643) [-1446.346] -- 0:00:38
      396000 -- (-1447.499) (-1445.766) (-1448.995) [-1448.045] * [-1455.671] (-1453.038) (-1449.717) (-1447.734) -- 0:00:38
      396500 -- (-1445.968) [-1445.499] (-1447.311) (-1445.878) * (-1450.278) (-1448.779) (-1448.625) [-1446.102] -- 0:00:38
      397000 -- [-1450.205] (-1447.029) (-1448.029) (-1446.556) * (-1454.187) (-1449.077) [-1448.781] (-1446.388) -- 0:00:37
      397500 -- (-1449.246) (-1451.977) [-1446.250] (-1452.288) * (-1447.994) [-1447.209] (-1455.731) (-1448.531) -- 0:00:37
      398000 -- (-1447.537) (-1447.242) (-1446.582) [-1445.843] * (-1447.003) (-1445.891) [-1451.456] (-1449.919) -- 0:00:37
      398500 -- (-1448.599) (-1445.937) [-1446.526] (-1448.986) * (-1451.718) (-1450.594) (-1447.598) [-1448.735] -- 0:00:37
      399000 -- [-1447.573] (-1448.868) (-1447.855) (-1448.619) * (-1451.202) (-1451.752) [-1446.990] (-1449.581) -- 0:00:37
      399500 -- (-1446.469) (-1450.695) [-1448.341] (-1448.850) * (-1447.891) (-1448.728) (-1447.236) [-1450.884] -- 0:00:37
      400000 -- [-1446.805] (-1447.901) (-1448.157) (-1446.561) * (-1448.963) [-1446.216] (-1446.990) (-1446.588) -- 0:00:37

      Average standard deviation of split frequencies: 0.013269

      400500 -- (-1449.150) (-1448.867) [-1449.662] (-1446.466) * (-1446.474) [-1447.662] (-1447.363) (-1445.554) -- 0:00:37
      401000 -- [-1448.659] (-1450.873) (-1448.155) (-1450.987) * (-1446.283) (-1448.335) (-1447.710) [-1445.113] -- 0:00:37
      401500 -- (-1447.455) [-1445.533] (-1449.317) (-1448.177) * (-1448.985) (-1449.135) (-1450.141) [-1446.178] -- 0:00:37
      402000 -- (-1448.821) (-1448.155) [-1447.805] (-1449.046) * [-1445.669] (-1448.338) (-1451.148) (-1445.902) -- 0:00:38
      402500 -- (-1448.857) [-1449.846] (-1447.710) (-1448.927) * (-1445.813) [-1448.952] (-1450.425) (-1446.322) -- 0:00:38
      403000 -- (-1447.121) (-1449.637) [-1448.146] (-1449.784) * (-1446.939) (-1445.868) (-1450.529) [-1445.915] -- 0:00:38
      403500 -- (-1446.455) [-1450.892] (-1452.267) (-1446.760) * (-1447.659) (-1445.072) [-1450.905] (-1449.852) -- 0:00:38
      404000 -- [-1451.537] (-1447.495) (-1449.428) (-1446.334) * (-1446.301) (-1447.179) (-1447.018) [-1446.632] -- 0:00:38
      404500 -- (-1455.734) [-1446.441] (-1449.903) (-1448.274) * (-1448.193) [-1448.086] (-1447.869) (-1448.608) -- 0:00:38
      405000 -- (-1451.545) (-1447.800) (-1450.420) [-1448.556] * (-1449.155) (-1445.901) (-1446.831) [-1447.520] -- 0:00:38

