>C1
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C2
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C3
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C4
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C5
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C6
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=354
C1 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C2 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C3 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C4 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C5 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C6 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
**************************************************
C1 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C2 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C3 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C4 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C5 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C6 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
**************************************************
C1 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C2 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C3 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C4 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C5 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C6 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
**************************************************
C1 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C2 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C3 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C4 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C5 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C6 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
**************************************************
C1 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C2 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C3 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C4 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C5 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C6 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
**************************************************
C1 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C2 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C3 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C4 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C5 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C6 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
**************************************************
C1 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C2 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C3 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C4 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C5 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C6 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
**************************************************
C1 GPPA
C2 GPPA
C3 GPPA
C4 GPPA
C5 GPPA
C6 GPPA
****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 354 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 354 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10620]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [10620]--->[10620]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.521 Mb, Max= 30.926 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C2 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C3 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C4 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C5 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
C6 MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
**************************************************
C1 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C2 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C3 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C4 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C5 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
C6 LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
**************************************************
C1 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C2 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C3 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C4 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C5 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
C6 TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
**************************************************
C1 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C2 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C3 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C4 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C5 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
C6 EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
**************************************************
C1 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C2 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C3 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C4 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C5 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
C6 APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
**************************************************
C1 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C2 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C3 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C4 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C5 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
C6 AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
**************************************************
C1 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C2 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C3 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C4 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C5 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
C6 DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
**************************************************
C1 GPPA
C2 GPPA
C3 GPPA
C4 GPPA
C5 GPPA
C6 GPPA
****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
C2 ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
C3 ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
C4 ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
C5 ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
C6 ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
**************************************************
C1 ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
C2 ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
C3 ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
C4 ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
C5 ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
C6 ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
**************************************************
C1 CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
C2 CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
C3 CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
C4 CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
C5 CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
C6 CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
**************************************************
C1 CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
C2 CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
C3 CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
C4 CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
C5 CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
C6 CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
**************************************************
C1 CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
C2 CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
C3 CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
C4 CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
C5 CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
C6 CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
**************************************************
C1 TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
C2 TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
C3 TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
C4 TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
C5 TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
C6 TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
**************************************************
C1 ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
C2 ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
C3 ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
C4 ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
C5 ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
C6 ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
**************************************************
C1 CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
C2 CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
C3 CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
C4 CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
C5 CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
C6 CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
**************************************************
C1 GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
C2 GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
C3 GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
C4 GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
C5 GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
C6 GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
**************************************************
C1 GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
C2 GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
C3 GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
C4 GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
C5 GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
C6 GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
**************************************************
C1 CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
C2 CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
C3 CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
C4 CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
C5 CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
C6 CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
**************************************************
C1 AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
C2 AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
C3 AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
C4 AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
C5 AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
C6 AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
**************************************************
C1 GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
C2 GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
C3 GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
C4 GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
C5 GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
C6 GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
**************************************************
C1 TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
C2 TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
C3 TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
C4 TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
C5 TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
C6 TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
**************************************************
C1 GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
C2 GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
C3 GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
C4 GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
C5 GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
C6 GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
**************************************************
C1 GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
C2 GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
C3 GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
C4 GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
C5 GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
C6 GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
**************************************************
C1 CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
C2 CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
C3 CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
C4 CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
C5 CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
C6 CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
**************************************************
C1 CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
C2 CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
C3 CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
C4 CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
C5 CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
C6 CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
**************************************************
C1 GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
C2 GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
C3 GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
C4 GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
C5 GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
C6 GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
**************************************************
C1 GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
C2 GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
C3 GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
C4 GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
C5 GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
C6 GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
**************************************************
C1 ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
C2 ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
C3 ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
C4 ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
C5 ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