      Average standard deviation of split frequencies: 0.013159

      405500 -- [-1450.257] (-1449.729) (-1448.829) (-1447.459) * (-1449.957) [-1446.097] (-1448.764) (-1447.226) -- 0:00:38
      406000 -- (-1447.239) [-1452.864] (-1448.608) (-1445.107) * (-1449.315) (-1446.253) (-1448.343) [-1445.585] -- 0:00:38
      406500 -- [-1446.047] (-1451.365) (-1453.216) (-1445.460) * [-1445.623] (-1446.429) (-1447.055) (-1445.600) -- 0:00:37
      407000 -- (-1448.485) (-1447.327) (-1455.950) [-1446.197] * [-1447.753] (-1446.702) (-1448.958) (-1448.262) -- 0:00:37
      407500 -- (-1449.311) (-1449.324) (-1459.113) [-1448.084] * (-1450.759) [-1448.851] (-1454.673) (-1446.898) -- 0:00:37
      408000 -- (-1447.835) [-1446.029] (-1449.357) (-1446.817) * [-1449.982] (-1450.728) (-1445.550) (-1447.799) -- 0:00:37
      408500 -- [-1450.546] (-1445.497) (-1446.650) (-1448.723) * (-1448.132) (-1448.286) [-1447.848] (-1446.296) -- 0:00:37
      409000 -- (-1448.664) (-1447.955) [-1447.377] (-1446.988) * (-1449.739) (-1447.368) [-1451.862] (-1446.374) -- 0:00:37
      409500 -- (-1447.226) (-1446.580) (-1445.924) [-1447.117] * (-1446.530) [-1448.206] (-1447.372) (-1446.127) -- 0:00:37
      410000 -- (-1447.469) [-1447.354] (-1445.924) (-1448.482) * (-1447.549) (-1448.366) [-1446.082] (-1445.785) -- 0:00:37

      Average standard deviation of split frequencies: 0.012818

      410500 -- (-1449.605) (-1446.935) [-1445.585] (-1448.126) * (-1450.283) (-1447.298) [-1448.064] (-1449.566) -- 0:00:37
      411000 -- (-1447.461) (-1448.413) (-1448.132) [-1446.130] * (-1448.014) (-1449.570) [-1446.538] (-1448.018) -- 0:00:37
      411500 -- (-1447.614) (-1448.508) (-1447.387) [-1445.391] * [-1447.302] (-1448.318) (-1448.244) (-1447.248) -- 0:00:37
      412000 -- (-1450.842) [-1446.721] (-1447.841) (-1448.303) * [-1445.878] (-1447.623) (-1447.383) (-1447.154) -- 0:00:37
      412500 -- (-1450.521) (-1446.680) [-1448.858] (-1450.829) * [-1450.405] (-1447.442) (-1449.235) (-1446.713) -- 0:00:37
      413000 -- (-1447.458) [-1446.691] (-1452.094) (-1448.932) * (-1448.366) (-1450.240) [-1448.307] (-1448.404) -- 0:00:36
      413500 -- (-1448.607) [-1449.024] (-1446.359) (-1446.891) * (-1450.050) (-1450.370) (-1446.913) [-1448.097] -- 0:00:36
      414000 -- (-1447.525) [-1447.500] (-1447.496) (-1448.412) * (-1451.114) (-1448.753) (-1449.730) [-1448.537] -- 0:00:36
      414500 -- (-1446.665) [-1448.895] (-1445.788) (-1450.913) * [-1447.381] (-1447.072) (-1450.044) (-1446.843) -- 0:00:36
      415000 -- (-1449.794) [-1449.593] (-1451.328) (-1448.946) * [-1448.172] (-1447.029) (-1445.224) (-1446.815) -- 0:00:36