C6 ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
**************************************************
C1 GGACCTCCAGCT
C2 GGACCTCCAGCT
C3 GGACCTCCAGCT
C4 GGACCTCCAGCT
C5 GGACCTCCAGCT
C6 GGACCTCCAGCT
************
>C1
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C2
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C3
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C4
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C5
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C6
ATGAGCAGACAACCCCACCGTTCACTCTGGCGGTCATGGCTGGTAAGTAC
ATTAGCTGCGCTAGGTCTGAGTCTAGCCGTGGTTCCAGGGTCAGCCACAC
CGTCTGGACCGTCCACTTTGGCGCTCGATCGGTTCAGCAACCGGCCACCC
CTGCCGCTCAATCCCGCCGCGATGGTTGCGCCTCAGGTGGTCAATATCAG
CACTAGATTAGGCTACAACAGCGCGGTGGGAGCCGGGACGGGAATCGTTA
TCGATTCCAGCGGTGTCGTGCTGACCAATAATCACGTGATCTCGGGTGCT
ACCGATATCAGTGCGTTCGATGTCGGAAATGGCAAAACTTACGGCGTCGA
CGTGGTTGGTTACGACCGTACCCAGGACGTCGCGGTGCTCCAGCTTCGTG
GCGCGAGTAACCTGCCTACCGCAGTAATCGGTGGTGACGTGGCGATCGGC
GAACCGATTGTGGCTCTGGGCAACACGGGCGGCCAGGGTGGACTTCCCAG
CGTGTTGCCGGGTCGTGTCGTAGCACTTAACCAGACCGTCCAAGCGTCTG
AACCCCTGACCGGCGCCCAAGAGACGTTGTCCGGACTAATCCAGGTCGAC
GCCCCGATCAAACCCGGCGATTCGGGCGGGCCCGTCGTCAACAGCCGAGG
TCAGGTGGTCGGCATGAACACTGCTGCTACCGATAACTACAAGATGTTGG
GTGGGCAGGGCTTCGCCATTCCGATTGGTCAGGCGATGGAGGTCGTCGGT
GCCATCCGGTCCGGGGCTGGGTCAAACACCGTACACATAGGCCCGACGGC
CTTCTTTGGCCTGGGCGTTTTAGACAACAACGGCAACGGCGCACGGGTTG
CCCGTGTGGTCGCGACGGGTCCAGCCGCGATGGCTGGGATTTCGGTAGGT
GACATCATCACGTCGGTCGACGGTGTACCCATCAGCGAGGCCACCGCTAT
GACGAATGTGCTCGTGCCGCATCATCCTGGGGAAACCGTTGCGGTGAACT
ATCGCTCTGCTGGCGGCGGTGACCTCACCGCGAATGTGACGTTAGCGGAG
GGACCTCCAGCT
>C1
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C2
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C3
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C4
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C5
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
>C6
MSRQPHRSLWRSWLVSTLAALGLSLAVVPGSATPSGPSTLALDRFSNRPP
LPLNPAAMVAPQVVNISTRLGYNSAVGAGTGIVIDSSGVVLTNNHVISGA
TDISAFDVGNGKTYGVDVVGYDRTQDVAVLQLRGASNLPTAVIGGDVAIG
EPIVALGNTGGQGGLPSVLPGRVVALNQTVQASEPLTGAQETLSGLIQVD
APIKPGDSGGPVVNSRGQVVGMNTAATDNYKMLGGQGFAIPIGQAMEVVG
AIRSGAGSNTVHIGPTAFFGLGVLDNNGNGARVARVVATGPAAMAGISVG
DIITSVDGVPISEATAMTNVLVPHHPGETVAVNYRSAGGGDLTANVTLAE
GPPA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 1062 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859992
Setting output file names to "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 251696473
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5927439121
Seed = 1691571732
Swapseed = 1579859992
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2376.806775 -- -24.965149
Chain 2 -- -2376.806775 -- -24.965149
Chain 3 -- -2376.806550 -- -24.965149
Chain 4 -- -2376.806912 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2376.806775 -- -24.965149
Chain 2 -- -2376.806912 -- -24.965149
Chain 3 -- -2376.806912 -- -24.965149
Chain 4 -- -2376.806912 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2376.807] (-2376.807) (-2376.807) (-2376.807) * [-2376.807] (-2376.807) (-2376.807) (-2376.807)
500 -- (-1460.445) (-1460.537) (-1472.435) [-1467.717] * (-1467.196) (-1474.976) [-1454.691] (-1461.149) -- 0:00:00
1000 -- [-1461.425] (-1451.327) (-1464.957) (-1463.080) * [-1462.243] (-1452.716) (-1453.165) (-1463.048) -- 0:00:00
1500 -- (-1465.305) (-1453.603) [-1459.615] (-1460.379) * [-1453.786] (-1451.298) (-1458.954) (-1461.069) -- 0:00:00
2000 -- (-1458.184) [-1453.695] (-1453.398) (-1456.272) * (-1460.162) [-1462.270] (-1457.369) (-1451.604) -- 0:00:00
2500 -- (-1452.946) [-1454.223] (-1459.183) (-1461.392) * (-1453.424) (-1463.202) [-1455.005] (-1456.812) -- 0:00:00
3000 -- (-1456.543) (-1453.270) [-1451.757] (-1461.687) * (-1458.232) [-1452.646] (-1456.816) (-1463.057) -- 0:00:00
3500 -- (-1456.697) (-1457.738) [-1454.142] (-1463.031) * (-1456.268) (-1464.285) (-1453.864) [-1456.451] -- 0:00:00
4000 -- (-1454.957) (-1459.004) (-1456.489) [-1458.038] * (-1455.804) (-1460.621) (-1454.697) [-1455.482] -- 0:00:00
4500 -- (-1466.160) (-1456.506) [-1452.484] (-1454.231) * (-1456.216) (-1455.292) [-1457.216] (-1459.777) -- 0:00:00
5000 -- [-1458.092] (-1450.595) (-1459.619) (-1456.720) * (-1469.604) [-1454.375] (-1452.177) (-1451.227) -- 0:00:00
Average standard deviation of split frequencies: 0.067344
5500 -- [-1456.391] (-1453.248) (-1458.379) (-1456.464) * (-1448.345) (-1455.304) [-1453.455] (-1459.362) -- 0:00:00
6000 -- [-1455.405] (-1465.265) (-1459.905) (-1453.795) * (-1446.390) (-1455.927) [-1451.958] (-1461.459) -- 0:00:00
6500 -- (-1453.426) (-1468.455) [-1457.448] (-1457.610) * (-1445.679) (-1455.145) [-1456.081] (-1458.667) -- 0:00:00
7000 -- (-1461.336) (-1460.075) (-1455.982) [-1454.500] * [-1445.739] (-1458.107) (-1454.323) (-1468.189) -- 0:00:00
7500 -- (-1452.287) (-1458.223) [-1456.508] (-1453.792) * [-1446.718] (-1458.564) (-1454.302) (-1457.573) -- 0:00:00
8000 -- (-1466.302) [-1451.249] (-1455.447) (-1456.872) * (-1445.664) [-1467.639] (-1468.921) (-1462.284) -- 0:00:00
8500 -- (-1449.724) [-1452.792] (-1459.614) (-1455.325) * [-1446.045] (-1458.733) (-1460.146) (-1459.018) -- 0:00:00
9000 -- (-1447.337) (-1457.879) [-1455.084] (-1455.922) * (-1445.290) (-1469.581) (-1467.890) [-1451.592] -- 0:01:50
9500 -- [-1447.338] (-1462.237) (-1464.609) (-1458.148) * (-1445.348) (-1452.582) (-1457.035) [-1454.390] -- 0:01:44
10000 -- (-1446.567) (-1453.815) [-1454.812] (-1458.780) * (-1447.750) [-1452.905] (-1460.759) (-1460.832) -- 0:01:39
Average standard deviation of split frequencies: 0.053498
10500 -- (-1446.116) (-1459.604) [-1453.553] (-1455.296) * (-1448.459) [-1447.941] (-1455.408) (-1452.214) -- 0:01:34
11000 -- (-1446.199) (-1459.761) [-1452.843] (-1460.884) * (-1445.532) [-1447.718] (-1457.733) (-1446.306) -- 0:01:29
11500 -- [-1448.119] (-1455.380) (-1470.673) (-1464.115) * (-1446.032) [-1446.863] (-1460.080) (-1445.878) -- 0:01:25
12000 -- (-1446.493) (-1463.320) (-1454.751) [-1451.466] * (-1446.298) (-1448.154) (-1455.552) [-1445.542] -- 0:01:22
12500 -- (-1446.689) (-1461.180) [-1453.008] (-1465.558) * (-1448.291) (-1450.444) (-1455.683) [-1446.913] -- 0:01:19
13000 -- (-1448.115) (-1460.792) [-1454.057] (-1458.219) * (-1446.835) [-1446.794] (-1460.040) (-1446.750) -- 0:01:15
13500 -- (-1448.280) (-1451.841) (-1453.575) [-1456.872] * (-1447.954) [-1447.216] (-1458.352) (-1447.608) -- 0:01:13
14000 -- (-1450.031) [-1450.594] (-1456.167) (-1459.267) * [-1449.347] (-1446.322) (-1453.978) (-1446.357) -- 0:01:10
14500 -- [-1445.419] (-1449.245) (-1452.588) (-1454.812) * (-1446.429) [-1447.234] (-1458.792) (-1446.243) -- 0:01:07
15000 -- (-1447.128) [-1450.120] (-1456.163) (-1455.325) * (-1446.662) [-1447.033] (-1463.637) (-1445.602) -- 0:01:05
Average standard deviation of split frequencies: 0.052723
15500 -- [-1447.146] (-1448.675) (-1457.987) (-1455.546) * [-1446.153] (-1446.726) (-1460.358) (-1445.816) -- 0:01:03
16000 -- (-1446.307) [-1450.175] (-1458.379) (-1455.377) * (-1446.431) (-1448.560) (-1450.391) [-1445.859] -- 0:01:01
16500 -- (-1446.962) [-1446.508] (-1459.676) (-1455.294) * (-1446.307) (-1447.486) [-1457.542] (-1447.097) -- 0:00:59
17000 -- (-1446.670) [-1447.773] (-1475.568) (-1466.464) * [-1447.649] (-1447.737) (-1461.630) (-1446.203) -- 0:00:57
17500 -- (-1445.889) [-1448.967] (-1457.273) (-1455.455) * (-1447.670) [-1448.292] (-1455.614) (-1446.754) -- 0:00:56
18000 -- (-1447.476) (-1448.616) (-1463.125) [-1452.564] * [-1447.050] (-1449.721) (-1463.306) (-1445.715) -- 0:00:54
18500 -- (-1445.449) [-1445.242] (-1458.393) (-1453.574) * [-1452.799] (-1445.848) (-1465.352) (-1448.588) -- 0:00:53
19000 -- (-1445.412) [-1447.992] (-1452.826) (-1462.005) * (-1447.431) (-1445.588) [-1456.304] (-1447.511) -- 0:00:51
19500 -- [-1445.566] (-1448.466) (-1455.655) (-1464.792) * (-1446.770) (-1451.613) [-1451.869] (-1446.635) -- 0:00:50
20000 -- (-1445.567) (-1447.157) (-1459.395) [-1454.434] * [-1447.188] (-1447.001) (-1459.584) (-1445.119) -- 0:00:49
Average standard deviation of split frequencies: 0.046887
20500 -- (-1446.701) (-1445.688) (-1455.716) [-1450.857] * (-1448.958) (-1446.465) [-1457.616] (-1446.937) -- 0:00:47
21000 -- (-1449.382) (-1445.589) (-1456.167) [-1450.824] * (-1448.333) (-1446.238) (-1464.873) [-1452.396] -- 0:00:46
21500 -- [-1451.421] (-1445.984) (-1455.622) (-1459.276) * [-1448.062] (-1445.294) (-1454.183) (-1450.628) -- 0:00:45
22000 -- (-1448.225) (-1447.745) (-1455.592) [-1456.517] * (-1449.909) (-1448.832) [-1456.347] (-1451.268) -- 0:00:44
22500 -- (-1447.820) [-1447.042] (-1459.822) (-1455.926) * [-1449.243] (-1450.568) (-1456.641) (-1446.221) -- 0:00:43
23000 -- (-1447.708) (-1445.508) (-1459.755) [-1457.773] * [-1446.434] (-1449.428) (-1461.917) (-1445.506) -- 0:01:24
23500 -- (-1448.310) (-1446.389) (-1454.839) [-1455.488] * (-1447.099) [-1447.896] (-1463.077) (-1445.627) -- 0:01:23
24000 -- [-1445.844] (-1445.737) (-1455.799) (-1460.541) * (-1445.825) [-1446.426] (-1457.854) (-1446.079) -- 0:01:21
24500 -- (-1446.689) (-1447.222) (-1460.180) [-1451.961] * (-1447.616) [-1445.787] (-1452.783) (-1445.888) -- 0:01:19
25000 -- (-1448.749) (-1446.951) (-1463.698) [-1460.561] * (-1448.970) (-1445.440) [-1455.293] (-1445.877) -- 0:01:18
Average standard deviation of split frequencies: 0.039715
25500 -- [-1445.863] (-1449.818) (-1452.139) (-1456.753) * (-1446.762) (-1445.865) [-1458.035] (-1448.020) -- 0:01:16
26000 -- (-1445.554) [-1447.181] (-1458.516) (-1454.411) * [-1448.111] (-1445.822) (-1462.435) (-1446.024) -- 0:01:14
26500 -- (-1447.454) (-1445.513) [-1451.162] (-1452.591) * (-1446.746) (-1451.620) (-1460.372) [-1445.975] -- 0:01:13
27000 -- (-1447.277) (-1445.497) (-1456.397) [-1458.919] * (-1451.157) (-1446.752) (-1459.787) [-1447.339] -- 0:01:12
27500 -- (-1445.924) (-1446.720) [-1458.833] (-1457.320) * (-1452.074) (-1448.422) [-1453.373] (-1446.510) -- 0:01:10
28000 -- (-1448.088) [-1448.065] (-1457.399) (-1455.316) * (-1447.146) (-1449.578) [-1453.957] (-1446.630) -- 0:01:09
28500 -- (-1450.401) (-1447.288) (-1446.250) [-1455.095] * (-1449.360) [-1449.726] (-1459.792) (-1446.637) -- 0:01:08
29000 -- (-1449.429) [-1448.958] (-1449.963) (-1456.965) * (-1448.454) (-1449.624) [-1454.867] (-1447.203) -- 0:01:06
29500 -- [-1446.094] (-1447.456) (-1448.057) (-1455.115) * (-1447.336) (-1450.957) [-1451.194] (-1446.738) -- 0:01:05
30000 -- (-1446.523) (-1448.075) [-1453.664] (-1460.422) * [-1446.004] (-1448.826) (-1460.878) (-1449.720) -- 0:01:04
Average standard deviation of split frequencies: 0.041504
30500 -- (-1446.427) (-1445.632) (-1450.100) [-1455.924] * (-1445.486) (-1447.297) [-1456.322] (-1451.172) -- 0:01:03
31000 -- (-1446.557) (-1446.321) (-1449.785) [-1453.687] * [-1446.393] (-1445.906) (-1449.444) (-1447.641) -- 0:01:02
31500 -- [-1446.980] (-1448.301) (-1448.886) (-1457.740) * (-1447.611) (-1446.437) [-1457.555] (-1446.653) -- 0:01:01
32000 -- [-1450.022] (-1456.864) (-1445.715) (-1454.226) * (-1445.625) (-1447.311) [-1455.805] (-1449.137) -- 0:01:00
32500 -- (-1448.656) (-1450.815) (-1445.402) [-1462.225] * (-1445.433) (-1447.788) (-1463.388) [-1446.386] -- 0:00:59
33000 -- (-1451.005) (-1448.692) (-1448.879) [-1455.365] * (-1448.315) [-1449.843] (-1464.703) (-1451.029) -- 0:00:58
33500 -- (-1446.296) [-1448.071] (-1446.556) (-1450.632) * (-1447.946) (-1447.677) (-1466.286) [-1447.889] -- 0:00:57
34000 -- [-1446.876] (-1447.403) (-1449.487) (-1458.461) * (-1448.224) (-1449.272) [-1454.047] (-1448.428) -- 0:00:56
34500 -- (-1446.843) (-1448.366) (-1445.700) [-1446.821] * [-1447.367] (-1448.562) (-1456.860) (-1447.504) -- 0:00:55
35000 -- [-1447.696] (-1447.944) (-1446.389) (-1446.112) * (-1447.088) [-1449.704] (-1456.647) (-1448.180) -- 0:00:55
Average standard deviation of split frequencies: 0.041903
35500 -- (-1446.139) [-1446.649] (-1445.807) (-1446.791) * (-1448.991) (-1449.359) [-1456.051] (-1448.491) -- 0:00:54
36000 -- (-1446.523) (-1446.882) (-1446.587) [-1447.904] * (-1449.649) (-1447.021) [-1456.993] (-1446.270) -- 0:00:53
36500 -- (-1445.497) (-1449.659) [-1445.986] (-1447.456) * (-1448.103) [-1447.564] (-1454.205) (-1446.786) -- 0:00:52
37000 -- (-1447.584) [-1449.419] (-1446.247) (-1447.373) * (-1449.075) (-1450.900) [-1456.309] (-1446.508) -- 0:00:52
37500 -- (-1445.888) [-1446.220] (-1445.939) (-1448.957) * (-1447.160) (-1448.159) (-1457.643) [-1446.297] -- 0:01:17
38000 -- (-1445.734) [-1446.653] (-1447.635) (-1448.606) * (-1447.549) (-1447.024) (-1458.470) [-1446.309] -- 0:01:15
38500 -- (-1449.446) [-1449.873] (-1447.334) (-1446.578) * (-1446.169) (-1447.014) [-1453.460] (-1447.318) -- 0:01:14
39000 -- (-1448.463) (-1447.708) [-1447.369] (-1447.012) * [-1446.624] (-1446.971) (-1460.367) (-1446.834) -- 0:01:13
39500 -- (-1448.549) [-1446.055] (-1446.727) (-1447.327) * [-1446.868] (-1447.433) (-1469.164) (-1448.476) -- 0:01:12
40000 -- (-1450.914) (-1446.784) (-1446.608) [-1448.794] * [-1448.365] (-1448.690) (-1446.631) (-1448.669) -- 0:01:12
Average standard deviation of split frequencies: 0.028980
40500 -- (-1452.660) (-1446.580) [-1449.266] (-1450.020) * (-1447.309) (-1449.330) (-1447.889) [-1446.367] -- 0:01:11
41000 -- [-1448.416] (-1446.216) (-1449.748) (-1450.295) * (-1447.379) (-1448.981) (-1449.792) [-1447.169] -- 0:01:10
41500 -- [-1449.119] (-1447.211) (-1447.475) (-1447.835) * (-1447.737) [-1449.894] (-1448.092) (-1448.506) -- 0:01:09
42000 -- (-1448.929) [-1449.292] (-1447.841) (-1447.137) * (-1452.501) [-1448.628] (-1449.310) (-1448.637) -- 0:01:08
42500 -- (-1448.074) (-1448.620) [-1446.297] (-1446.150) * (-1447.984) (-1450.185) [-1447.043] (-1446.558) -- 0:01:07
43000 -- [-1450.129] (-1449.756) (-1446.929) (-1448.510) * (-1446.764) (-1447.224) (-1450.370) [-1446.484] -- 0:01:06
43500 -- (-1449.534) [-1446.749] (-1446.993) (-1450.755) * (-1449.528) (-1447.134) [-1445.740] (-1446.804) -- 0:01:05
44000 -- (-1449.797) (-1446.114) [-1446.618] (-1453.349) * (-1448.797) [-1446.747] (-1446.110) (-1449.881) -- 0:01:05
44500 -- (-1447.482) (-1447.026) (-1447.226) [-1447.387] * [-1447.387] (-1446.215) (-1448.477) (-1449.370) -- 0:01:04
45000 -- (-1447.181) (-1446.594) [-1446.505] (-1448.962) * (-1447.994) (-1446.156) (-1450.065) [-1449.703] -- 0:01:03
Average standard deviation of split frequencies: 0.029768
45500 -- [-1447.142] (-1451.715) (-1446.085) (-1453.138) * [-1448.691] (-1448.724) (-1449.588) (-1450.519) -- 0:01:02
46000 -- [-1446.179] (-1449.494) (-1446.261) (-1454.181) * (-1452.782) (-1447.244) (-1446.166) [-1457.005] -- 0:01:02
46500 -- (-1446.325) [-1447.038] (-1447.883) (-1455.980) * (-1448.692) (-1449.648) [-1447.632] (-1453.296) -- 0:01:01
47000 -- [-1449.087] (-1451.562) (-1456.027) (-1453.140) * [-1447.158] (-1448.828) (-1446.813) (-1449.266) -- 0:01:00
47500 -- (-1449.588) (-1447.780) [-1450.438] (-1448.024) * (-1450.276) (-1445.517) [-1447.900] (-1447.223) -- 0:01:00
48000 -- (-1447.290) (-1446.369) [-1446.632] (-1448.382) * (-1446.804) (-1446.512) [-1450.398] (-1451.096) -- 0:00:59
48500 -- [-1446.241] (-1447.449) (-1447.372) (-1448.225) * [-1452.996] (-1450.162) (-1450.736) (-1447.923) -- 0:00:58
49000 -- [-1447.863] (-1447.301) (-1446.059) (-1451.271) * (-1446.718) (-1446.776) (-1450.066) [-1450.740] -- 0:00:58
49500 -- (-1446.848) (-1447.253) [-1445.928] (-1450.197) * (-1448.073) (-1448.755) [-1447.813] (-1447.944) -- 0:00:57
50000 -- [-1446.272] (-1448.198) (-1447.384) (-1446.669) * (-1447.834) (-1446.477) [-1446.133] (-1448.310) -- 0:00:57
Average standard deviation of split frequencies: 0.025586
50500 -- (-1446.516) (-1451.351) (-1445.833) [-1446.984] * (-1446.019) (-1445.219) [-1445.402] (-1451.788) -- 0:00:56
51000 -- (-1447.671) (-1448.872) [-1446.871] (-1447.926) * [-1446.358] (-1445.597) (-1446.974) (-1448.673) -- 0:00:55
51500 -- [-1449.518] (-1449.926) (-1446.168) (-1448.931) * (-1446.306) (-1447.987) (-1447.656) [-1448.617] -- 0:00:55
52000 -- (-1448.716) [-1445.953] (-1446.861) (-1447.329) * (-1448.734) (-1449.260) [-1453.035] (-1448.832) -- 0:00:54
52500 -- (-1445.646) [-1446.114] (-1446.727) (-1452.185) * [-1445.370] (-1449.103) (-1449.501) (-1446.403) -- 0:00:54
53000 -- [-1446.235] (-1445.804) (-1450.415) (-1454.071) * [-1445.370] (-1449.066) (-1446.647) (-1445.856) -- 0:00:53
53500 -- [-1445.585] (-1451.130) (-1450.305) (-1450.113) * (-1445.254) (-1448.034) [-1445.448] (-1450.732) -- 0:01:10
54000 -- (-1450.605) [-1448.114] (-1450.418) (-1449.350) * (-1445.551) [-1447.747] (-1446.413) (-1451.934) -- 0:01:10
54500 -- (-1446.947) [-1446.165] (-1452.146) (-1447.291) * (-1446.725) (-1447.864) [-1445.816] (-1448.811) -- 0:01:09
55000 -- (-1446.428) (-1446.472) (-1446.896) [-1446.543] * [-1447.505] (-1447.603) (-1447.015) (-1449.276) -- 0:01:08
Average standard deviation of split frequencies: 0.028355
55500 -- [-1446.310] (-1446.434) (-1448.445) (-1450.490) * (-1447.635) (-1447.904) (-1447.148) [-1448.681] -- 0:01:08
56000 -- (-1447.527) (-1445.867) [-1446.667] (-1446.353) * (-1447.074) [-1446.418] (-1451.054) (-1449.582) -- 0:01:07
56500 -- (-1447.149) [-1447.039] (-1447.247) (-1446.615) * (-1447.131) (-1446.863) [-1448.497] (-1447.780) -- 0:01:06
57000 -- (-1446.620) (-1447.648) (-1447.056) [-1446.893] * [-1446.048] (-1446.138) (-1446.737) (-1446.672) -- 0:01:06
57500 -- (-1446.752) [-1446.349] (-1447.385) (-1445.689) * (-1447.051) (-1446.421) (-1449.441) [-1445.774] -- 0:01:05
58000 -- (-1446.661) [-1446.716] (-1446.909) (-1448.141) * (-1447.801) (-1445.916) [-1448.110] (-1446.033) -- 0:01:04
58500 -- [-1445.784] (-1446.283) (-1447.014) (-1446.674) * (-1455.314) [-1445.384] (-1449.716) (-1446.874) -- 0:01:04
59000 -- (-1451.509) [-1446.284] (-1447.550) (-1447.800) * [-1450.073] (-1446.490) (-1445.973) (-1446.113) -- 0:01:03
59500 -- (-1451.503) [-1447.968] (-1447.081) (-1446.745) * (-1451.244) (-1453.068) [-1445.973] (-1448.873) -- 0:01:03
60000 -- (-1449.450) (-1447.582) [-1449.701] (-1446.660) * [-1448.510] (-1446.845) (-1447.899) (-1452.210) -- 0:01:02
Average standard deviation of split frequencies: 0.027425
60500 -- (-1446.018) (-1449.774) (-1450.555) [-1446.031] * (-1448.178) [-1446.734] (-1447.599) (-1449.939) -- 0:01:02
61000 -- (-1446.858) [-1451.962] (-1447.080) (-1448.133) * (-1450.324) (-1446.132) [-1446.658] (-1447.322) -- 0:01:01
61500 -- (-1446.513) (-1449.166) (-1450.529) [-1446.670] * (-1451.885) [-1445.520] (-1447.491) (-1445.535) -- 0:01:01
62000 -- (-1446.773) [-1445.670] (-1448.907) (-1447.184) * (-1448.043) [-1446.892] (-1446.151) (-1446.122) -- 0:01:00
62500 -- (-1447.906) [-1447.707] (-1452.880) (-1448.281) * (-1447.865) (-1447.020) [-1445.601] (-1448.815) -- 0:01:00
63000 -- (-1445.992) (-1449.204) [-1446.812] (-1446.589) * (-1449.276) (-1447.176) [-1446.396] (-1446.164) -- 0:00:59
63500 -- (-1450.900) [-1450.338] (-1447.374) (-1447.939) * (-1450.444) (-1445.990) (-1446.396) [-1446.899] -- 0:00:58
64000 -- [-1445.701] (-1446.515) (-1449.300) (-1447.934) * (-1451.464) (-1446.636) [-1445.689] (-1447.128) -- 0:00:58
64500 -- (-1447.502) (-1448.362) (-1449.274) [-1451.537] * (-1447.714) (-1446.753) [-1445.682] (-1446.037) -- 0:00:58
65000 -- (-1446.508) [-1450.236] (-1448.724) (-1450.494) * (-1445.427) [-1446.182] (-1445.650) (-1446.180) -- 0:00:57
Average standard deviation of split frequencies: 0.022179
65500 -- (-1448.278) (-1449.367) [-1450.112] (-1449.937) * (-1445.427) (-1452.159) (-1445.045) [-1449.568] -- 0:00:57
66000 -- (-1448.898) (-1447.959) [-1449.694] (-1453.257) * (-1445.561) (-1445.621) (-1449.556) [-1449.582] -- 0:00:56
66500 -- (-1447.370) (-1447.959) [-1451.313] (-1449.524) * (-1446.866) [-1445.081] (-1446.620) (-1449.722) -- 0:00:56
67000 -- (-1446.470) (-1451.095) (-1446.683) [-1449.358] * (-1446.386) (-1446.661) [-1447.160] (-1450.947) -- 0:00:55
67500 -- (-1447.036) (-1447.917) (-1447.811) [-1450.241] * (-1446.325) [-1449.455] (-1447.279) (-1451.533) -- 0:00:55
68000 -- (-1445.970) (-1446.118) (-1449.022) [-1447.933] * (-1446.894) (-1447.434) [-1445.545] (-1451.868) -- 0:00:54
68500 -- (-1446.234) [-1446.675] (-1448.894) (-1447.906) * [-1446.892] (-1445.968) (-1448.716) (-1452.184) -- 0:00:54
69000 -- (-1445.800) (-1447.119) (-1449.851) [-1449.969] * (-1448.741) (-1450.320) [-1448.716] (-1451.152) -- 0:00:53
69500 -- (-1446.657) (-1452.373) [-1446.571] (-1447.692) * (-1446.162) [-1446.821] (-1449.359) (-1448.856) -- 0:00:53
70000 -- (-1445.818) (-1452.791) (-1447.371) [-1448.457] * (-1450.163) (-1447.365) [-1447.577] (-1448.871) -- 0:01:06
Average standard deviation of split frequencies: 0.022470
70500 -- (-1446.675) (-1447.538) (-1447.315) [-1446.890] * (-1452.458) (-1447.304) (-1453.393) [-1448.882] -- 0:01:05
71000 -- [-1446.324] (-1449.632) (-1447.407) (-1446.851) * (-1447.874) [-1447.574] (-1453.149) (-1454.282) -- 0:01:05
71500 -- (-1446.687) (-1447.392) (-1447.599) [-1447.215] * (-1448.136) (-1447.154) [-1447.353] (-1446.827) -- 0:01:04
72000 -- (-1446.796) [-1450.790] (-1448.283) (-1445.766) * (-1449.256) [-1447.128] (-1446.051) (-1449.782) -- 0:01:04
72500 -- (-1450.449) (-1448.542) [-1447.641] (-1447.129) * (-1450.685) (-1447.121) [-1447.010] (-1445.337) -- 0:01:03
73000 -- (-1452.669) (-1449.562) (-1451.281) [-1447.660] * (-1451.506) [-1446.640] (-1450.189) (-1447.032) -- 0:01:03
73500 -- (-1449.756) (-1447.853) [-1449.670] (-1448.177) * (-1448.047) (-1447.228) [-1448.196] (-1446.365) -- 0:01:03
74000 -- [-1446.545] (-1449.279) (-1452.012) (-1449.508) * (-1447.250) (-1446.072) (-1448.457) [-1445.762] -- 0:01:02
74500 -- (-1450.358) (-1447.411) (-1448.211) [-1449.602] * (-1446.874) (-1449.084) (-1448.150) [-1446.077] -- 0:01:02
75000 -- [-1445.875] (-1446.930) (-1448.217) (-1449.043) * (-1445.801) (-1447.444) (-1448.334) [-1446.086] -- 0:01:01
Average standard deviation of split frequencies: 0.027096
75500 -- [-1446.236] (-1447.359) (-1451.869) (-1446.719) * (-1447.322) (-1448.115) (-1448.477) [-1445.703] -- 0:01:01
76000 -- (-1447.465) (-1447.873) (-1449.637) [-1447.765] * (-1451.174) [-1449.348] (-1446.974) (-1446.556) -- 0:01:00
76500 -- (-1450.341) [-1446.372] (-1445.994) (-1446.562) * (-1447.232) (-1446.616) [-1447.549] (-1446.665) -- 0:01:00
77000 -- (-1447.659) (-1447.195) [-1445.687] (-1447.783) * [-1448.617] (-1446.721) (-1449.295) (-1446.661) -- 0:00:59
77500 -- (-1448.375) [-1449.257] (-1445.687) (-1450.164) * (-1450.530) (-1447.261) [-1450.621] (-1451.352) -- 0:00:59
78000 -- (-1452.404) [-1451.461] (-1447.229) (-1447.040) * (-1450.056) [-1452.783] (-1451.218) (-1454.206) -- 0:00:59
78500 -- (-1449.069) (-1448.698) (-1451.421) [-1447.453] * [-1447.776] (-1449.574) (-1452.449) (-1446.815) -- 0:00:58
79000 -- (-1450.943) (-1446.638) (-1447.632) [-1445.583] * [-1450.738] (-1451.735) (-1447.740) (-1447.517) -- 0:00:58
79500 -- (-1447.573) (-1446.407) (-1446.276) [-1446.551] * (-1451.682) (-1449.303) (-1446.922) [-1454.528] -- 0:00:57
80000 -- (-1446.418) (-1446.164) [-1446.351] (-1450.929) * (-1450.272) (-1446.690) [-1446.475] (-1448.110) -- 0:00:57
Average standard deviation of split frequencies: 0.025528
80500 -- [-1446.003] (-1447.710) (-1446.331) (-1449.116) * (-1449.370) [-1449.424] (-1447.096) (-1447.780) -- 0:00:57
81000 -- (-1450.549) (-1449.722) [-1447.206] (-1451.730) * (-1450.096) (-1450.357) (-1446.799) [-1447.312] -- 0:00:56
81500 -- (-1447.032) [-1448.126] (-1448.162) (-1448.288) * (-1447.175) (-1452.074) (-1448.724) [-1448.647] -- 0:00:56
82000 -- [-1449.336] (-1446.979) (-1448.383) (-1449.715) * [-1446.817] (-1450.544) (-1447.459) (-1448.264) -- 0:00:55
82500 -- [-1446.531] (-1446.360) (-1452.743) (-1449.766) * [-1446.714] (-1448.491) (-1446.826) (-1447.867) -- 0:00:55
83000 -- (-1453.345) [-1448.145] (-1447.507) (-1448.228) * (-1445.974) (-1448.588) (-1447.094) [-1451.520] -- 0:00:55
83500 -- (-1447.699) (-1447.000) (-1446.722) [-1446.789] * (-1447.517) (-1446.852) (-1446.472) [-1449.603] -- 0:00:54
84000 -- [-1450.582] (-1449.208) (-1446.221) (-1445.977) * (-1447.805) [-1446.604] (-1446.639) (-1446.782) -- 0:00:54
84500 -- (-1448.366) (-1447.116) (-1448.430) [-1446.047] * (-1447.339) (-1446.615) (-1446.451) [-1445.681] -- 0:00:54
85000 -- (-1448.297) [-1447.471] (-1451.616) (-1449.720) * [-1449.897] (-1446.343) (-1447.117) (-1445.710) -- 0:00:53
Average standard deviation of split frequencies: 0.025580
85500 -- [-1446.727] (-1450.981) (-1448.022) (-1449.457) * (-1446.223) (-1445.940) [-1446.103] (-1446.024) -- 0:00:53
86000 -- (-1447.249) (-1447.934) [-1447.422] (-1447.803) * (-1446.049) (-1446.707) [-1447.154] (-1449.490) -- 0:01:03
86500 -- (-1447.249) (-1447.115) [-1445.844] (-1445.456) * [-1446.906] (-1447.857) (-1445.948) (-1450.609) -- 0:01:03
87000 -- (-1447.729) (-1449.117) [-1445.914] (-1447.292) * [-1446.531] (-1445.841) (-1447.121) (-1450.847) -- 0:01:02
87500 -- [-1447.170] (-1450.232) (-1445.914) (-1447.686) * (-1450.301) [-1446.340] (-1445.386) (-1445.839) -- 0:01:02
88000 -- (-1449.462) [-1446.838] (-1449.106) (-1447.994) * (-1450.282) [-1447.899] (-1447.275) (-1445.695) -- 0:01:02
88500 -- [-1446.077] (-1447.175) (-1447.934) (-1448.033) * (-1447.230) [-1448.411] (-1448.625) (-1451.151) -- 0:01:01
89000 -- (-1446.550) (-1446.896) (-1448.469) [-1445.593] * (-1447.306) (-1447.421) (-1448.492) [-1446.609] -- 0:01:01
89500 -- (-1447.877) (-1446.463) [-1448.801] (-1446.403) * [-1447.546] (-1447.208) (-1448.378) (-1445.674) -- 0:01:01
90000 -- (-1449.651) [-1448.011] (-1448.800) (-1446.292) * (-1446.259) (-1448.454) (-1449.523) [-1447.383] -- 0:01:00
Average standard deviation of split frequencies: 0.024355
90500 -- (-1447.467) (-1445.579) [-1445.647] (-1445.681) * (-1448.703) (-1445.578) (-1451.016) [-1448.053] -- 0:01:00
91000 -- (-1448.524) [-1445.547] (-1451.864) (-1447.145) * (-1447.581) (-1446.136) (-1450.678) [-1446.779] -- 0:00:59
91500 -- [-1448.840] (-1445.547) (-1446.606) (-1446.017) * (-1447.857) (-1446.136) [-1448.754] (-1445.765) -- 0:00:59
92000 -- [-1448.224] (-1446.672) (-1447.751) (-1447.826) * (-1448.191) (-1445.702) [-1449.175] (-1446.532) -- 0:00:59
92500 -- (-1447.157) (-1447.136) (-1445.505) [-1445.997] * (-1453.042) (-1447.412) [-1447.233] (-1445.935) -- 0:00:58
93000 -- (-1448.652) (-1452.501) [-1446.620] (-1448.092) * (-1451.519) (-1446.887) [-1449.170] (-1447.707) -- 0:00:58
93500 -- (-1448.216) (-1447.781) [-1446.968] (-1445.886) * (-1446.413) [-1450.260] (-1447.494) (-1447.639) -- 0:00:58
94000 -- (-1448.077) (-1447.698) (-1446.214) [-1445.428] * (-1451.799) [-1449.678] (-1447.384) (-1450.005) -- 0:00:57
94500 -- (-1451.876) (-1447.466) (-1447.181) [-1448.936] * (-1451.701) (-1450.750) (-1448.969) [-1445.783] -- 0:00:57
95000 -- (-1449.666) [-1448.489] (-1448.402) (-1446.928) * (-1450.649) [-1446.787] (-1453.935) (-1447.771) -- 0:00:57
Average standard deviation of split frequencies: 0.020417
95500 -- [-1446.691] (-1447.635) (-1447.781) (-1447.191) * (-1448.915) (-1448.099) (-1448.343) [-1448.758] -- 0:00:56
96000 -- [-1447.081] (-1447.059) (-1446.947) (-1445.382) * (-1450.361) [-1446.428] (-1448.797) (-1445.656) -- 0:00:56
96500 -- (-1450.567) (-1450.034) [-1445.947] (-1446.656) * [-1446.287] (-1447.465) (-1447.847) (-1446.299) -- 0:00:56
97000 -- (-1445.720) (-1446.693) [-1447.831] (-1448.057) * [-1448.083] (-1447.333) (-1447.166) (-1446.406) -- 0:00:55
97500 -- (-1445.923) (-1447.925) (-1447.723) [-1450.502] * (-1452.607) [-1448.860] (-1446.677) (-1447.698) -- 0:00:55
98000 -- [-1445.774] (-1448.033) (-1448.922) (-1452.252) * (-1451.681) (-1447.211) (-1447.630) [-1448.076] -- 0:00:55
98500 -- [-1445.607] (-1447.030) (-1447.400) (-1449.536) * (-1448.227) [-1447.371] (-1447.660) (-1447.423) -- 0:00:54
99000 -- (-1446.870) (-1448.540) (-1446.859) [-1446.697] * [-1447.712] (-1447.680) (-1446.605) (-1446.538) -- 0:00:54
99500 -- [-1446.045] (-1449.383) (-1449.127) (-1445.529) * (-1447.894) (-1448.232) (-1447.513) [-1446.441] -- 0:00:54
100000 -- (-1445.368) [-1447.349] (-1449.257) (-1445.228) * (-1447.073) (-1447.805) [-1450.446] (-1446.954) -- 0:00:54
Average standard deviation of split frequencies: 0.023154
100500 -- (-1451.892) [-1445.523] (-1447.547) (-1445.789) * (-1446.372) (-1446.494) [-1447.330] (-1447.824) -- 0:00:53
101000 -- (-1446.623) (-1445.642) (-1449.423) [-1445.965] * (-1451.645) [-1446.340] (-1447.287) (-1447.463) -- 0:01:02
101500 -- (-1446.779) (-1447.657) (-1448.253) [-1445.794] * [-1450.155] (-1449.312) (-1448.171) (-1448.315) -- 0:01:01
102000 -- (-1451.783) (-1448.298) [-1449.009] (-1448.642) * [-1449.905] (-1447.924) (-1452.378) (-1453.283) -- 0:01:01
102500 -- (-1445.849) (-1451.413) (-1447.836) [-1447.592] * (-1451.366) (-1448.531) (-1452.036) [-1446.748] -- 0:01:01
103000 -- (-1448.539) [-1446.763] (-1453.469) (-1445.947) * (-1447.848) (-1448.452) (-1446.841) [-1446.882] -- 0:01:00
103500 -- (-1447.870) (-1446.634) (-1446.116) [-1446.514] * (-1449.284) (-1446.698) (-1448.577) [-1446.876] -- 0:01:00
104000 -- (-1445.310) (-1448.871) (-1446.768) [-1446.277] * (-1448.796) (-1447.086) [-1448.011] (-1451.247) -- 0:01:00
104500 -- [-1445.420] (-1447.371) (-1447.398) (-1450.102) * [-1445.981] (-1449.733) (-1446.793) (-1454.507) -- 0:00:59