      Average standard deviation of split frequencies: 0.012465

      415500 -- [-1451.627] (-1451.223) (-1447.341) (-1448.585) * (-1447.231) [-1447.370] (-1448.171) (-1448.018) -- 0:00:36
      416000 -- (-1445.900) [-1446.708] (-1448.075) (-1448.694) * (-1447.491) (-1448.620) (-1450.244) [-1445.997] -- 0:00:36
      416500 -- (-1446.481) (-1446.258) [-1451.202] (-1447.979) * (-1450.914) (-1448.869) [-1450.460] (-1446.301) -- 0:00:36
      417000 -- [-1445.603] (-1446.744) (-1453.163) (-1448.518) * (-1446.197) (-1450.445) [-1448.265] (-1446.302) -- 0:00:36
      417500 -- (-1447.136) (-1447.023) (-1448.407) [-1447.899] * [-1446.848] (-1448.233) (-1448.831) (-1447.657) -- 0:00:36
      418000 -- (-1446.989) [-1447.654] (-1447.570) (-1445.953) * (-1446.176) (-1448.229) (-1446.162) [-1446.123] -- 0:00:37
      418500 -- (-1452.688) [-1449.054] (-1451.093) (-1447.894) * (-1446.082) (-1448.136) [-1446.580] (-1445.574) -- 0:00:37
      419000 -- (-1446.962) (-1449.756) [-1445.954] (-1448.720) * (-1446.029) [-1448.345] (-1446.881) (-1445.574) -- 0:00:37
      419500 -- (-1447.454) (-1446.089) (-1448.225) [-1447.543] * (-1445.749) [-1447.399] (-1447.755) (-1447.042) -- 0:00:37
      420000 -- (-1451.285) (-1446.334) (-1447.036) [-1451.209] * (-1445.425) [-1446.728] (-1447.828) (-1446.999) -- 0:00:37

      Average standard deviation of split frequencies: 0.012202

      420500 -- (-1448.234) [-1445.397] (-1448.516) (-1448.353) * (-1445.582) (-1445.973) [-1451.081] (-1448.548) -- 0:00:37
      421000 -- (-1448.234) [-1447.600] (-1445.695) (-1446.192) * (-1446.622) [-1445.807] (-1447.136) (-1445.876) -- 0:00:37
      421500 -- (-1450.433) (-1446.761) (-1446.283) [-1447.532] * (-1450.144) (-1446.068) (-1446.185) [-1446.693] -- 0:00:37
      422000 -- (-1447.628) (-1446.146) (-1447.365) [-1448.527] * (-1453.531) (-1447.707) [-1449.292] (-1446.620) -- 0:00:36
      422500 -- (-1446.271) (-1446.280) (-1448.335) [-1448.466] * [-1447.311] (-1449.152) (-1448.025) (-1448.274) -- 0:00:36
      423000 -- (-1450.791) [-1449.103] (-1447.506) (-1451.919) * (-1448.139) (-1447.552) (-1445.979) [-1446.557] -- 0:00:36
      423500 -- [-1447.088] (-1448.675) (-1445.265) (-1449.860) * (-1448.621) [-1445.292] (-1447.485) (-1446.076) -- 0:00:36
      424000 -- (-1447.069) (-1447.798) (-1445.330) [-1446.959] * (-1450.870) [-1446.779] (-1450.417) (-1446.136) -- 0:00:36
      424500 -- (-1449.600) (-1448.990) [-1446.463] (-1446.910) * [-1449.435] (-1446.383) (-1452.902) (-1448.870) -- 0:00:36
      425000 -- (-1449.867) (-1449.168) (-1446.461) [-1445.608] * [-1446.170] (-1448.872) (-1449.498) (-1450.989) -- 0:00:36