105000 -- (-1446.621) [-1446.606] (-1445.866) (-1447.302) * [-1447.196] (-1445.913) (-1447.262) (-1448.883) -- 0:00:59
Average standard deviation of split frequencies: 0.021768
105500 -- (-1446.965) (-1450.713) (-1445.488) [-1446.126] * (-1446.655) [-1445.914] (-1448.536) (-1449.355) -- 0:00:59
106000 -- [-1445.836] (-1445.862) (-1445.493) (-1446.020) * (-1445.599) [-1447.218] (-1449.672) (-1447.649) -- 0:00:59
106500 -- (-1450.974) (-1446.152) [-1445.950] (-1446.385) * (-1445.852) [-1446.678] (-1448.865) (-1447.523) -- 0:00:58
107000 -- (-1447.887) (-1448.465) (-1446.574) [-1446.097] * (-1446.287) (-1446.877) (-1454.350) [-1446.106] -- 0:00:58
107500 -- (-1448.995) (-1449.336) (-1448.989) [-1446.410] * [-1445.903] (-1446.650) (-1451.968) (-1445.616) -- 0:00:58
108000 -- [-1447.593] (-1448.096) (-1448.464) (-1446.002) * (-1449.896) (-1447.889) (-1450.358) [-1445.846] -- 0:00:57
108500 -- [-1447.345] (-1451.980) (-1448.282) (-1446.330) * (-1447.597) [-1446.771] (-1448.302) (-1451.543) -- 0:00:57
109000 -- (-1447.486) [-1447.747] (-1446.771) (-1451.273) * [-1446.244] (-1447.368) (-1446.515) (-1448.726) -- 0:00:57
109500 -- (-1447.596) (-1447.521) [-1447.756] (-1447.204) * (-1447.131) (-1451.121) (-1450.648) [-1446.659] -- 0:00:56
110000 -- (-1447.219) (-1448.018) [-1447.988] (-1449.604) * (-1446.786) [-1451.308] (-1447.105) (-1449.769) -- 0:00:56
Average standard deviation of split frequencies: 0.021523
110500 -- (-1447.795) (-1451.061) [-1446.529] (-1450.017) * (-1446.898) (-1447.405) (-1446.849) [-1447.466] -- 0:00:56
111000 -- (-1445.923) (-1452.439) [-1447.336] (-1447.276) * (-1447.355) (-1446.855) [-1453.690] (-1446.901) -- 0:00:56
111500 -- (-1446.660) (-1451.081) [-1449.077] (-1448.439) * (-1446.954) [-1448.037] (-1454.492) (-1446.712) -- 0:00:55
112000 -- (-1446.860) (-1447.243) [-1447.148] (-1446.685) * (-1446.061) (-1448.322) [-1446.203] (-1446.256) -- 0:00:55
112500 -- (-1455.308) (-1450.404) [-1446.646] (-1449.820) * (-1445.875) [-1447.465] (-1447.815) (-1446.278) -- 0:00:55
113000 -- (-1448.210) (-1449.350) (-1447.699) [-1449.652] * (-1445.737) (-1447.640) (-1446.006) [-1445.900] -- 0:00:54
113500 -- (-1448.293) [-1446.960] (-1447.248) (-1447.146) * (-1447.282) (-1446.925) [-1445.355] (-1449.197) -- 0:00:54
114000 -- (-1447.503) (-1448.967) [-1448.113] (-1446.080) * (-1448.829) [-1446.533] (-1446.290) (-1447.815) -- 0:00:54
114500 -- (-1449.462) (-1445.415) [-1449.135] (-1446.088) * (-1447.038) (-1448.290) (-1446.142) [-1445.636] -- 0:00:54
115000 -- (-1448.347) (-1446.550) (-1447.447) [-1446.781] * [-1445.516] (-1448.312) (-1451.442) (-1449.026) -- 0:00:53
Average standard deviation of split frequencies: 0.018897
115500 -- (-1448.224) [-1448.451] (-1449.146) (-1447.460) * [-1446.069] (-1447.051) (-1450.231) (-1448.766) -- 0:00:53
116000 -- [-1448.495] (-1448.198) (-1449.702) (-1447.999) * (-1448.495) [-1446.257] (-1447.681) (-1449.576) -- 0:01:00
116500 -- (-1445.874) (-1447.162) (-1447.260) [-1446.025] * (-1456.273) (-1448.117) (-1448.197) [-1448.948] -- 0:01:00
117000 -- (-1445.823) (-1450.993) [-1447.894] (-1448.175) * (-1455.785) [-1447.014] (-1447.208) (-1449.683) -- 0:01:00
117500 -- (-1453.120) (-1447.213) [-1447.667] (-1449.396) * (-1447.200) [-1449.950] (-1447.768) (-1448.653) -- 0:01:00
118000 -- (-1450.358) (-1445.649) (-1448.806) [-1450.377] * (-1447.595) (-1448.753) [-1447.034] (-1448.588) -- 0:00:59
118500 -- [-1448.015] (-1447.231) (-1447.855) (-1448.817) * (-1448.384) [-1447.238] (-1448.397) (-1448.964) -- 0:00:59
119000 -- [-1447.964] (-1445.878) (-1450.051) (-1448.718) * [-1450.858] (-1447.950) (-1446.821) (-1452.340) -- 0:00:59
119500 -- (-1450.819) [-1449.163] (-1450.866) (-1448.406) * (-1448.086) (-1447.475) (-1446.878) [-1446.750] -- 0:00:58
120000 -- [-1447.452] (-1446.733) (-1448.978) (-1448.759) * [-1445.730] (-1448.719) (-1447.026) (-1447.932) -- 0:00:58
Average standard deviation of split frequencies: 0.020150
120500 -- (-1447.742) (-1446.332) (-1448.973) [-1446.369] * (-1447.613) (-1449.302) (-1446.507) [-1446.697] -- 0:00:58
121000 -- [-1449.028] (-1447.275) (-1447.899) (-1446.033) * [-1445.662] (-1453.004) (-1448.950) (-1447.258) -- 0:00:58
121500 -- (-1448.115) [-1448.882] (-1445.523) (-1446.442) * (-1448.154) (-1448.161) (-1448.063) [-1445.517] -- 0:00:57
122000 -- (-1446.121) (-1446.139) (-1447.122) [-1445.226] * [-1446.764] (-1447.734) (-1447.171) (-1448.980) -- 0:00:57
122500 -- [-1448.501] (-1447.051) (-1447.769) (-1446.661) * (-1446.867) (-1447.902) [-1445.754] (-1451.843) -- 0:00:57
123000 -- (-1445.865) [-1446.420] (-1446.733) (-1448.266) * (-1449.379) (-1447.799) [-1445.784] (-1447.637) -- 0:00:57
123500 -- (-1447.197) [-1446.591] (-1446.627) (-1449.177) * (-1446.917) (-1445.673) [-1445.324] (-1447.592) -- 0:00:56
124000 -- [-1445.200] (-1447.270) (-1446.069) (-1451.408) * (-1448.928) [-1445.789] (-1446.385) (-1447.019) -- 0:00:56
124500 -- (-1445.216) (-1447.506) (-1450.038) [-1446.578] * (-1448.757) (-1448.417) [-1445.472] (-1449.317) -- 0:00:56
125000 -- (-1446.785) (-1445.717) [-1448.294] (-1450.121) * (-1448.160) (-1446.199) [-1447.426] (-1448.331) -- 0:00:56
Average standard deviation of split frequencies: 0.018116
125500 -- [-1447.496] (-1449.067) (-1446.098) (-1448.053) * (-1446.538) (-1446.107) (-1448.239) [-1447.908] -- 0:00:55
126000 -- (-1446.775) (-1446.908) [-1445.540] (-1448.524) * [-1451.514] (-1446.143) (-1446.265) (-1448.315) -- 0:00:55
126500 -- (-1446.634) [-1448.058] (-1446.857) (-1447.679) * (-1451.339) [-1446.296] (-1446.765) (-1447.303) -- 0:00:55
127000 -- (-1445.959) [-1450.116] (-1447.922) (-1450.122) * (-1447.079) [-1445.533] (-1447.099) (-1447.851) -- 0:00:54
127500 -- [-1446.235] (-1448.522) (-1446.415) (-1454.782) * (-1453.371) (-1445.955) [-1446.328] (-1446.464) -- 0:00:54
128000 -- (-1446.159) [-1450.344] (-1447.856) (-1448.654) * (-1449.116) (-1445.859) [-1446.160] (-1447.524) -- 0:00:54
128500 -- (-1447.609) (-1447.894) (-1450.411) [-1446.935] * [-1450.433] (-1446.269) (-1447.059) (-1449.029) -- 0:00:54
129000 -- (-1446.446) [-1447.780] (-1447.930) (-1449.519) * (-1445.356) (-1447.994) (-1449.124) [-1448.127] -- 0:00:54
129500 -- (-1447.097) [-1447.785] (-1449.716) (-1448.977) * (-1445.165) (-1449.606) (-1448.283) [-1449.803] -- 0:00:53
130000 -- [-1445.931] (-1449.339) (-1449.711) (-1446.158) * (-1447.372) (-1448.552) (-1447.457) [-1447.927] -- 0:00:53
Average standard deviation of split frequencies: 0.017089
130500 -- [-1446.706] (-1447.942) (-1446.950) (-1450.928) * (-1448.657) (-1448.158) (-1446.725) [-1446.206] -- 0:00:53
131000 -- (-1447.119) (-1447.405) [-1446.460] (-1448.533) * (-1448.572) (-1447.956) (-1447.239) [-1445.482] -- 0:00:53
131500 -- [-1445.495] (-1446.707) (-1447.756) (-1447.777) * (-1449.310) (-1450.243) (-1446.964) [-1445.688] -- 0:00:52
132000 -- (-1447.342) (-1450.333) [-1445.176] (-1451.407) * (-1449.177) [-1449.151] (-1446.442) (-1451.267) -- 0:00:59
132500 -- (-1445.438) (-1447.012) [-1449.075] (-1452.078) * (-1450.862) (-1448.864) (-1447.188) [-1446.970] -- 0:00:58
133000 -- (-1445.623) (-1446.315) [-1452.524] (-1448.603) * (-1449.147) (-1447.331) (-1448.273) [-1447.132] -- 0:00:58
133500 -- (-1448.954) (-1449.171) (-1448.000) [-1446.526] * (-1447.931) (-1446.945) (-1447.206) [-1446.293] -- 0:00:58
134000 -- (-1448.446) (-1449.188) [-1448.366] (-1445.862) * (-1446.792) [-1449.932] (-1446.447) (-1446.441) -- 0:00:58
134500 -- (-1451.152) (-1446.093) (-1446.470) [-1448.074] * (-1445.593) (-1448.801) (-1447.346) [-1446.394] -- 0:00:57
135000 -- (-1448.066) (-1446.085) [-1447.530] (-1453.040) * [-1445.593] (-1446.696) (-1451.324) (-1446.514) -- 0:00:57
Average standard deviation of split frequencies: 0.015598
135500 -- [-1451.002] (-1445.472) (-1445.091) (-1449.719) * (-1445.795) [-1446.438] (-1450.827) (-1447.945) -- 0:00:57
136000 -- [-1447.851] (-1445.409) (-1445.091) (-1447.384) * [-1446.666] (-1446.436) (-1452.973) (-1449.023) -- 0:00:57
136500 -- [-1445.359] (-1449.853) (-1447.984) (-1446.259) * (-1447.063) [-1447.817] (-1448.491) (-1447.698) -- 0:00:56
137000 -- (-1446.420) (-1446.058) (-1447.843) [-1445.438] * (-1447.970) [-1445.517] (-1451.774) (-1447.482) -- 0:00:56
137500 -- [-1445.634] (-1445.261) (-1450.816) (-1446.726) * [-1446.656] (-1447.561) (-1453.056) (-1449.946) -- 0:00:56
138000 -- (-1445.635) (-1445.797) [-1449.170] (-1447.493) * (-1450.500) [-1448.418] (-1447.133) (-1450.274) -- 0:00:56
138500 -- (-1449.171) (-1447.035) [-1448.523] (-1448.799) * (-1447.743) (-1446.623) (-1451.659) [-1448.327] -- 0:00:55
139000 -- (-1446.144) [-1445.396] (-1447.048) (-1448.477) * (-1451.464) [-1446.147] (-1445.817) (-1447.078) -- 0:00:55
139500 -- (-1446.787) (-1450.658) [-1447.106] (-1453.306) * (-1450.405) (-1446.638) (-1447.045) [-1446.913] -- 0:00:55
140000 -- (-1446.146) (-1449.860) (-1450.056) [-1447.882] * (-1450.122) (-1449.130) [-1446.855] (-1447.993) -- 0:00:55
Average standard deviation of split frequencies: 0.015080
140500 -- (-1448.435) (-1446.962) [-1446.410] (-1449.203) * (-1448.966) (-1453.476) [-1446.372] (-1447.892) -- 0:00:55
141000 -- (-1448.540) [-1445.850] (-1447.724) (-1455.301) * (-1447.694) (-1450.588) [-1446.695] (-1448.648) -- 0:00:54
141500 -- (-1448.021) (-1446.238) (-1447.623) [-1450.746] * [-1445.152] (-1449.718) (-1448.712) (-1448.080) -- 0:00:54
142000 -- (-1448.058) (-1446.446) (-1447.307) [-1450.427] * (-1446.194) (-1449.785) [-1449.886] (-1446.966) -- 0:00:54
142500 -- (-1449.898) [-1446.455] (-1447.249) (-1450.144) * (-1447.200) (-1449.618) [-1449.636] (-1450.377) -- 0:00:54
143000 -- (-1451.382) (-1446.653) (-1445.780) [-1451.244] * (-1447.335) (-1448.152) (-1450.325) [-1447.488] -- 0:00:53
143500 -- (-1449.447) (-1447.454) [-1447.018] (-1447.710) * (-1448.785) (-1446.801) [-1447.993] (-1449.943) -- 0:00:53
144000 -- (-1448.191) (-1446.474) (-1446.023) [-1446.517] * (-1448.288) [-1446.892] (-1447.218) (-1448.735) -- 0:00:53
144500 -- (-1449.819) [-1447.414] (-1447.660) (-1447.039) * (-1446.594) [-1447.986] (-1448.502) (-1449.127) -- 0:00:53
145000 -- [-1445.399] (-1447.381) (-1446.039) (-1448.689) * (-1448.770) (-1449.150) [-1446.648] (-1447.520) -- 0:00:53
Average standard deviation of split frequencies: 0.014709
145500 -- (-1445.398) (-1445.821) (-1446.005) [-1445.572] * (-1450.858) [-1449.995] (-1447.448) (-1451.748) -- 0:00:52
146000 -- [-1445.920] (-1446.106) (-1447.110) (-1447.822) * (-1447.643) [-1449.564] (-1448.911) (-1447.113) -- 0:00:52
146500 -- (-1447.779) [-1446.630] (-1448.453) (-1446.272) * (-1449.706) (-1450.114) [-1450.676] (-1449.779) -- 0:00:52
147000 -- (-1448.896) [-1448.045] (-1450.387) (-1445.826) * (-1450.496) [-1447.246] (-1449.202) (-1446.216) -- 0:00:52
147500 -- [-1446.756] (-1448.644) (-1449.503) (-1445.910) * (-1449.853) (-1447.626) [-1448.814] (-1448.869) -- 0:00:52
148000 -- [-1446.806] (-1449.122) (-1453.610) (-1447.385) * (-1448.410) (-1450.755) [-1448.471] (-1448.009) -- 0:00:57
148500 -- [-1449.789] (-1447.435) (-1446.885) (-1445.515) * (-1446.243) [-1448.507] (-1447.809) (-1449.072) -- 0:00:57
149000 -- (-1448.335) (-1446.961) [-1447.526] (-1445.801) * (-1449.642) (-1448.415) [-1445.999] (-1446.226) -- 0:00:57
149500 -- [-1446.725] (-1448.549) (-1448.840) (-1449.232) * [-1447.973] (-1445.785) (-1445.854) (-1446.967) -- 0:00:56
150000 -- (-1446.271) [-1445.423] (-1450.257) (-1447.332) * (-1448.769) [-1445.525] (-1448.728) (-1445.561) -- 0:00:56
Average standard deviation of split frequencies: 0.014949
150500 -- (-1446.589) [-1445.282] (-1451.221) (-1446.089) * (-1447.878) [-1447.316] (-1448.072) (-1453.709) -- 0:00:56
151000 -- (-1449.468) (-1446.930) [-1447.400] (-1446.049) * (-1447.570) (-1446.952) [-1448.822] (-1453.175) -- 0:00:56
151500 -- (-1448.539) (-1446.930) (-1448.094) [-1446.037] * [-1447.544] (-1446.231) (-1447.692) (-1447.428) -- 0:00:56
152000 -- (-1445.554) (-1447.773) (-1447.304) [-1446.164] * (-1447.060) (-1446.111) (-1447.762) [-1447.329] -- 0:00:55
152500 -- [-1445.435] (-1445.678) (-1447.133) (-1447.438) * [-1448.987] (-1445.989) (-1446.514) (-1450.440) -- 0:00:55
153000 -- (-1446.156) (-1445.776) (-1446.706) [-1447.887] * [-1453.037] (-1448.821) (-1447.259) (-1447.310) -- 0:00:55
153500 -- (-1446.388) [-1447.786] (-1452.700) (-1446.789) * (-1450.892) (-1449.869) [-1448.395] (-1447.090) -- 0:00:55
154000 -- (-1453.076) [-1449.079] (-1449.164) (-1447.273) * (-1447.962) (-1448.210) [-1446.674] (-1446.901) -- 0:00:54
154500 -- (-1448.702) (-1450.024) (-1447.193) [-1447.644] * [-1451.094] (-1449.258) (-1445.741) (-1447.337) -- 0:00:54
155000 -- (-1448.088) [-1454.081] (-1446.904) (-1447.658) * (-1454.571) (-1446.731) [-1445.605] (-1447.210) -- 0:00:54
Average standard deviation of split frequencies: 0.015109
155500 -- (-1447.778) (-1450.297) [-1446.476] (-1448.506) * (-1446.225) [-1447.637] (-1445.527) (-1451.505) -- 0:00:54
156000 -- (-1448.837) (-1448.234) [-1446.160] (-1448.078) * [-1445.734] (-1445.770) (-1450.400) (-1448.234) -- 0:00:54
156500 -- [-1446.298] (-1447.786) (-1446.788) (-1446.903) * (-1445.531) (-1449.005) (-1453.361) [-1446.375] -- 0:00:53
157000 -- [-1447.221] (-1445.985) (-1447.934) (-1447.151) * (-1446.744) [-1448.962] (-1452.986) (-1446.381) -- 0:00:53
157500 -- (-1446.339) (-1446.855) [-1445.947] (-1446.351) * (-1447.616) [-1448.050] (-1449.543) (-1446.848) -- 0:00:53
158000 -- (-1447.313) (-1449.378) (-1447.306) [-1446.469] * (-1446.388) (-1446.453) [-1448.757] (-1449.091) -- 0:00:53
158500 -- (-1445.815) [-1447.317] (-1449.496) (-1446.900) * (-1446.219) (-1446.669) (-1445.922) [-1446.974] -- 0:00:53
159000 -- (-1445.511) [-1447.588] (-1447.048) (-1447.206) * (-1445.788) (-1446.026) [-1446.210] (-1453.011) -- 0:00:52
159500 -- (-1446.356) (-1446.509) [-1447.290] (-1447.521) * (-1449.041) [-1445.999] (-1446.369) (-1447.424) -- 0:00:52
160000 -- (-1446.351) [-1447.091] (-1446.801) (-1448.474) * (-1449.034) [-1447.518] (-1445.851) (-1450.507) -- 0:00:52
Average standard deviation of split frequencies: 0.016396
160500 -- (-1446.384) [-1448.349] (-1450.288) (-1446.298) * (-1445.843) (-1446.918) (-1445.600) [-1447.467] -- 0:00:52
161000 -- (-1447.055) (-1445.525) [-1446.235] (-1446.529) * (-1446.976) (-1445.821) [-1446.211] (-1446.391) -- 0:00:52
161500 -- (-1450.113) [-1445.605] (-1447.264) (-1446.936) * [-1447.020] (-1449.879) (-1446.203) (-1447.948) -- 0:00:51
162000 -- [-1445.830] (-1451.061) (-1446.196) (-1454.656) * (-1446.155) [-1446.333] (-1445.125) (-1449.439) -- 0:00:51
162500 -- (-1446.431) (-1447.330) (-1447.794) [-1446.006] * (-1450.035) (-1448.921) [-1445.946] (-1445.792) -- 0:00:51
163000 -- (-1448.309) (-1447.998) (-1450.054) [-1447.500] * [-1445.712] (-1447.710) (-1450.052) (-1449.211) -- 0:00:51
163500 -- (-1448.945) (-1449.245) [-1447.157] (-1449.242) * (-1445.664) (-1446.422) (-1446.493) [-1448.146] -- 0:00:51
164000 -- (-1451.616) (-1447.902) (-1446.467) [-1450.113] * (-1445.831) [-1446.524] (-1445.429) (-1447.153) -- 0:00:56
164500 -- (-1453.722) [-1448.692] (-1446.430) (-1448.384) * (-1445.830) (-1447.243) (-1445.825) [-1449.439] -- 0:00:55
165000 -- (-1449.528) (-1448.052) [-1445.486] (-1448.760) * (-1447.268) [-1446.499] (-1448.957) (-1447.583) -- 0:00:55
Average standard deviation of split frequencies: 0.016881
165500 -- [-1446.266] (-1446.210) (-1445.641) (-1447.101) * (-1447.384) [-1449.922] (-1449.248) (-1452.030) -- 0:00:55
166000 -- (-1446.546) (-1446.144) [-1446.124] (-1448.652) * [-1448.224] (-1448.625) (-1448.518) (-1450.233) -- 0:00:55
166500 -- (-1452.143) [-1446.101] (-1446.224) (-1448.745) * (-1448.726) [-1450.536] (-1450.081) (-1446.458) -- 0:00:55
167000 -- (-1447.255) (-1447.858) (-1446.889) [-1446.545] * (-1447.042) (-1447.497) (-1451.943) [-1447.397] -- 0:00:54
167500 -- [-1448.512] (-1446.289) (-1447.842) (-1446.305) * (-1447.054) (-1449.706) (-1448.592) [-1448.970] -- 0:00:54
168000 -- [-1446.519] (-1447.773) (-1447.313) (-1449.964) * (-1447.082) (-1449.041) [-1446.969] (-1446.467) -- 0:00:54
168500 -- (-1447.596) (-1447.042) [-1446.824] (-1446.718) * (-1445.589) (-1449.147) [-1448.363] (-1449.358) -- 0:00:54
169000 -- [-1449.208] (-1448.447) (-1448.407) (-1447.706) * (-1446.628) [-1449.451] (-1448.718) (-1451.976) -- 0:00:54
169500 -- (-1446.368) (-1449.841) [-1446.609] (-1450.360) * (-1448.726) (-1447.635) [-1447.333] (-1449.244) -- 0:00:53
170000 -- (-1446.659) [-1450.002] (-1448.639) (-1449.673) * (-1447.680) (-1448.342) (-1445.836) [-1452.788] -- 0:00:53
Average standard deviation of split frequencies: 0.016880
170500 -- (-1446.874) (-1450.025) [-1448.821] (-1446.765) * (-1447.512) (-1447.157) (-1448.335) [-1449.464] -- 0:00:53
171000 -- (-1448.147) (-1445.881) (-1448.786) [-1446.085] * (-1453.446) (-1447.607) (-1448.105) [-1446.209] -- 0:00:53
171500 -- (-1447.818) [-1446.754] (-1456.679) (-1446.250) * (-1448.733) (-1447.226) [-1446.341] (-1447.988) -- 0:00:53
172000 -- (-1448.512) [-1446.617] (-1451.051) (-1449.673) * (-1447.439) (-1449.963) (-1446.038) [-1449.388] -- 0:00:52
172500 -- (-1448.435) (-1447.024) [-1450.405] (-1449.269) * [-1446.630] (-1450.138) (-1447.292) (-1449.942) -- 0:00:52
173000 -- (-1447.712) (-1446.396) (-1452.522) [-1446.193] * [-1446.485] (-1449.902) (-1445.428) (-1447.029) -- 0:00:52
173500 -- [-1448.533] (-1445.688) (-1452.188) (-1447.039) * (-1446.415) (-1446.093) [-1446.254] (-1448.334) -- 0:00:52
174000 -- (-1446.679) (-1446.691) (-1447.055) [-1449.095] * (-1447.078) (-1445.597) (-1448.266) [-1448.439] -- 0:00:52
174500 -- [-1447.368] (-1447.208) (-1448.657) (-1449.079) * [-1447.622] (-1445.923) (-1447.579) (-1446.719) -- 0:00:52
175000 -- [-1448.377] (-1446.983) (-1452.007) (-1448.774) * (-1447.777) (-1452.686) [-1449.891] (-1447.946) -- 0:00:51
Average standard deviation of split frequencies: 0.017331
175500 -- (-1446.880) [-1446.014] (-1446.929) (-1447.485) * (-1446.481) (-1452.740) (-1446.723) [-1447.152] -- 0:00:51
176000 -- [-1447.831] (-1445.927) (-1447.449) (-1448.390) * (-1446.748) (-1448.897) (-1449.280) [-1447.111] -- 0:00:51
176500 -- (-1447.482) (-1450.448) (-1454.291) [-1447.821] * (-1446.603) [-1445.630] (-1445.989) (-1449.201) -- 0:00:51
177000 -- [-1448.211] (-1447.723) (-1450.199) (-1447.768) * (-1450.127) [-1446.014] (-1447.233) (-1448.470) -- 0:00:51
177500 -- (-1450.794) (-1449.449) (-1447.103) [-1451.094] * [-1448.889] (-1446.520) (-1446.852) (-1447.189) -- 0:00:50
178000 -- (-1451.584) (-1448.965) (-1445.902) [-1447.368] * (-1446.531) (-1446.533) [-1445.178] (-1446.736) -- 0:00:50
178500 -- (-1447.600) (-1446.599) [-1447.303] (-1446.852) * (-1448.812) [-1445.836] (-1446.459) (-1446.160) -- 0:00:50
179000 -- (-1447.612) (-1446.651) [-1446.240] (-1450.160) * (-1449.384) (-1445.833) [-1446.897] (-1449.366) -- 0:00:50
179500 -- [-1447.764] (-1453.292) (-1448.088) (-1450.158) * [-1446.846] (-1445.664) (-1448.800) (-1446.173) -- 0:00:54
180000 -- (-1452.025) (-1446.455) (-1448.148) [-1449.020] * (-1447.734) (-1446.248) [-1446.246] (-1445.787) -- 0:00:54
Average standard deviation of split frequencies: 0.018265
180500 -- (-1450.244) (-1446.558) (-1446.070) [-1448.027] * (-1448.822) [-1445.828] (-1447.685) (-1445.497) -- 0:00:54
181000 -- (-1450.324) [-1446.889] (-1450.287) (-1449.360) * (-1450.619) (-1449.248) (-1446.033) [-1446.764] -- 0:00:54
181500 -- (-1450.621) [-1453.372] (-1448.467) (-1449.274) * [-1449.904] (-1448.955) (-1446.032) (-1449.050) -- 0:00:54
182000 -- (-1449.149) (-1448.499) [-1446.966] (-1449.499) * [-1448.038] (-1447.368) (-1445.528) (-1446.499) -- 0:00:53
182500 -- [-1447.540] (-1448.233) (-1446.242) (-1449.991) * [-1445.519] (-1446.554) (-1445.684) (-1447.088) -- 0:00:53
183000 -- (-1447.736) (-1447.758) (-1446.899) [-1448.324] * (-1445.664) (-1448.988) (-1446.882) [-1447.088] -- 0:00:53
183500 -- (-1447.751) [-1447.463] (-1446.432) (-1448.346) * (-1452.139) (-1447.590) (-1446.882) [-1448.273] -- 0:00:53
184000 -- [-1447.800] (-1448.427) (-1449.633) (-1447.309) * (-1447.315) [-1447.571] (-1446.287) (-1446.272) -- 0:00:53
184500 -- [-1449.541] (-1446.953) (-1452.515) (-1447.155) * [-1446.322] (-1449.161) (-1446.476) (-1448.579) -- 0:00:53
185000 -- (-1447.906) (-1446.185) [-1447.508] (-1447.313) * (-1446.508) (-1447.643) (-1447.397) [-1449.230] -- 0:00:52
Average standard deviation of split frequencies: 0.018188
185500 -- (-1456.782) [-1446.175] (-1445.806) (-1449.204) * [-1445.074] (-1447.594) (-1446.859) (-1449.926) -- 0:00:52
186000 -- [-1449.670] (-1447.091) (-1445.885) (-1448.687) * (-1450.246) [-1447.261] (-1450.842) (-1448.430) -- 0:00:52
186500 -- (-1446.963) (-1446.826) (-1449.100) [-1446.703] * (-1446.592) (-1446.932) (-1451.108) [-1446.863] -- 0:00:52
187000 -- (-1445.903) (-1447.633) (-1447.688) [-1446.050] * (-1446.918) (-1447.803) (-1450.243) [-1445.977] -- 0:00:52
187500 -- (-1446.586) [-1448.434] (-1447.926) (-1447.691) * (-1447.213) (-1445.235) (-1453.249) [-1448.020] -- 0:00:52
188000 -- (-1448.656) (-1445.740) [-1448.407] (-1451.499) * (-1446.470) (-1447.120) (-1448.597) [-1446.550] -- 0:00:51
188500 -- (-1447.523) (-1445.740) [-1449.657] (-1447.465) * (-1448.698) (-1449.955) (-1447.634) [-1447.797] -- 0:00:51
189000 -- (-1446.660) (-1447.751) [-1446.582] (-1446.117) * (-1447.921) (-1447.372) [-1446.508] (-1448.586) -- 0:00:51
189500 -- [-1447.074] (-1446.573) (-1445.965) (-1445.428) * (-1446.916) (-1447.558) [-1448.930] (-1447.785) -- 0:00:51
190000 -- (-1446.746) [-1447.049] (-1447.288) (-1445.656) * (-1447.293) (-1447.467) [-1449.319] (-1449.904) -- 0:00:51
Average standard deviation of split frequencies: 0.019779
190500 -- [-1447.737] (-1446.797) (-1447.741) (-1446.782) * [-1447.207] (-1445.566) (-1445.834) (-1448.835) -- 0:00:50
191000 -- [-1446.872] (-1445.402) (-1448.385) (-1448.120) * (-1450.636) (-1450.014) (-1446.787) [-1447.243] -- 0:00:50
191500 -- (-1447.315) (-1452.149) [-1449.854] (-1445.680) * (-1450.072) [-1447.217] (-1448.454) (-1447.700) -- 0:00:50
192000 -- (-1447.923) (-1448.007) (-1447.851) [-1446.313] * (-1446.361) (-1446.377) (-1450.385) [-1447.840] -- 0:00:50
192500 -- (-1451.446) [-1447.127] (-1447.405) (-1447.583) * (-1448.311) (-1446.110) (-1449.457) [-1447.299] -- 0:00:50
193000 -- (-1450.586) [-1445.705] (-1447.721) (-1446.988) * (-1450.656) (-1447.638) [-1449.033] (-1447.101) -- 0:00:50
193500 -- (-1449.673) (-1448.301) [-1448.686] (-1447.125) * [-1450.162] (-1447.165) (-1448.885) (-1447.103) -- 0:00:50
194000 -- (-1446.580) (-1445.778) (-1448.459) [-1448.461] * (-1448.495) (-1445.837) (-1446.059) [-1449.773] -- 0:00:49
194500 -- (-1446.076) (-1446.545) (-1446.603) [-1450.085] * (-1446.467) (-1447.076) (-1446.514) [-1446.156] -- 0:00:49
195000 -- [-1446.605] (-1450.347) (-1447.348) (-1447.802) * (-1447.431) [-1447.646] (-1447.684) (-1445.839) -- 0:00:49
Average standard deviation of split frequencies: 0.019107
195500 -- (-1450.754) (-1449.064) [-1447.848] (-1446.451) * (-1448.343) (-1447.835) (-1446.818) [-1448.466] -- 0:00:53
196000 -- (-1451.136) (-1446.999) [-1446.029] (-1446.933) * [-1446.140] (-1449.073) (-1446.979) (-1446.591) -- 0:00:53
196500 -- (-1448.143) (-1445.907) [-1446.526] (-1446.480) * [-1446.161] (-1448.979) (-1446.980) (-1446.098) -- 0:00:53
197000 -- (-1446.646) (-1447.214) (-1447.705) [-1447.316] * (-1446.121) [-1446.523] (-1448.543) (-1447.414) -- 0:00:52
197500 -- (-1448.772) [-1447.241] (-1448.151) (-1446.218) * [-1449.028] (-1446.820) (-1448.077) (-1445.233) -- 0:00:52
198000 -- (-1448.918) (-1447.686) (-1450.510) [-1450.422] * (-1446.926) (-1447.558) [-1449.090] (-1450.130) -- 0:00:52
198500 -- (-1448.016) (-1447.696) [-1448.566] (-1449.961) * [-1446.076] (-1447.258) (-1446.422) (-1449.460) -- 0:00:52
199000 -- (-1450.001) (-1447.179) (-1448.985) [-1449.478] * (-1445.468) (-1449.628) [-1446.422] (-1453.347) -- 0:00:52
199500 -- (-1452.106) (-1445.983) (-1448.539) [-1448.467] * (-1445.505) [-1451.818] (-1447.422) (-1452.671) -- 0:00:52
200000 -- (-1447.054) [-1445.485] (-1447.802) (-1450.336) * [-1448.905] (-1445.675) (-1448.104) (-1450.810) -- 0:00:51
Average standard deviation of split frequencies: 0.016183
200500 -- (-1448.226) [-1448.023] (-1446.341) (-1447.696) * (-1446.334) [-1446.054] (-1448.334) (-1448.701) -- 0:00:51
201000 -- (-1451.220) [-1446.956] (-1446.418) (-1448.340) * (-1450.227) (-1445.745) [-1448.160] (-1447.979) -- 0:00:51
201500 -- (-1448.905) (-1446.190) (-1446.274) [-1445.830] * (-1447.747) [-1445.891] (-1448.809) (-1447.725) -- 0:00:51
202000 -- (-1447.344) (-1449.104) (-1445.652) [-1446.624] * (-1449.950) [-1447.274] (-1449.113) (-1446.029) -- 0:00:51
202500 -- [-1446.997] (-1446.497) (-1447.434) (-1446.299) * (-1447.292) [-1446.425] (-1447.058) (-1445.521) -- 0:00:51
203000 -- (-1447.411) (-1446.099) (-1445.415) [-1448.267] * (-1449.330) [-1446.560] (-1449.461) (-1445.445) -- 0:00:51
203500 -- (-1447.441) (-1446.419) (-1445.628) [-1448.903] * (-1448.976) (-1446.428) [-1448.827] (-1445.375) -- 0:00:50
204000 -- (-1447.869) [-1447.408] (-1447.359) (-1450.594) * (-1447.531) [-1445.969] (-1450.989) (-1445.375) -- 0:00:50
204500 -- (-1450.204) (-1448.703) (-1448.047) [-1445.905] * [-1450.347] (-1446.005) (-1448.676) (-1447.267) -- 0:00:50
205000 -- [-1450.226] (-1447.575) (-1446.408) (-1447.147) * (-1449.372) [-1445.187] (-1446.078) (-1445.737) -- 0:00:50
Average standard deviation of split frequencies: 0.015764
205500 -- (-1447.688) (-1453.585) [-1447.402] (-1454.295) * (-1447.903) [-1445.754] (-1446.017) (-1446.777) -- 0:00:50
206000 -- (-1447.402) [-1449.049] (-1448.588) (-1455.802) * (-1447.134) [-1446.707] (-1445.629) (-1453.652) -- 0:00:50
206500 -- [-1446.793] (-1449.854) (-1451.133) (-1448.673) * (-1446.456) (-1448.072) [-1445.899] (-1449.411) -- 0:00:49
207000 -- (-1446.022) [-1448.454] (-1446.578) (-1448.254) * (-1447.927) (-1449.796) [-1446.373] (-1446.029) -- 0:00:49
207500 -- (-1448.948) [-1449.614] (-1447.436) (-1449.224) * (-1447.602) [-1450.206] (-1447.898) (-1447.486) -- 0:00:49
208000 -- (-1446.070) (-1450.530) (-1446.636) [-1451.323] * (-1447.726) (-1446.685) [-1445.972] (-1447.331) -- 0:00:49
208500 -- (-1446.799) [-1448.257] (-1448.883) (-1448.921) * (-1448.165) (-1446.071) [-1446.010] (-1448.385) -- 0:00:49
209000 -- (-1445.572) (-1448.573) (-1448.080) [-1446.926] * (-1447.795) (-1446.204) [-1446.039] (-1447.499) -- 0:00:49
209500 -- (-1446.729) (-1447.076) [-1447.287] (-1447.196) * (-1447.089) [-1446.320] (-1449.295) (-1446.824) -- 0:00:49
210000 -- (-1446.484) (-1449.510) [-1446.949] (-1447.196) * (-1446.939) [-1447.252] (-1446.152) (-1446.894) -- 0:00:48
Average standard deviation of split frequencies: 0.014048
210500 -- (-1449.503) (-1450.077) [-1448.329] (-1445.494) * (-1447.048) (-1446.608) (-1448.754) [-1446.933] -- 0:00:52
211000 -- (-1450.878) [-1447.291] (-1446.381) (-1446.446) * (-1446.736) (-1446.609) [-1451.703] (-1449.282) -- 0:00:52
211500 -- (-1449.485) (-1449.769) (-1450.289) [-1447.504] * [-1449.083] (-1449.439) (-1446.716) (-1446.154) -- 0:00:52
212000 -- (-1447.274) (-1451.880) (-1446.270) [-1446.281] * (-1447.541) [-1447.228] (-1447.859) (-1447.691) -- 0:00:52
212500 -- (-1446.568) (-1454.155) [-1448.011] (-1449.882) * (-1446.931) (-1446.007) [-1445.753] (-1446.480) -- 0:00:51
213000 -- (-1449.241) [-1447.855] (-1447.909) (-1445.384) * (-1450.956) (-1445.055) (-1449.453) [-1446.773] -- 0:00:51
213500 -- (-1448.334) (-1447.258) (-1446.072) [-1446.276] * [-1450.421] (-1445.455) (-1447.232) (-1445.822) -- 0:00:51
214000 -- (-1447.372) (-1449.659) (-1448.363) [-1448.250] * [-1447.312] (-1446.179) (-1448.932) (-1445.949) -- 0:00:51
214500 -- (-1448.212) [-1450.348] (-1445.104) (-1446.010) * (-1450.229) (-1449.003) [-1446.695] (-1446.385) -- 0:00:51
215000 -- (-1449.305) (-1446.107) (-1446.471) [-1446.239] * (-1453.326) [-1446.581] (-1447.424) (-1446.433) -- 0:00:51
Average standard deviation of split frequencies: 0.014378
215500 -- (-1447.122) (-1446.941) [-1446.342] (-1448.988) * (-1450.520) (-1446.273) [-1446.554] (-1447.246) -- 0:00:50
216000 -- (-1447.275) (-1446.847) [-1446.093] (-1449.426) * (-1449.172) (-1449.868) [-1445.844] (-1446.025) -- 0:00:50
216500 -- (-1447.432) [-1447.458] (-1450.676) (-1448.460) * (-1446.247) [-1454.940] (-1446.892) (-1448.946) -- 0:00:50
217000 -- (-1448.447) (-1446.547) (-1457.302) [-1447.793] * (-1447.947) (-1451.584) [-1447.954] (-1448.093) -- 0:00:50
217500 -- (-1447.821) (-1447.330) [-1447.857] (-1449.714) * (-1448.301) (-1448.565) [-1446.389] (-1449.806) -- 0:00:50
218000 -- [-1447.557] (-1446.305) (-1447.633) (-1448.865) * (-1448.870) (-1445.842) (-1449.115) [-1452.766] -- 0:00:50
218500 -- (-1448.436) (-1447.018) (-1451.030) [-1446.410] * [-1448.187] (-1446.039) (-1446.591) (-1445.891) -- 0:00:50
219000 -- (-1452.453) (-1446.145) (-1449.671) [-1445.323] * [-1446.717] (-1445.230) (-1450.296) (-1446.260) -- 0:00:49
219500 -- [-1447.601] (-1451.047) (-1447.072) (-1446.377) * (-1446.180) (-1446.324) (-1451.033) [-1446.953] -- 0:00:49
220000 -- (-1445.828) (-1451.123) [-1449.079] (-1446.473) * (-1445.995) (-1446.834) (-1449.635) [-1446.141] -- 0:00:49
Average standard deviation of split frequencies: 0.015457