      Average standard deviation of split frequencies: 0.012234

      425500 -- (-1447.095) [-1449.198] (-1447.399) (-1448.710) * [-1448.104] (-1449.658) (-1449.077) (-1446.855) -- 0:00:36
      426000 -- [-1445.552] (-1449.912) (-1447.053) (-1446.681) * [-1447.273] (-1447.181) (-1448.304) (-1449.588) -- 0:00:36
      426500 -- [-1445.183] (-1445.528) (-1448.272) (-1447.900) * (-1446.531) (-1447.237) (-1448.714) [-1448.713] -- 0:00:36
      427000 -- [-1447.584] (-1445.934) (-1447.011) (-1446.232) * (-1445.929) (-1446.201) [-1449.456] (-1451.114) -- 0:00:36
      427500 -- (-1447.250) [-1445.494] (-1446.667) (-1446.404) * [-1447.036] (-1446.208) (-1446.495) (-1446.741) -- 0:00:36
      428000 -- (-1449.624) (-1447.999) (-1447.615) [-1447.207] * [-1448.909] (-1446.282) (-1447.773) (-1446.626) -- 0:00:36
      428500 -- (-1446.665) (-1446.209) (-1451.511) [-1446.723] * (-1447.373) (-1448.063) [-1446.108] (-1452.255) -- 0:00:36
      429000 -- (-1446.523) (-1446.021) [-1450.191] (-1446.276) * (-1446.785) [-1446.663] (-1453.570) (-1446.689) -- 0:00:35
      429500 -- (-1447.380) [-1445.988] (-1446.380) (-1450.355) * [-1447.726] (-1447.765) (-1450.215) (-1450.867) -- 0:00:35
      430000 -- (-1447.181) (-1446.126) (-1446.642) [-1448.056] * (-1446.116) (-1445.684) (-1449.673) [-1450.724] -- 0:00:35

      Average standard deviation of split frequencies: 0.012527

      430500 -- [-1445.771] (-1446.444) (-1446.553) (-1448.133) * (-1447.204) [-1445.495] (-1448.749) (-1446.790) -- 0:00:35
      431000 -- (-1447.964) (-1446.286) [-1446.183] (-1447.317) * (-1446.929) [-1447.709] (-1448.382) (-1448.310) -- 0:00:35
      431500 -- (-1445.748) [-1447.171] (-1446.284) (-1447.580) * (-1446.718) (-1446.967) (-1445.701) [-1446.252] -- 0:00:35
      432000 -- [-1445.879] (-1447.293) (-1447.116) (-1446.858) * (-1446.233) [-1447.565] (-1446.275) (-1447.737) -- 0:00:35
      432500 -- [-1445.762] (-1446.566) (-1447.095) (-1452.276) * (-1449.325) [-1447.602] (-1448.367) (-1445.416) -- 0:00:35
      433000 -- (-1446.477) [-1445.702] (-1448.926) (-1451.213) * (-1446.056) (-1447.501) [-1449.431] (-1445.546) -- 0:00:35
      433500 -- [-1447.698] (-1447.365) (-1448.595) (-1449.992) * (-1447.600) (-1446.480) (-1445.232) [-1446.146] -- 0:00:35
      434000 -- (-1449.103) (-1449.612) (-1445.906) [-1446.656] * (-1448.290) (-1446.246) [-1451.010] (-1446.095) -- 0:00:36
      434500 -- (-1446.683) (-1448.604) (-1446.995) [-1453.691] * (-1448.751) (-1446.923) (-1446.617) [-1446.043] -- 0:00:36
      435000 -- (-1447.274) (-1449.870) (-1447.849) [-1445.423] * [-1447.330] (-1445.758) (-1446.866) (-1449.270) -- 0:00:36

      Average standard deviation of split frequencies: 0.013395

      435500 -- (-1447.827) [-1449.870] (-1449.411) (-1446.123) * [-1447.794] (-1446.709) (-1449.115) (-1447.999) -- 0:00:36
      436000 -- (-1447.227) (-1449.211) (-1446.437) [-1448.853] * (-1447.410) (-1446.517) [-1447.060] (-1448.670) -- 0:00:36
      436500 -- [-1447.456] (-1447.163) (-1448.115) (-1446.819) * [-1447.451] (-1450.985) (-1450.153) (-1450.930) -- 0:00:36
      437000 -- (-1450.196) (-1447.338) (-1450.532) [-1447.242] * (-1451.729) (-1448.434) (-1446.119) [-1448.009] -- 0:00:36
      437500 -- (-1448.480) (-1448.854) (-1454.429) [-1446.394] * (-1451.133) (-1446.705) (-1445.872) [-1447.074] -- 0:00:36
      438000 -- (-1449.033) (-1446.660) (-1451.882) [-1448.394] * (-1451.912) (-1445.908) (-1445.872) [-1448.602] -- 0:00:35
      438500 -- [-1446.230] (-1450.113) (-1450.841) (-1446.454) * [-1446.295] (-1445.941) (-1447.755) (-1450.640) -- 0:00:35
      439000 -- [-1447.825] (-1448.434) (-1447.641) (-1446.479) * (-1451.756) (-1447.078) [-1448.577] (-1448.543) -- 0:00:35
      439500 -- (-1447.825) (-1451.568) (-1447.154) [-1446.187] * [-1449.755] (-1448.434) (-1446.423) (-1449.246) -- 0:00:35
      440000 -- [-1450.913] (-1447.493) (-1448.067) (-1445.654) * (-1445.161) (-1448.882) [-1449.996] (-1450.733) -- 0:00:35