220500 -- (-1445.623) [-1447.605] (-1447.579) (-1445.578) * (-1447.881) (-1447.985) (-1451.342) [-1447.276] -- 0:00:49
221000 -- (-1447.316) (-1451.518) (-1445.935) [-1447.613] * (-1446.994) [-1448.692] (-1449.587) (-1449.515) -- 0:00:49
221500 -- (-1446.299) [-1449.814] (-1447.418) (-1446.399) * (-1447.770) (-1448.852) [-1448.921] (-1449.891) -- 0:00:49
222000 -- (-1446.102) [-1446.544] (-1446.410) (-1445.668) * (-1449.180) [-1448.662] (-1448.671) (-1447.491) -- 0:00:49
222500 -- (-1446.156) [-1449.572] (-1446.143) (-1447.409) * (-1447.333) (-1447.270) (-1449.004) [-1447.864] -- 0:00:48
223000 -- (-1446.179) [-1446.121] (-1445.949) (-1447.056) * (-1447.072) (-1445.910) [-1446.333] (-1447.244) -- 0:00:48
223500 -- (-1450.707) (-1445.289) (-1446.306) [-1447.282] * (-1448.145) (-1447.147) (-1447.262) [-1447.887] -- 0:00:48
224000 -- (-1446.278) (-1448.996) [-1446.306] (-1445.362) * (-1446.472) [-1446.684] (-1447.804) (-1446.226) -- 0:00:48
224500 -- [-1446.387] (-1451.238) (-1446.301) (-1445.337) * [-1447.018] (-1447.015) (-1445.281) (-1445.337) -- 0:00:48
225000 -- (-1445.975) (-1451.001) [-1449.041] (-1447.640) * (-1446.199) (-1447.542) (-1450.487) [-1445.148] -- 0:00:48
Average standard deviation of split frequencies: 0.016319
225500 -- (-1447.879) (-1451.195) (-1447.795) [-1447.187] * (-1450.515) [-1445.937] (-1449.660) (-1446.529) -- 0:00:48
226000 -- (-1450.255) [-1446.132] (-1446.749) (-1449.236) * [-1451.732] (-1445.554) (-1451.602) (-1446.537) -- 0:00:47
226500 -- (-1447.617) (-1447.015) [-1446.640] (-1450.613) * (-1445.951) (-1446.713) [-1445.797] (-1451.457) -- 0:00:51
227000 -- [-1447.511] (-1447.202) (-1445.583) (-1454.573) * [-1446.102] (-1449.028) (-1451.185) (-1451.700) -- 0:00:51
227500 -- (-1449.123) (-1449.215) [-1447.721] (-1451.348) * (-1447.234) [-1445.721] (-1451.497) (-1450.916) -- 0:00:50
228000 -- [-1445.797] (-1449.965) (-1449.136) (-1451.135) * (-1449.452) (-1446.501) (-1449.356) [-1448.954] -- 0:00:50
228500 -- [-1446.701] (-1451.642) (-1446.780) (-1449.928) * (-1446.121) (-1451.242) (-1447.240) [-1448.561] -- 0:00:50
229000 -- [-1448.063] (-1451.252) (-1447.624) (-1447.970) * (-1449.686) (-1448.338) (-1448.261) [-1445.800] -- 0:00:50
229500 -- [-1446.772] (-1447.982) (-1451.168) (-1448.638) * (-1449.755) (-1447.774) (-1450.077) [-1445.663] -- 0:00:50
230000 -- [-1446.396] (-1448.906) (-1448.656) (-1447.679) * (-1453.574) (-1446.793) (-1449.278) [-1445.716] -- 0:00:50
Average standard deviation of split frequencies: 0.018961
230500 -- (-1448.215) (-1446.769) (-1447.517) [-1445.813] * (-1445.832) (-1446.110) [-1449.006] (-1449.140) -- 0:00:50
231000 -- [-1451.107] (-1446.763) (-1448.375) (-1446.088) * (-1447.568) [-1446.229] (-1447.335) (-1449.168) -- 0:00:49
231500 -- (-1451.068) (-1449.716) [-1449.191] (-1449.551) * (-1448.432) (-1446.229) [-1447.395] (-1445.484) -- 0:00:49
232000 -- (-1447.062) (-1447.131) (-1449.141) [-1448.701] * (-1446.556) (-1445.372) (-1449.905) [-1445.516] -- 0:00:49
232500 -- (-1446.630) [-1449.771] (-1450.751) (-1447.256) * (-1449.892) [-1445.810] (-1447.741) (-1447.483) -- 0:00:49
233000 -- (-1446.101) [-1449.739] (-1447.889) (-1447.941) * [-1447.996] (-1445.476) (-1450.763) (-1447.874) -- 0:00:49
233500 -- (-1446.150) (-1451.093) [-1448.065] (-1450.828) * (-1447.383) (-1446.297) [-1446.611] (-1448.343) -- 0:00:49
234000 -- [-1446.452] (-1450.617) (-1452.262) (-1450.008) * (-1448.203) (-1446.297) [-1447.592] (-1448.527) -- 0:00:49
234500 -- (-1448.318) [-1447.631] (-1448.432) (-1451.206) * (-1446.006) [-1445.587] (-1448.504) (-1449.860) -- 0:00:48
235000 -- (-1447.338) (-1445.954) [-1450.956] (-1451.829) * [-1447.376] (-1448.833) (-1448.164) (-1448.343) -- 0:00:48
Average standard deviation of split frequencies: 0.019152
235500 -- (-1448.600) (-1448.811) (-1450.308) [-1450.345] * (-1447.254) (-1450.292) [-1448.303] (-1448.403) -- 0:00:48
236000 -- (-1446.832) [-1447.803] (-1448.929) (-1446.056) * (-1450.575) (-1446.616) [-1447.159] (-1447.660) -- 0:00:48
236500 -- [-1448.859] (-1448.211) (-1451.278) (-1448.234) * [-1448.471] (-1446.810) (-1446.829) (-1452.081) -- 0:00:48
237000 -- (-1449.404) (-1453.800) [-1446.019] (-1448.514) * (-1448.472) [-1448.070] (-1446.501) (-1448.317) -- 0:00:48
237500 -- (-1445.569) (-1451.335) [-1446.336] (-1450.282) * (-1446.402) [-1449.019] (-1448.720) (-1445.624) -- 0:00:48
238000 -- (-1445.768) [-1449.462] (-1446.972) (-1451.933) * (-1446.891) [-1446.697] (-1452.228) (-1445.722) -- 0:00:48
238500 -- [-1446.100] (-1451.474) (-1446.998) (-1453.809) * (-1448.010) [-1446.867] (-1456.167) (-1445.319) -- 0:00:47
239000 -- [-1447.059] (-1446.881) (-1446.143) (-1451.409) * (-1447.419) (-1447.751) (-1448.725) [-1445.286] -- 0:00:47
239500 -- [-1446.628] (-1446.782) (-1446.416) (-1451.388) * (-1447.324) (-1448.275) [-1449.776] (-1447.421) -- 0:00:47
240000 -- [-1448.383] (-1450.550) (-1447.671) (-1446.857) * [-1447.082] (-1445.634) (-1448.525) (-1447.514) -- 0:00:47
Average standard deviation of split frequencies: 0.017629
240500 -- (-1447.729) [-1448.527] (-1448.731) (-1448.866) * (-1446.977) (-1445.849) [-1451.045] (-1447.657) -- 0:00:47
241000 -- [-1447.068] (-1451.075) (-1447.819) (-1448.276) * (-1447.453) (-1447.077) (-1452.325) [-1448.121] -- 0:00:47
241500 -- (-1448.476) (-1446.832) [-1450.217] (-1446.940) * (-1447.146) (-1452.449) (-1448.488) [-1449.824] -- 0:00:47
242000 -- [-1448.250] (-1446.520) (-1449.446) (-1448.875) * (-1450.130) (-1448.080) [-1446.257] (-1448.618) -- 0:00:46
242500 -- (-1445.869) [-1446.366] (-1449.110) (-1445.882) * [-1447.049] (-1448.910) (-1446.663) (-1445.466) -- 0:00:49
243000 -- [-1446.684] (-1450.857) (-1448.419) (-1445.867) * (-1445.595) (-1448.292) (-1447.129) [-1445.524] -- 0:00:49
243500 -- (-1446.493) (-1449.099) [-1448.673] (-1445.768) * (-1446.509) (-1445.751) (-1447.837) [-1449.418] -- 0:00:49
244000 -- (-1445.747) [-1449.961] (-1451.522) (-1447.006) * (-1446.759) [-1446.221] (-1447.857) (-1448.593) -- 0:00:49
244500 -- (-1445.911) (-1447.247) (-1449.000) [-1449.375] * (-1445.445) [-1448.452] (-1447.188) (-1449.294) -- 0:00:49
245000 -- (-1450.643) [-1446.399] (-1451.462) (-1452.355) * [-1447.352] (-1447.084) (-1446.150) (-1447.992) -- 0:00:49
Average standard deviation of split frequencies: 0.015650
245500 -- (-1445.962) (-1447.061) (-1449.770) [-1451.454] * (-1445.651) [-1447.831] (-1445.994) (-1448.082) -- 0:00:49
246000 -- [-1446.728] (-1448.408) (-1447.152) (-1449.809) * (-1447.724) (-1450.168) (-1446.299) [-1450.747] -- 0:00:49
246500 -- (-1447.302) [-1447.812] (-1446.869) (-1446.228) * (-1445.948) (-1446.277) [-1447.316] (-1447.880) -- 0:00:48
247000 -- (-1446.685) (-1448.139) [-1445.320] (-1446.301) * (-1447.214) [-1448.285] (-1447.374) (-1451.083) -- 0:00:48
247500 -- [-1447.019] (-1447.146) (-1446.912) (-1446.737) * [-1448.007] (-1447.355) (-1448.146) (-1450.170) -- 0:00:48
248000 -- (-1448.541) (-1447.301) [-1446.394] (-1450.349) * (-1447.803) (-1446.969) [-1447.176] (-1451.202) -- 0:00:48
248500 -- (-1449.100) (-1446.952) [-1445.744] (-1448.606) * (-1448.034) [-1447.370] (-1447.923) (-1447.142) -- 0:00:48
249000 -- [-1447.648] (-1448.856) (-1446.928) (-1450.106) * [-1450.073] (-1447.652) (-1447.763) (-1447.142) -- 0:00:48
249500 -- (-1446.945) [-1447.687] (-1446.129) (-1451.450) * (-1450.951) [-1447.182] (-1447.768) (-1446.261) -- 0:00:48
250000 -- (-1448.921) (-1448.021) (-1448.341) [-1451.526] * (-1447.147) [-1445.406] (-1447.867) (-1451.326) -- 0:00:48
Average standard deviation of split frequencies: 0.015881
250500 -- (-1448.557) [-1448.442] (-1446.840) (-1449.504) * (-1447.918) (-1446.030) (-1449.172) [-1446.417] -- 0:00:47
251000 -- (-1454.518) [-1448.879] (-1446.515) (-1449.032) * (-1451.115) [-1445.876] (-1446.097) (-1447.542) -- 0:00:47
251500 -- (-1451.039) (-1445.887) [-1445.973] (-1447.718) * (-1450.940) (-1448.067) [-1446.469] (-1445.759) -- 0:00:47
252000 -- (-1451.142) (-1447.006) (-1447.535) [-1448.082] * [-1447.795] (-1447.777) (-1448.905) (-1446.874) -- 0:00:47
252500 -- [-1447.216] (-1445.603) (-1448.019) (-1449.343) * (-1447.943) (-1447.880) (-1449.196) [-1451.958] -- 0:00:47
253000 -- [-1451.003] (-1446.898) (-1447.110) (-1449.416) * (-1449.116) [-1446.343] (-1447.532) (-1447.910) -- 0:00:47
253500 -- (-1450.680) [-1447.480] (-1448.521) (-1446.837) * [-1448.260] (-1446.370) (-1446.762) (-1446.116) -- 0:00:47
254000 -- (-1449.800) (-1449.077) [-1446.129] (-1445.501) * (-1447.630) (-1447.588) (-1446.007) [-1446.395] -- 0:00:46
254500 -- [-1451.964] (-1447.705) (-1447.304) (-1445.487) * [-1447.885] (-1447.174) (-1448.139) (-1446.647) -- 0:00:46
255000 -- (-1452.352) (-1448.713) [-1446.223] (-1445.467) * [-1448.414] (-1447.247) (-1452.522) (-1450.563) -- 0:00:46
Average standard deviation of split frequencies: 0.016088
255500 -- (-1446.518) (-1451.725) (-1445.904) [-1446.318] * [-1447.311] (-1449.135) (-1450.962) (-1448.441) -- 0:00:46
256000 -- (-1447.630) (-1449.736) (-1446.743) [-1446.314] * (-1445.665) [-1449.727] (-1447.561) (-1447.481) -- 0:00:46
256500 -- (-1447.202) (-1448.609) [-1448.155] (-1447.297) * (-1446.008) (-1449.325) (-1446.213) [-1446.658] -- 0:00:46
257000 -- (-1446.211) (-1449.948) [-1447.269] (-1447.787) * [-1450.412] (-1447.865) (-1446.934) (-1448.528) -- 0:00:46
257500 -- [-1447.071] (-1449.347) (-1446.885) (-1450.684) * [-1446.533] (-1448.906) (-1448.178) (-1455.500) -- 0:00:46
258000 -- (-1451.726) (-1451.656) [-1446.271] (-1446.012) * [-1445.118] (-1449.099) (-1447.580) (-1447.046) -- 0:00:48
258500 -- (-1452.338) (-1450.292) (-1446.363) [-1447.738] * (-1446.983) [-1448.069] (-1449.728) (-1447.473) -- 0:00:48
259000 -- (-1449.678) (-1448.843) [-1447.856] (-1445.762) * (-1446.525) (-1450.730) (-1452.023) [-1445.327] -- 0:00:48
259500 -- (-1450.181) (-1446.919) [-1447.002] (-1446.537) * [-1450.878] (-1446.966) (-1447.401) (-1452.952) -- 0:00:48
260000 -- [-1447.598] (-1446.103) (-1446.271) (-1446.474) * [-1452.754] (-1449.223) (-1447.117) (-1446.827) -- 0:00:48
Average standard deviation of split frequencies: 0.018185
260500 -- (-1447.175) [-1446.956] (-1448.879) (-1448.850) * (-1449.404) (-1447.876) (-1446.671) [-1445.685] -- 0:00:48
261000 -- (-1448.423) (-1446.099) (-1450.269) [-1446.922] * (-1450.653) (-1446.769) [-1448.017] (-1445.674) -- 0:00:48
261500 -- (-1449.034) [-1449.747] (-1449.290) (-1446.776) * (-1450.128) (-1446.461) (-1448.259) [-1446.634] -- 0:00:48
262000 -- (-1450.488) (-1448.246) (-1449.450) [-1448.967] * [-1447.324] (-1446.920) (-1446.183) (-1448.287) -- 0:00:47
262500 -- (-1446.802) (-1447.595) [-1450.850] (-1447.922) * (-1451.424) (-1446.359) (-1447.532) [-1448.392] -- 0:00:47
263000 -- [-1446.505] (-1446.746) (-1447.116) (-1449.115) * (-1450.814) [-1448.430] (-1447.708) (-1446.067) -- 0:00:47
263500 -- [-1446.747] (-1447.149) (-1445.836) (-1446.279) * (-1449.357) (-1446.357) (-1449.008) [-1446.020] -- 0:00:47
264000 -- (-1446.088) (-1448.949) (-1446.641) [-1451.366] * (-1448.297) [-1445.575] (-1447.596) (-1454.031) -- 0:00:47
264500 -- (-1447.396) (-1445.939) [-1447.999] (-1447.141) * (-1452.781) (-1448.687) [-1447.821] (-1447.107) -- 0:00:47
265000 -- (-1448.223) [-1446.779] (-1450.839) (-1447.215) * [-1445.965] (-1446.712) (-1448.216) (-1446.413) -- 0:00:47
Average standard deviation of split frequencies: 0.017256
265500 -- [-1446.020] (-1449.029) (-1448.564) (-1445.306) * (-1446.290) (-1446.710) (-1446.383) [-1445.632] -- 0:00:47
266000 -- [-1447.618] (-1447.852) (-1451.095) (-1448.582) * (-1447.193) (-1445.190) (-1448.061) [-1445.674] -- 0:00:46
266500 -- (-1448.580) (-1449.343) (-1448.492) [-1447.313] * (-1447.063) (-1447.798) (-1446.104) [-1445.518] -- 0:00:46
267000 -- (-1448.070) [-1450.083] (-1448.081) (-1446.260) * (-1448.795) (-1445.827) [-1445.295] (-1445.322) -- 0:00:46
267500 -- [-1445.959] (-1447.020) (-1450.547) (-1447.064) * (-1446.947) (-1446.692) (-1449.672) [-1445.736] -- 0:00:46
268000 -- (-1446.896) (-1449.525) [-1447.116] (-1450.624) * (-1451.622) (-1447.375) (-1447.775) [-1446.974] -- 0:00:46
268500 -- [-1450.484] (-1447.111) (-1451.037) (-1449.013) * (-1445.653) (-1448.935) (-1449.044) [-1446.831] -- 0:00:46
269000 -- (-1446.569) (-1446.997) (-1448.521) [-1445.919] * [-1445.303] (-1447.551) (-1449.909) (-1445.429) -- 0:00:46
269500 -- [-1448.685] (-1449.857) (-1448.316) (-1448.406) * [-1447.077] (-1445.268) (-1449.797) (-1446.442) -- 0:00:46
270000 -- (-1447.768) (-1448.143) [-1448.066] (-1446.700) * (-1446.567) (-1445.637) [-1447.117] (-1446.574) -- 0:00:45
Average standard deviation of split frequencies: 0.017900
270500 -- (-1447.528) [-1448.454] (-1448.135) (-1448.712) * [-1446.473] (-1454.328) (-1449.516) (-1446.575) -- 0:00:45
271000 -- (-1447.179) [-1447.233] (-1447.545) (-1448.712) * [-1445.927] (-1445.891) (-1449.814) (-1446.522) -- 0:00:45
271500 -- (-1449.993) [-1447.243] (-1447.741) (-1447.675) * (-1445.319) [-1447.179] (-1449.380) (-1450.181) -- 0:00:45
272000 -- (-1446.798) (-1447.706) [-1449.694] (-1448.230) * [-1448.795] (-1446.312) (-1449.575) (-1448.180) -- 0:00:45
272500 -- (-1447.408) (-1447.474) [-1446.704] (-1450.771) * (-1446.563) (-1449.163) [-1445.965] (-1445.786) -- 0:00:45
273000 -- (-1446.988) (-1447.913) [-1452.993] (-1450.819) * [-1448.000] (-1447.140) (-1447.278) (-1445.826) -- 0:00:45
273500 -- [-1447.663] (-1446.573) (-1450.188) (-1445.316) * [-1448.054] (-1446.823) (-1447.288) (-1445.886) -- 0:00:45
274000 -- (-1447.977) [-1445.441] (-1447.345) (-1446.253) * [-1452.546] (-1447.628) (-1449.406) (-1445.944) -- 0:00:47
274500 -- (-1454.568) [-1445.982] (-1445.457) (-1447.909) * (-1446.863) (-1447.826) [-1449.379] (-1447.153) -- 0:00:47
275000 -- (-1445.098) (-1447.683) [-1446.427] (-1445.080) * (-1446.508) [-1447.148] (-1447.357) (-1450.395) -- 0:00:47
Average standard deviation of split frequencies: 0.017482
275500 -- (-1446.990) [-1447.203] (-1446.598) (-1448.167) * (-1449.178) (-1449.886) [-1447.742] (-1446.152) -- 0:00:47
276000 -- (-1449.625) (-1448.268) (-1446.542) [-1446.345] * [-1455.278] (-1445.988) (-1449.450) (-1445.823) -- 0:00:47
276500 -- (-1451.090) (-1449.023) (-1449.082) [-1449.165] * [-1450.720] (-1448.199) (-1449.141) (-1447.171) -- 0:00:47
277000 -- (-1453.828) [-1446.322] (-1445.832) (-1453.600) * [-1447.199] (-1447.637) (-1450.607) (-1448.900) -- 0:00:46
277500 -- [-1445.653] (-1447.364) (-1448.442) (-1450.078) * (-1447.742) (-1449.425) [-1447.797] (-1446.370) -- 0:00:46
278000 -- (-1451.726) (-1446.502) [-1449.467] (-1449.201) * (-1446.479) [-1447.298] (-1448.502) (-1447.692) -- 0:00:46