      Average standard deviation of split frequencies: 0.013312

      440500 -- (-1445.826) (-1447.658) (-1451.021) [-1446.191] * [-1447.087] (-1447.617) (-1445.337) (-1450.889) -- 0:00:35
      441000 -- (-1445.824) (-1447.068) (-1449.446) [-1446.959] * [-1447.876] (-1446.113) (-1445.800) (-1446.251) -- 0:00:35
      441500 -- (-1446.053) (-1448.342) (-1450.368) [-1446.070] * (-1449.871) (-1447.638) [-1448.143] (-1447.441) -- 0:00:35
      442000 -- (-1446.327) [-1447.660] (-1447.143) (-1450.423) * [-1449.124] (-1447.433) (-1456.648) (-1451.167) -- 0:00:35
      442500 -- (-1446.392) (-1447.109) (-1447.689) [-1446.696] * [-1448.437] (-1448.442) (-1448.887) (-1448.105) -- 0:00:35
      443000 -- (-1446.089) (-1446.379) (-1448.040) [-1447.180] * (-1446.552) (-1447.576) [-1448.505] (-1446.610) -- 0:00:35
      443500 -- [-1446.055] (-1447.495) (-1447.276) (-1452.252) * [-1448.387] (-1448.520) (-1449.284) (-1446.860) -- 0:00:35
      444000 -- (-1446.104) [-1449.656] (-1447.350) (-1446.793) * (-1446.575) (-1448.520) (-1446.502) [-1447.757] -- 0:00:35
      444500 -- [-1446.078] (-1446.621) (-1448.866) (-1447.415) * (-1447.190) (-1450.876) [-1445.670] (-1447.674) -- 0:00:34
      445000 -- (-1453.289) [-1446.865] (-1447.694) (-1448.487) * (-1447.921) (-1445.504) (-1446.387) [-1450.492] -- 0:00:34

      Average standard deviation of split frequencies: 0.013907

      445500 -- (-1448.384) [-1447.146] (-1447.315) (-1447.421) * [-1448.584] (-1447.992) (-1447.327) (-1448.245) -- 0:00:34
      446000 -- (-1450.531) [-1446.377] (-1446.836) (-1446.998) * (-1448.622) (-1447.265) (-1454.237) [-1453.152] -- 0:00:34
      446500 -- (-1450.046) (-1447.247) [-1448.561] (-1445.843) * [-1451.843] (-1446.576) (-1447.375) (-1448.366) -- 0:00:34
      447000 -- (-1447.161) (-1449.452) [-1449.768] (-1449.699) * (-1453.439) (-1446.518) (-1447.756) [-1448.265] -- 0:00:34
      447500 -- (-1447.014) (-1448.288) (-1446.402) [-1448.239] * (-1447.399) (-1445.656) (-1446.535) [-1445.388] -- 0:00:34
      448000 -- (-1449.033) [-1446.350] (-1445.914) (-1446.285) * (-1451.199) (-1446.046) [-1447.072] (-1446.891) -- 0:00:34
      448500 -- (-1448.957) [-1446.746] (-1446.574) (-1446.823) * (-1445.981) (-1446.579) [-1448.896] (-1447.769) -- 0:00:34
      449000 -- [-1447.906] (-1446.567) (-1446.866) (-1448.536) * (-1446.131) [-1448.630] (-1446.356) (-1446.701) -- 0:00:34
      449500 -- (-1447.411) [-1448.601] (-1450.248) (-1449.962) * (-1446.750) [-1447.505] (-1449.839) (-1447.309) -- 0:00:34
      450000 -- (-1446.677) (-1448.382) [-1448.086] (-1446.875) * (-1446.696) (-1447.182) (-1449.614) [-1446.216] -- 0:00:35