278500 -- (-1446.300) [-1449.224] (-1450.208) (-1448.805) * (-1447.156) (-1449.595) [-1447.618] (-1446.197) -- 0:00:46
279000 -- (-1449.595) (-1451.292) [-1449.041] (-1450.028) * [-1447.359] (-1453.767) (-1446.866) (-1445.506) -- 0:00:46
279500 -- [-1445.245] (-1451.122) (-1447.373) (-1447.714) * (-1447.920) (-1451.631) (-1448.592) [-1445.710] -- 0:00:46
280000 -- (-1448.280) [-1448.764] (-1446.301) (-1449.898) * (-1448.654) (-1450.887) (-1446.424) [-1445.173] -- 0:00:46
Average standard deviation of split frequencies: 0.017636
280500 -- (-1446.983) (-1448.012) (-1448.869) [-1450.825] * (-1448.797) (-1447.260) (-1449.425) [-1445.145] -- 0:00:46
281000 -- (-1448.591) (-1446.243) (-1449.090) [-1448.218] * (-1446.726) (-1449.758) (-1447.992) [-1446.087] -- 0:00:46
281500 -- (-1448.398) [-1445.932] (-1446.710) (-1447.251) * (-1447.147) [-1448.536] (-1448.811) (-1446.767) -- 0:00:45
282000 -- (-1452.365) (-1453.253) (-1450.953) [-1446.537] * (-1450.398) [-1445.871] (-1448.785) (-1448.996) -- 0:00:45
282500 -- (-1447.084) (-1447.776) [-1452.964] (-1445.651) * (-1446.915) (-1445.621) (-1447.573) [-1445.866] -- 0:00:45
283000 -- [-1447.526] (-1448.481) (-1448.986) (-1449.083) * (-1447.456) [-1445.830] (-1451.364) (-1446.411) -- 0:00:45
283500 -- [-1447.360] (-1446.301) (-1449.243) (-1447.509) * (-1446.502) (-1448.607) [-1447.216] (-1445.622) -- 0:00:45
284000 -- (-1450.003) (-1445.917) (-1449.002) [-1446.235] * (-1449.172) (-1447.142) [-1446.552] (-1446.108) -- 0:00:45
284500 -- [-1445.626] (-1447.323) (-1448.777) (-1446.031) * (-1446.848) (-1446.613) (-1445.245) [-1446.336] -- 0:00:45
285000 -- (-1445.672) (-1448.543) (-1447.550) [-1446.118] * (-1446.207) [-1447.145] (-1445.946) (-1447.164) -- 0:00:45
Average standard deviation of split frequencies: 0.016941
285500 -- (-1447.175) (-1448.873) [-1448.848] (-1446.378) * (-1446.425) (-1445.477) (-1447.140) [-1447.516] -- 0:00:45
286000 -- (-1447.032) (-1446.522) (-1452.972) [-1447.141] * (-1446.916) (-1446.901) (-1450.304) [-1448.978] -- 0:00:44
286500 -- [-1446.786] (-1450.287) (-1446.536) (-1445.788) * [-1447.328] (-1448.257) (-1449.948) (-1446.361) -- 0:00:44
287000 -- (-1447.415) [-1446.627] (-1450.029) (-1446.104) * (-1446.552) [-1446.387] (-1448.331) (-1449.228) -- 0:00:44
287500 -- (-1447.808) [-1446.737] (-1453.801) (-1447.018) * (-1448.799) [-1445.730] (-1451.884) (-1449.099) -- 0:00:44
288000 -- (-1447.689) (-1446.112) (-1450.930) [-1448.231] * (-1449.367) (-1445.729) (-1448.870) [-1448.440] -- 0:00:44
288500 -- (-1446.992) (-1446.269) (-1450.208) [-1448.427] * (-1447.431) [-1447.928] (-1447.281) (-1446.254) -- 0:00:44
289000 -- (-1448.255) (-1446.523) [-1447.488] (-1449.674) * (-1448.544) [-1450.607] (-1447.813) (-1447.866) -- 0:00:44
289500 -- [-1445.770] (-1447.044) (-1449.398) (-1447.142) * [-1449.169] (-1446.332) (-1448.295) (-1455.007) -- 0:00:44
290000 -- (-1445.622) [-1447.162] (-1449.106) (-1448.361) * (-1450.430) [-1447.548] (-1447.052) (-1451.004) -- 0:00:44
Average standard deviation of split frequencies: 0.015073
290500 -- (-1446.441) (-1448.569) (-1449.228) [-1446.554] * [-1448.249] (-1448.721) (-1445.989) (-1448.324) -- 0:00:46
291000 -- (-1452.215) (-1449.783) (-1449.032) [-1446.118] * (-1447.559) (-1448.441) (-1445.743) [-1447.096] -- 0:00:46
291500 -- (-1447.606) (-1459.208) [-1447.606] (-1446.396) * (-1448.968) (-1450.085) (-1448.263) [-1449.341] -- 0:00:46
292000 -- (-1449.604) (-1455.419) (-1445.485) [-1451.449] * [-1447.502] (-1447.315) (-1449.051) (-1451.647) -- 0:00:46
292500 -- (-1448.595) (-1451.073) (-1446.148) [-1446.121] * (-1446.461) (-1446.815) (-1450.676) [-1447.122] -- 0:00:45
293000 -- (-1446.792) (-1451.632) [-1446.036] (-1446.842) * [-1445.951] (-1449.539) (-1447.807) (-1446.163) -- 0:00:45
293500 -- (-1448.618) [-1449.377] (-1447.551) (-1447.446) * (-1446.605) (-1450.758) [-1450.135] (-1446.517) -- 0:00:45
294000 -- (-1446.253) (-1449.753) [-1446.451] (-1447.116) * [-1445.713] (-1446.976) (-1449.939) (-1447.244) -- 0:00:45
294500 -- (-1447.307) (-1447.000) (-1447.170) [-1447.134] * (-1445.841) (-1447.233) (-1450.077) [-1446.483] -- 0:00:45
295000 -- (-1445.567) (-1446.994) [-1445.857] (-1448.340) * (-1449.347) [-1446.615] (-1451.066) (-1447.582) -- 0:00:45
Average standard deviation of split frequencies: 0.014521
295500 -- [-1445.454] (-1448.582) (-1447.984) (-1448.345) * (-1445.353) [-1446.157] (-1448.953) (-1449.832) -- 0:00:45
296000 -- (-1446.736) [-1446.792] (-1447.698) (-1448.620) * (-1449.418) [-1445.700] (-1448.159) (-1448.360) -- 0:00:45
296500 -- (-1447.723) (-1447.543) (-1447.834) [-1445.939] * (-1447.298) [-1445.537] (-1450.208) (-1446.707) -- 0:00:45
297000 -- (-1446.048) (-1446.743) (-1448.230) [-1445.632] * [-1445.843] (-1447.816) (-1449.568) (-1448.313) -- 0:00:44
297500 -- (-1447.211) (-1446.001) [-1448.110] (-1446.592) * (-1446.538) (-1447.055) [-1447.518] (-1449.810) -- 0:00:44
298000 -- (-1445.645) (-1445.933) (-1446.580) [-1448.493] * [-1446.224] (-1447.259) (-1447.475) (-1448.893) -- 0:00:44
298500 -- (-1446.174) (-1447.867) (-1447.505) [-1447.418] * (-1448.138) (-1448.512) (-1448.872) [-1447.361] -- 0:00:44
299000 -- (-1447.301) (-1447.538) (-1448.560) [-1448.808] * [-1447.685] (-1447.868) (-1448.279) (-1448.904) -- 0:00:44
299500 -- (-1449.810) (-1446.975) (-1446.090) [-1446.596] * (-1446.595) (-1448.742) [-1447.711] (-1447.585) -- 0:00:44
300000 -- [-1450.984] (-1447.316) (-1451.535) (-1445.919) * (-1445.926) (-1446.932) (-1449.588) [-1447.912] -- 0:00:44
Average standard deviation of split frequencies: 0.014203
300500 -- (-1448.560) [-1447.800] (-1446.942) (-1445.917) * [-1445.845] (-1447.519) (-1448.728) (-1452.016) -- 0:00:44
301000 -- (-1448.515) (-1446.424) [-1445.998] (-1450.073) * [-1445.911] (-1448.878) (-1449.378) (-1447.666) -- 0:00:44
301500 -- [-1445.416] (-1446.942) (-1446.168) (-1446.835) * (-1447.415) [-1447.559] (-1447.267) (-1448.817) -- 0:00:44
302000 -- (-1445.353) (-1448.557) (-1446.363) [-1447.324] * (-1446.602) (-1448.611) [-1454.088] (-1448.033) -- 0:00:43
302500 -- (-1446.733) (-1446.519) [-1450.895] (-1451.220) * (-1445.625) (-1447.573) (-1450.223) [-1450.516] -- 0:00:43
303000 -- (-1446.733) (-1453.383) [-1448.724] (-1446.930) * [-1446.121] (-1447.414) (-1447.756) (-1449.262) -- 0:00:43
303500 -- (-1446.999) (-1451.113) [-1446.875] (-1448.615) * [-1446.618] (-1448.018) (-1447.579) (-1446.785) -- 0:00:43
304000 -- [-1446.133] (-1451.220) (-1446.110) (-1448.149) * (-1447.992) (-1446.619) (-1446.926) [-1446.156] -- 0:00:43
304500 -- (-1448.903) (-1448.217) [-1446.067] (-1450.011) * (-1449.597) (-1448.395) [-1447.526] (-1446.836) -- 0:00:43
305000 -- [-1447.888] (-1446.877) (-1446.132) (-1448.373) * (-1449.638) (-1446.579) [-1446.780] (-1446.161) -- 0:00:43
Average standard deviation of split frequencies: 0.013593
305500 -- (-1446.914) (-1446.021) (-1446.700) [-1447.794] * [-1447.523] (-1447.004) (-1446.910) (-1447.265) -- 0:00:43
306000 -- (-1446.013) (-1446.742) (-1449.806) [-1448.515] * (-1447.286) (-1450.818) (-1452.992) [-1448.471] -- 0:00:45
306500 -- [-1449.535] (-1447.043) (-1447.507) (-1447.539) * (-1448.620) (-1448.316) (-1445.630) [-1448.425] -- 0:00:45
307000 -- (-1448.733) (-1446.788) (-1450.038) [-1447.521] * (-1447.294) (-1447.305) [-1450.443] (-1447.461) -- 0:00:45
307500 -- (-1447.568) (-1447.471) (-1450.694) [-1448.393] * [-1447.324] (-1447.642) (-1452.109) (-1450.242) -- 0:00:45
308000 -- (-1446.061) [-1447.806] (-1447.578) (-1445.210) * (-1446.862) (-1450.481) (-1450.017) [-1445.285] -- 0:00:44
308500 -- (-1448.989) (-1446.817) (-1445.985) [-1447.705] * (-1445.633) (-1446.006) [-1449.513] (-1446.691) -- 0:00:44
309000 -- [-1449.435] (-1448.339) (-1446.661) (-1446.278) * (-1445.842) (-1446.004) [-1448.255] (-1450.084) -- 0:00:44
309500 -- (-1446.205) (-1449.889) [-1446.067] (-1453.014) * [-1445.988] (-1447.552) (-1446.924) (-1446.510) -- 0:00:44
310000 -- (-1448.437) (-1449.473) [-1445.775] (-1448.096) * (-1447.675) (-1448.343) (-1448.305) [-1446.375] -- 0:00:44
Average standard deviation of split frequencies: 0.012729
310500 -- (-1448.863) (-1448.696) [-1445.523] (-1448.964) * (-1451.772) [-1445.296] (-1448.082) (-1450.089) -- 0:00:44
311000 -- (-1447.041) (-1448.655) [-1445.812] (-1447.745) * (-1449.169) [-1446.495] (-1451.150) (-1445.651) -- 0:00:44
311500 -- (-1449.089) (-1447.749) [-1450.942] (-1446.858) * (-1446.305) [-1447.309] (-1447.828) (-1445.330) -- 0:00:44
312000 -- (-1446.519) (-1447.522) (-1447.732) [-1446.104] * [-1446.379] (-1446.762) (-1445.803) (-1445.927) -- 0:00:44
312500 -- [-1447.400] (-1446.212) (-1447.361) (-1445.598) * (-1447.568) [-1448.824] (-1448.227) (-1447.070) -- 0:00:44
313000 -- (-1447.688) (-1447.794) [-1445.940] (-1446.655) * (-1445.764) [-1452.629] (-1448.725) (-1445.741) -- 0:00:43
313500 -- (-1446.610) (-1450.463) (-1448.728) [-1446.480] * [-1445.579] (-1446.518) (-1446.632) (-1445.550) -- 0:00:43
314000 -- (-1446.680) (-1448.064) [-1447.077] (-1445.927) * (-1445.709) (-1446.695) (-1446.736) [-1446.337] -- 0:00:43
314500 -- [-1450.354] (-1447.367) (-1447.047) (-1447.945) * [-1445.821] (-1447.335) (-1448.533) (-1445.512) -- 0:00:43
315000 -- (-1449.273) (-1446.885) (-1447.153) [-1447.702] * [-1445.487] (-1448.066) (-1449.222) (-1447.189) -- 0:00:43
Average standard deviation of split frequencies: 0.012763
315500 -- (-1447.112) (-1451.994) [-1446.694] (-1446.895) * (-1446.717) [-1447.875] (-1449.011) (-1447.879) -- 0:00:43
316000 -- (-1446.886) (-1448.425) (-1447.959) [-1446.069] * (-1445.991) [-1446.078] (-1449.721) (-1447.646) -- 0:00:43
316500 -- [-1447.956] (-1445.856) (-1451.526) (-1446.311) * (-1448.363) [-1446.014] (-1452.553) (-1451.227) -- 0:00:43
317000 -- (-1446.460) (-1447.795) (-1446.055) [-1446.324] * (-1448.053) (-1446.229) [-1447.025] (-1452.343) -- 0:00:43
317500 -- (-1448.166) [-1446.174] (-1450.763) (-1446.352) * (-1447.362) [-1446.628] (-1450.508) (-1453.490) -- 0:00:42
318000 -- [-1448.396] (-1446.506) (-1446.541) (-1445.385) * (-1449.236) [-1446.864] (-1449.646) (-1448.026) -- 0:00:42
318500 -- (-1447.915) [-1447.974] (-1447.191) (-1448.088) * (-1449.973) (-1447.089) [-1449.397] (-1446.718) -- 0:00:42
319000 -- (-1447.380) [-1446.908] (-1448.771) (-1447.628) * (-1447.391) (-1448.163) [-1451.815] (-1446.879) -- 0:00:42
319500 -- (-1447.890) (-1445.731) (-1448.836) [-1447.411] * (-1446.395) (-1450.240) (-1446.918) [-1448.283] -- 0:00:42
320000 -- (-1446.270) (-1445.533) [-1446.570] (-1448.225) * (-1449.175) [-1450.964] (-1447.918) (-1448.451) -- 0:00:42
Average standard deviation of split frequencies: 0.013067
320500 -- (-1449.071) (-1450.535) [-1446.910] (-1447.749) * (-1447.919) (-1448.084) [-1448.055] (-1445.986) -- 0:00:42
321000 -- (-1449.115) (-1447.312) [-1447.701] (-1448.988) * (-1452.024) [-1446.405] (-1447.092) (-1447.372) -- 0:00:42
321500 -- (-1445.648) (-1450.328) (-1447.325) [-1449.705] * (-1452.347) (-1446.998) [-1449.423] (-1448.249) -- 0:00:42
322000 -- [-1446.494] (-1452.354) (-1449.627) (-1447.447) * (-1449.218) (-1445.647) [-1446.960] (-1448.245) -- 0:00:44
322500 -- (-1445.452) (-1447.261) [-1447.345] (-1446.714) * (-1447.022) [-1445.620] (-1446.019) (-1449.606) -- 0:00:44
323000 -- (-1447.781) [-1446.026] (-1448.857) (-1446.276) * [-1448.962] (-1447.052) (-1446.581) (-1447.272) -- 0:00:44
323500 -- (-1448.485) (-1447.559) [-1447.993] (-1446.153) * [-1449.819] (-1446.483) (-1446.991) (-1445.891) -- 0:00:43
324000 -- [-1447.468] (-1449.363) (-1448.722) (-1448.660) * (-1447.085) (-1446.555) (-1450.098) [-1451.241] -- 0:00:43
324500 -- [-1446.924] (-1454.806) (-1447.235) (-1448.179) * (-1448.299) [-1446.744] (-1449.621) (-1453.787) -- 0:00:43
325000 -- (-1446.495) (-1451.606) (-1446.493) [-1447.233] * [-1447.498] (-1446.271) (-1448.549) (-1445.518) -- 0:00:43
Average standard deviation of split frequencies: 0.014232
325500 -- [-1446.488] (-1455.407) (-1450.568) (-1451.225) * (-1449.486) (-1449.345) [-1446.278] (-1446.335) -- 0:00:43
326000 -- [-1445.196] (-1447.902) (-1447.042) (-1446.468) * (-1446.496) (-1448.953) (-1446.253) [-1446.018] -- 0:00:43
326500 -- [-1445.548] (-1446.429) (-1447.225) (-1446.054) * (-1445.826) (-1449.692) [-1446.574] (-1448.812) -- 0:00:43
327000 -- [-1445.902] (-1447.340) (-1449.353) (-1446.796) * (-1445.789) [-1450.222] (-1447.837) (-1447.878) -- 0:00:43
327500 -- (-1445.858) (-1449.545) [-1450.754] (-1446.968) * (-1453.826) [-1445.726] (-1447.753) (-1447.974) -- 0:00:43
328000 -- (-1449.657) (-1446.303) (-1447.441) [-1450.539] * [-1446.247] (-1447.632) (-1447.168) (-1448.073) -- 0:00:43
328500 -- (-1445.469) (-1446.701) (-1447.716) [-1446.907] * (-1446.531) (-1448.312) [-1450.826] (-1448.585) -- 0:00:42
329000 -- (-1446.382) [-1446.373] (-1445.131) (-1449.874) * (-1446.073) (-1447.372) [-1447.907] (-1451.042) -- 0:00:42
329500 -- (-1448.675) (-1447.428) (-1446.799) [-1447.690] * (-1446.231) [-1446.639] (-1448.617) (-1447.765) -- 0:00:42
330000 -- (-1451.648) [-1447.140] (-1450.232) (-1453.488) * (-1448.353) [-1446.981] (-1448.861) (-1448.512) -- 0:00:42
Average standard deviation of split frequencies: 0.013656
330500 -- (-1453.629) (-1449.236) (-1448.443) [-1450.444] * (-1446.770) (-1450.341) [-1447.600] (-1446.248) -- 0:00:42
331000 -- (-1450.837) (-1447.412) [-1447.357] (-1448.996) * (-1445.670) (-1446.096) (-1446.005) [-1446.951] -- 0:00:42
331500 -- [-1447.951] (-1447.438) (-1445.911) (-1448.490) * [-1447.669] (-1447.977) (-1452.073) (-1445.317) -- 0:00:42
332000 -- (-1451.347) (-1451.287) [-1446.936] (-1445.910) * (-1446.445) (-1448.000) (-1452.726) [-1447.954] -- 0:00:42
332500 -- (-1446.966) (-1447.951) (-1447.017) [-1445.364] * (-1445.842) (-1448.062) [-1448.723] (-1446.649) -- 0:00:42
333000 -- [-1447.640] (-1448.053) (-1446.283) (-1448.983) * (-1446.328) (-1446.904) (-1448.476) [-1447.266] -- 0:00:42
333500 -- (-1451.190) [-1449.521] (-1448.516) (-1447.230) * (-1445.439) (-1447.597) (-1448.346) [-1447.444] -- 0:00:41
334000 -- [-1448.246] (-1447.689) (-1451.629) (-1446.776) * (-1445.593) [-1447.143] (-1449.470) (-1447.413) -- 0:00:41
334500 -- (-1449.203) (-1448.814) (-1449.622) [-1446.776] * (-1446.602) [-1447.598] (-1446.788) (-1448.204) -- 0:00:41
335000 -- (-1447.880) (-1450.813) (-1448.552) [-1446.817] * (-1446.969) (-1449.441) [-1445.452] (-1448.000) -- 0:00:41
Average standard deviation of split frequencies: 0.013439
335500 -- (-1448.015) [-1448.295] (-1449.812) (-1446.799) * (-1453.153) [-1446.902] (-1445.255) (-1446.974) -- 0:00:41