      Average standard deviation of split frequencies: 0.013929

      450500 -- (-1447.423) (-1449.191) [-1448.873] (-1446.420) * (-1446.178) (-1446.212) (-1447.770) [-1447.873] -- 0:00:35
      451000 -- (-1448.562) (-1447.713) (-1445.840) [-1447.641] * (-1445.300) (-1448.212) (-1445.325) [-1446.960] -- 0:00:35
      451500 -- [-1446.629] (-1447.803) (-1447.109) (-1445.646) * (-1447.572) (-1446.449) (-1447.279) [-1449.138] -- 0:00:35
      452000 -- (-1447.407) [-1446.675] (-1446.234) (-1446.188) * (-1446.324) (-1447.801) [-1447.717] (-1452.867) -- 0:00:35
      452500 -- (-1445.937) [-1446.555] (-1446.840) (-1445.620) * (-1445.773) (-1447.397) (-1455.898) [-1447.626] -- 0:00:35
      453000 -- (-1446.583) (-1447.628) (-1448.149) [-1448.106] * (-1449.334) (-1451.406) (-1447.049) [-1448.248] -- 0:00:35
      453500 -- (-1450.255) (-1450.807) [-1447.214] (-1446.570) * (-1449.948) (-1447.857) (-1448.710) [-1447.830] -- 0:00:34
      454000 -- (-1447.959) (-1445.919) (-1446.962) [-1446.800] * (-1448.718) (-1448.799) (-1447.780) [-1445.387] -- 0:00:34
      454500 -- (-1446.285) (-1447.773) [-1446.404] (-1447.643) * (-1450.112) [-1446.406] (-1449.023) (-1445.801) -- 0:00:34
      455000 -- (-1446.815) (-1446.769) (-1447.195) [-1445.906] * (-1447.616) (-1446.693) [-1449.643] (-1449.942) -- 0:00:34

      Average standard deviation of split frequencies: 0.014255

      455500 -- (-1447.085) (-1448.573) [-1449.707] (-1445.837) * (-1452.185) [-1446.563] (-1449.158) (-1447.646) -- 0:00:34
      456000 -- (-1450.719) (-1449.394) [-1445.302] (-1446.426) * (-1448.718) (-1450.916) (-1450.991) [-1448.582] -- 0:00:34
      456500 -- (-1449.120) (-1452.365) [-1448.446] (-1450.656) * (-1447.348) [-1447.983] (-1448.757) (-1446.840) -- 0:00:34
      457000 -- (-1447.356) [-1453.357] (-1446.801) (-1448.459) * (-1445.944) (-1447.521) [-1448.413] (-1446.502) -- 0:00:34
      457500 -- (-1448.309) (-1450.278) (-1450.866) [-1449.096] * (-1447.249) [-1447.380] (-1448.474) (-1446.905) -- 0:00:34
      458000 -- (-1450.385) (-1449.123) [-1447.810] (-1450.275) * [-1446.491] (-1446.277) (-1448.099) (-1446.734) -- 0:00:34
      458500 -- (-1446.240) (-1454.474) [-1448.917] (-1446.802) * (-1447.041) (-1445.577) [-1448.524] (-1449.588) -- 0:00:34
      459000 -- (-1450.226) (-1449.157) [-1447.140] (-1446.367) * (-1446.621) [-1446.712] (-1446.284) (-1446.576) -- 0:00:34
      459500 -- [-1455.765] (-1448.239) (-1450.401) (-1447.412) * (-1448.324) [-1446.629] (-1445.768) (-1448.141) -- 0:00:34
      460000 -- (-1452.314) (-1448.978) (-1449.872) [-1446.677] * (-1449.143) (-1449.349) (-1446.934) [-1450.752] -- 0:00:34

      Average standard deviation of split frequencies: 0.013530

      460500 -- (-1448.109) (-1449.168) (-1448.845) [-1448.749] * [-1447.073] (-1451.927) (-1446.953) (-1449.699) -- 0:00:33
      461000 -- [-1447.054] (-1445.944) (-1448.282) (-1447.496) * (-1447.343) (-1448.295) [-1450.041] (-1448.240) -- 0:00:33
      461500 -- [-1446.421] (-1446.333) (-1450.455) (-1450.525) * [-1446.275] (-1448.535) (-1449.461) (-1451.496) -- 0:00:33
      462000 -- [-1447.761] (-1448.976) (-1447.114) (-1447.755) * (-1449.492) [-1447.983] (-1449.833) (-1450.398) -- 0:00:33
      462500 -- (-1449.823) (-1446.561) (-1447.265) [-1448.456] * (-1449.553) (-1447.591) [-1450.812] (-1449.465) -- 0:00:33
      463000 -- (-1449.335) (-1446.507) (-1452.683) [-1446.292] * (-1449.575) (-1447.484) [-1452.557] (-1447.592) -- 0:00:33
      463500 -- (-1448.410) (-1445.715) [-1448.663] (-1447.351) * (-1448.213) [-1448.999] (-1454.112) (-1453.163) -- 0:00:33
      464000 -- (-1448.587) (-1446.625) [-1446.065] (-1449.745) * [-1448.937] (-1447.410) (-1447.067) (-1448.738) -- 0:00:33
      464500 -- (-1446.943) (-1447.199) (-1447.738) [-1447.652] * (-1448.611) [-1445.445] (-1445.705) (-1451.073) -- 0:00:33
      465000 -- (-1447.905) (-1447.045) (-1447.206) [-1448.209] * (-1447.400) (-1446.252) [-1447.180] (-1449.327) -- 0:00:33

      Average standard deviation of split frequencies: 0.013151

      465500 -- (-1450.132) (-1446.493) [-1450.224] (-1447.617) * (-1446.467) [-1446.163] (-1446.782) (-1448.040) -- 0:00:34
      466000 -- (-1447.735) [-1447.722] (-1447.953) (-1446.830) * [-1446.990] (-1446.608) (-1447.209) (-1447.149) -- 0:00:34
      466500 -- (-1449.595) (-1446.471) [-1448.388] (-1449.840) * [-1446.963] (-1446.716) (-1447.541) (-1445.835) -- 0:00:34
      467000 -- (-1446.947) (-1446.969) (-1449.598) [-1446.807] * (-1445.612) (-1446.367) (-1447.768) [-1445.750] -- 0:00:34
      467500 -- (-1447.685) (-1446.425) [-1445.905] (-1445.911) * (-1445.775) (-1448.157) [-1445.528] (-1445.905) -- 0:00:34
      468000 -- (-1447.889) (-1445.794) (-1448.612) [-1447.721] * (-1446.854) [-1447.851] (-1446.212) (-1446.337) -- 0:00:34
      468500 -- (-1449.662) [-1446.410] (-1447.309) (-1448.517) * (-1448.668) [-1449.800] (-1449.430) (-1448.078) -- 0:00:34
      469000 -- (-1447.998) (-1446.424) (-1450.598) [-1446.383] * (-1450.249) [-1445.914] (-1449.033) (-1448.264) -- 0:00:33
      469500 -- (-1446.936) (-1448.551) [-1446.507] (-1449.396) * (-1449.540) (-1446.408) [-1451.239] (-1447.013) -- 0:00:33
      470000 -- (-1450.419) [-1447.657] (-1446.932) (-1445.761)