336000 -- (-1446.418) (-1448.440) [-1447.879] (-1446.799) * (-1447.345) [-1447.129] (-1446.294) (-1450.368) -- 0:00:41
336500 -- (-1445.950) (-1448.906) (-1446.702) [-1447.233] * [-1449.560] (-1446.335) (-1445.912) (-1446.117) -- 0:00:41
337000 -- (-1445.744) (-1447.915) (-1449.485) [-1447.115] * [-1445.620] (-1445.581) (-1446.687) (-1447.076) -- 0:00:41
337500 -- (-1448.279) (-1451.008) [-1449.455] (-1446.116) * [-1445.660] (-1448.714) (-1446.225) (-1450.492) -- 0:00:41
338000 -- (-1448.907) (-1455.233) (-1447.025) [-1445.824] * (-1449.821) [-1445.234] (-1445.531) (-1450.418) -- 0:00:43
338500 -- [-1447.402] (-1446.428) (-1451.395) (-1446.383) * (-1447.798) (-1445.211) [-1447.162] (-1448.633) -- 0:00:42
339000 -- [-1447.983] (-1450.532) (-1447.274) (-1450.669) * (-1447.265) (-1446.209) (-1454.614) [-1448.173] -- 0:00:42
339500 -- (-1445.515) (-1447.674) (-1450.981) [-1447.175] * [-1446.599] (-1449.177) (-1450.036) (-1448.168) -- 0:00:42
340000 -- (-1446.612) [-1446.202] (-1447.170) (-1445.799) * (-1446.324) (-1449.253) [-1446.270] (-1448.182) -- 0:00:42
Average standard deviation of split frequencies: 0.012838
340500 -- (-1447.086) (-1448.825) [-1446.314] (-1446.677) * [-1447.257] (-1448.750) (-1448.402) (-1448.484) -- 0:00:42
341000 -- (-1445.607) (-1450.320) [-1446.847] (-1445.718) * (-1446.207) [-1446.896] (-1450.241) (-1447.835) -- 0:00:42
341500 -- [-1445.061] (-1448.822) (-1447.593) (-1450.356) * [-1451.255] (-1448.818) (-1448.556) (-1447.693) -- 0:00:42
342000 -- [-1445.640] (-1448.523) (-1449.430) (-1447.563) * (-1448.274) (-1447.909) [-1447.108] (-1446.158) -- 0:00:42
342500 -- [-1446.875] (-1445.604) (-1450.138) (-1446.897) * (-1448.278) [-1449.072] (-1450.048) (-1446.973) -- 0:00:42
343000 -- [-1446.796] (-1445.397) (-1445.997) (-1446.674) * (-1452.174) [-1446.414] (-1450.569) (-1446.706) -- 0:00:42
343500 -- (-1448.261) (-1445.730) [-1445.623] (-1447.125) * (-1446.788) (-1446.054) (-1450.005) [-1447.076] -- 0:00:42
344000 -- (-1446.545) (-1446.998) [-1447.286] (-1447.211) * [-1447.907] (-1448.963) (-1449.365) (-1445.578) -- 0:00:41
344500 -- (-1446.921) (-1447.635) (-1446.269) [-1446.133] * (-1448.283) [-1445.548] (-1449.586) (-1447.308) -- 0:00:41
345000 -- [-1447.809] (-1446.848) (-1448.523) (-1449.984) * (-1449.308) [-1445.168] (-1448.657) (-1446.242) -- 0:00:41
Average standard deviation of split frequencies: 0.012836
345500 -- (-1447.964) [-1448.954] (-1448.754) (-1446.816) * [-1445.811] (-1446.788) (-1458.641) (-1446.317) -- 0:00:41
346000 -- [-1450.033] (-1445.767) (-1447.306) (-1447.952) * (-1445.453) [-1445.591] (-1450.025) (-1446.484) -- 0:00:41
346500 -- [-1447.843] (-1446.006) (-1447.477) (-1449.717) * (-1447.364) [-1448.423] (-1448.715) (-1446.506) -- 0:00:41
347000 -- (-1450.958) (-1446.437) [-1446.269] (-1447.809) * (-1445.541) (-1452.072) (-1447.903) [-1447.746] -- 0:00:41
347500 -- (-1447.395) (-1447.142) (-1448.210) [-1446.506] * (-1448.450) (-1452.738) [-1448.180] (-1447.481) -- 0:00:41
348000 -- (-1447.143) (-1454.013) (-1447.983) [-1445.602] * (-1446.529) [-1449.688] (-1448.143) (-1450.382) -- 0:00:41
348500 -- (-1448.460) (-1446.581) [-1446.196] (-1447.063) * (-1446.417) (-1447.658) (-1446.771) [-1448.838] -- 0:00:41
349000 -- [-1447.331] (-1445.900) (-1447.645) (-1447.084) * (-1447.386) (-1449.484) [-1447.539] (-1450.321) -- 0:00:41
349500 -- [-1447.938] (-1445.760) (-1446.994) (-1446.043) * (-1448.380) (-1448.763) [-1448.082] (-1450.187) -- 0:00:40
350000 -- (-1446.628) [-1446.774] (-1453.227) (-1451.784) * [-1447.323] (-1447.197) (-1449.844) (-1450.413) -- 0:00:40
Average standard deviation of split frequencies: 0.013219
350500 -- [-1446.801] (-1448.310) (-1448.010) (-1446.936) * (-1447.458) (-1446.855) (-1449.926) [-1449.006] -- 0:00:40
351000 -- [-1448.129] (-1447.922) (-1451.673) (-1451.690) * [-1445.988] (-1447.139) (-1447.942) (-1452.228) -- 0:00:40
351500 -- [-1446.738] (-1448.824) (-1448.934) (-1452.366) * [-1448.981] (-1447.139) (-1446.579) (-1448.308) -- 0:00:40
352000 -- (-1446.258) [-1448.762] (-1449.476) (-1448.583) * (-1450.645) (-1447.304) [-1448.589] (-1448.425) -- 0:00:40
352500 -- (-1445.221) (-1446.356) [-1446.442] (-1448.648) * [-1449.742] (-1447.451) (-1447.514) (-1449.207) -- 0:00:40
353000 -- [-1445.920] (-1446.843) (-1447.346) (-1446.781) * (-1453.311) [-1446.225] (-1449.892) (-1447.030) -- 0:00:40
353500 -- [-1446.362] (-1452.096) (-1449.145) (-1447.982) * (-1450.589) (-1445.828) [-1446.254] (-1447.704) -- 0:00:40
354000 -- (-1448.282) (-1450.474) [-1450.193] (-1446.212) * [-1447.913] (-1446.354) (-1447.482) (-1449.581) -- 0:00:41
354500 -- (-1448.675) (-1447.321) [-1446.893] (-1446.932) * (-1446.837) (-1447.111) [-1448.267] (-1451.405) -- 0:00:41
355000 -- (-1450.404) (-1447.982) [-1445.474] (-1446.218) * (-1446.072) [-1448.343] (-1447.310) (-1448.466) -- 0:00:41
Average standard deviation of split frequencies: 0.012545
355500 -- (-1446.625) [-1447.087] (-1447.658) (-1448.393) * [-1447.865] (-1446.536) (-1448.627) (-1446.645) -- 0:00:41
356000 -- (-1447.425) (-1446.287) [-1447.792] (-1448.578) * [-1447.725] (-1446.798) (-1446.708) (-1448.447) -- 0:00:41
356500 -- (-1446.938) (-1445.748) (-1448.611) [-1447.902] * [-1446.492] (-1446.976) (-1446.487) (-1449.478) -- 0:00:41
357000 -- (-1449.676) [-1449.368] (-1446.068) (-1452.065) * [-1445.627] (-1446.322) (-1446.236) (-1446.884) -- 0:00:41
357500 -- (-1448.546) (-1446.467) [-1446.106] (-1450.229) * (-1446.250) [-1447.935] (-1445.751) (-1447.714) -- 0:00:41
358000 -- [-1447.986] (-1449.068) (-1447.774) (-1447.131) * [-1446.227] (-1447.567) (-1445.707) (-1447.322) -- 0:00:41
358500 -- (-1447.735) (-1450.230) [-1446.255] (-1447.901) * [-1445.949] (-1447.143) (-1448.008) (-1448.065) -- 0:00:41
359000 -- (-1446.520) (-1450.529) [-1446.966] (-1448.517) * [-1446.657] (-1449.923) (-1445.947) (-1446.852) -- 0:00:41
359500 -- (-1445.721) (-1455.220) [-1446.672] (-1446.326) * (-1448.915) (-1451.873) [-1445.589] (-1447.988) -- 0:00:40
360000 -- (-1445.721) [-1457.967] (-1447.485) (-1453.332) * (-1450.621) [-1450.542] (-1449.674) (-1447.385) -- 0:00:40
Average standard deviation of split frequencies: 0.013651
360500 -- (-1447.437) (-1464.454) (-1447.222) [-1451.224] * [-1454.843] (-1449.124) (-1447.228) (-1447.930) -- 0:00:40
361000 -- (-1451.111) (-1462.045) (-1451.553) [-1447.100] * (-1454.213) (-1448.969) [-1448.070] (-1449.609) -- 0:00:40
361500 -- [-1447.183] (-1447.495) (-1452.243) (-1450.491) * (-1449.748) (-1448.908) [-1447.817] (-1447.516) -- 0:00:40
362000 -- (-1452.313) [-1446.048] (-1450.430) (-1447.761) * (-1447.297) [-1446.497] (-1446.525) (-1448.415) -- 0:00:40
362500 -- (-1449.334) (-1446.943) (-1448.966) [-1447.764] * (-1446.112) (-1447.693) (-1445.083) [-1448.981] -- 0:00:40
363000 -- [-1448.746] (-1449.975) (-1449.026) (-1445.143) * [-1446.699] (-1446.507) (-1451.864) (-1446.593) -- 0:00:40
363500 -- (-1447.748) (-1447.889) (-1445.757) [-1445.148] * [-1446.120] (-1446.277) (-1451.354) (-1447.518) -- 0:00:40
364000 -- (-1446.893) (-1447.906) (-1445.322) [-1445.430] * [-1446.303] (-1446.153) (-1447.248) (-1448.774) -- 0:00:40
364500 -- (-1459.656) [-1448.668] (-1447.184) (-1446.495) * [-1446.723] (-1445.960) (-1454.422) (-1449.721) -- 0:00:40
365000 -- [-1448.040] (-1446.691) (-1446.532) (-1446.627) * (-1447.171) [-1446.080] (-1446.899) (-1446.406) -- 0:00:40
Average standard deviation of split frequencies: 0.013023
365500 -- (-1446.468) (-1451.307) (-1447.622) [-1446.234] * [-1449.086] (-1448.471) (-1449.465) (-1447.037) -- 0:00:39
366000 -- (-1448.409) [-1448.315] (-1447.452) (-1445.949) * (-1449.340) [-1447.857] (-1446.631) (-1445.676) -- 0:00:39
366500 -- (-1446.223) (-1448.087) (-1446.762) [-1446.995] * (-1451.105) (-1450.609) [-1445.649] (-1445.613) -- 0:00:39
367000 -- (-1446.921) [-1445.357] (-1454.036) (-1446.550) * [-1446.503] (-1450.074) (-1447.264) (-1446.389) -- 0:00:39
367500 -- (-1446.592) (-1445.549) (-1446.165) [-1445.387] * [-1447.162] (-1450.576) (-1450.272) (-1446.701) -- 0:00:39
368000 -- (-1448.660) (-1447.415) [-1445.388] (-1450.516) * [-1446.800] (-1451.640) (-1449.808) (-1446.554) -- 0:00:39
368500 -- [-1446.534] (-1445.997) (-1445.861) (-1451.053) * (-1448.768) (-1449.897) (-1447.451) [-1450.016] -- 0:00:39
369000 -- (-1445.420) (-1445.847) [-1446.223] (-1450.607) * (-1447.742) [-1448.945] (-1451.178) (-1447.713) -- 0:00:39
369500 -- [-1445.310] (-1447.256) (-1446.873) (-1449.463) * (-1447.844) [-1449.675] (-1450.794) (-1445.620) -- 0:00:39
370000 -- (-1449.249) (-1450.467) [-1448.007] (-1450.149) * (-1449.514) (-1445.900) [-1445.793] (-1446.013) -- 0:00:40
Average standard deviation of split frequencies: 0.012364
370500 -- (-1446.217) [-1450.783] (-1448.163) (-1449.458) * [-1446.869] (-1446.641) (-1445.219) (-1446.482) -- 0:00:40
371000 -- (-1450.966) (-1445.886) [-1446.789] (-1451.656) * [-1446.469] (-1446.057) (-1451.647) (-1448.460) -- 0:00:40
371500 -- (-1451.779) (-1447.029) [-1445.557] (-1452.804) * (-1446.393) (-1447.333) [-1447.809] (-1448.338) -- 0:00:40
372000 -- (-1450.034) (-1449.151) [-1445.722] (-1450.562) * (-1446.329) [-1445.664] (-1447.998) (-1446.746) -- 0:00:40
372500 -- (-1446.122) [-1449.148] (-1447.468) (-1448.334) * [-1449.367] (-1446.217) (-1446.480) (-1446.220) -- 0:00:40
373000 -- (-1446.054) [-1449.736] (-1451.008) (-1446.162) * [-1449.345] (-1447.632) (-1447.283) (-1446.354) -- 0:00:40
373500 -- (-1445.643) (-1449.833) [-1446.852] (-1446.216) * (-1446.707) [-1447.581] (-1447.373) (-1445.683) -- 0:00:40
374000 -- (-1446.370) [-1445.941] (-1448.775) (-1448.635) * (-1445.748) (-1447.874) [-1447.187] (-1445.675) -- 0:00:40
374500 -- [-1446.892] (-1446.666) (-1447.851) (-1447.170) * [-1447.018] (-1448.788) (-1448.550) (-1445.396) -- 0:00:40
375000 -- (-1446.937) (-1457.820) [-1447.801] (-1448.832) * [-1446.616] (-1447.577) (-1450.884) (-1447.077) -- 0:00:40
Average standard deviation of split frequencies: 0.012746
375500 -- (-1447.760) [-1447.490] (-1450.759) (-1446.013) * [-1447.851] (-1448.938) (-1448.169) (-1446.689) -- 0:00:39
376000 -- (-1446.484) (-1446.801) (-1445.596) [-1447.062] * (-1448.346) (-1448.248) (-1447.450) [-1448.981] -- 0:00:39
376500 -- (-1450.375) (-1446.245) (-1446.140) [-1452.366] * (-1448.040) (-1450.422) (-1446.698) [-1447.313] -- 0:00:39
377000 -- (-1448.904) (-1446.789) (-1445.543) [-1448.968] * [-1446.909] (-1446.186) (-1450.543) (-1447.389) -- 0:00:39
377500 -- (-1448.764) (-1447.566) [-1447.828] (-1455.242) * (-1448.448) [-1446.397] (-1446.166) (-1449.401) -- 0:00:39
378000 -- (-1446.008) (-1450.388) [-1449.233] (-1451.358) * (-1445.358) (-1447.806) [-1447.939] (-1449.905) -- 0:00:39
378500 -- (-1445.551) (-1448.290) (-1448.845) [-1445.695] * (-1447.486) (-1446.254) [-1446.955] (-1450.091) -- 0:00:39
379000 -- [-1446.092] (-1451.903) (-1448.331) (-1445.758) * [-1449.247] (-1446.387) (-1448.234) (-1450.414) -- 0:00:39
379500 -- [-1445.811] (-1451.795) (-1446.261) (-1448.336) * (-1449.066) [-1447.728] (-1445.610) (-1448.446) -- 0:00:39
380000 -- [-1446.419] (-1447.910) (-1445.990) (-1452.416) * (-1447.489) (-1447.916) [-1449.649] (-1446.950) -- 0:00:39
Average standard deviation of split frequencies: 0.013140
380500 -- [-1445.774] (-1447.145) (-1445.984) (-1451.278) * (-1449.128) (-1448.963) [-1451.102] (-1447.247) -- 0:00:39
381000 -- [-1445.761] (-1446.376) (-1447.724) (-1449.040) * (-1450.741) [-1447.999] (-1447.862) (-1448.669) -- 0:00:38
381500 -- [-1447.565] (-1448.458) (-1449.985) (-1447.833) * (-1451.153) (-1447.000) (-1447.562) [-1447.296] -- 0:00:38
382000 -- (-1447.526) (-1448.877) [-1447.412] (-1447.820) * (-1453.140) (-1447.203) (-1446.871) [-1447.021] -- 0:00:38
382500 -- (-1451.910) [-1448.677] (-1448.124) (-1448.015) * [-1448.321] (-1446.281) (-1448.976) (-1449.966) -- 0:00:38
383000 -- (-1446.857) (-1448.537) (-1446.888) [-1448.507] * (-1447.348) (-1445.981) (-1447.014) [-1453.442] -- 0:00:38
383500 -- (-1446.332) (-1449.405) (-1446.229) [-1447.284] * (-1447.224) [-1445.484] (-1447.597) (-1451.621) -- 0:00:38
384000 -- (-1446.183) [-1446.254] (-1446.943) (-1451.470) * (-1448.052) (-1446.163) (-1447.802) [-1449.591] -- 0:00:38
384500 -- [-1450.214] (-1448.649) (-1448.081) (-1450.906) * (-1447.773) [-1446.506] (-1448.477) (-1448.693) -- 0:00:38
385000 -- (-1445.892) [-1448.613] (-1450.710) (-1451.436) * [-1447.553] (-1446.104) (-1447.319) (-1445.995) -- 0:00:38
Average standard deviation of split frequencies: 0.013502
385500 -- [-1445.774] (-1448.440) (-1447.448) (-1446.643) * [-1448.348] (-1446.183) (-1447.906) (-1446.651) -- 0:00:38
386000 -- (-1445.304) [-1445.964] (-1446.434) (-1451.988) * (-1446.070) [-1447.719] (-1447.395) (-1446.582) -- 0:00:39
386500 -- (-1450.199) (-1446.829) [-1447.432] (-1449.586) * (-1448.020) (-1446.833) [-1446.221] (-1446.360) -- 0:00:39
387000 -- (-1447.212) [-1454.155] (-1447.077) (-1450.283) * (-1445.281) (-1446.727) (-1446.542) [-1445.933] -- 0:00:39
387500 -- [-1448.276] (-1451.020) (-1449.062) (-1450.094) * (-1445.614) [-1447.653] (-1448.601) (-1447.013) -- 0:00:39
388000 -- [-1448.017] (-1448.306) (-1450.269) (-1446.482) * (-1446.047) [-1452.488] (-1449.241) (-1448.704) -- 0:00:39
388500 -- (-1449.046) (-1449.227) [-1445.675] (-1447.596) * [-1447.632] (-1446.203) (-1445.892) (-1448.616) -- 0:00:39
389000 -- (-1447.192) (-1455.500) [-1445.782] (-1448.755) * (-1445.785) [-1445.413] (-1445.262) (-1446.997) -- 0:00:39
389500 -- (-1448.904) (-1450.002) [-1448.018] (-1446.522) * (-1447.404) [-1447.039] (-1445.794) (-1447.271) -- 0:00:39
390000 -- [-1447.212] (-1451.387) (-1445.936) (-1447.398) * [-1447.487] (-1447.116) (-1449.031) (-1447.628) -- 0:00:39
Average standard deviation of split frequencies: 0.013206
390500 -- (-1446.737) (-1446.658) (-1446.716) [-1450.882] * (-1447.370) [-1448.499] (-1448.548) (-1447.020) -- 0:00:39
391000 -- (-1446.940) (-1446.418) [-1450.920] (-1450.775) * (-1446.955) (-1447.020) (-1448.555) [-1446.598] -- 0:00:38
391500 -- (-1447.788) (-1445.829) (-1446.093) [-1451.529] * [-1447.986] (-1447.049) (-1447.817) (-1446.309) -- 0:00:38
392000 -- [-1448.207] (-1447.029) (-1446.490) (-1447.209) * [-1445.785] (-1449.785) (-1449.680) (-1446.675) -- 0:00:38
392500 -- (-1447.243) (-1445.432) (-1446.605) [-1447.403] * (-1445.815) (-1446.871) [-1445.407] (-1446.388) -- 0:00:38
393000 -- [-1446.521] (-1445.570) (-1448.249) (-1447.769) * [-1445.112] (-1447.515) (-1445.914) (-1447.803) -- 0:00:38
393500 -- [-1448.587] (-1449.644) (-1448.894) (-1447.981) * (-1445.117) (-1447.170) (-1446.066) [-1448.484] -- 0:00:38
394000 -- (-1446.561) (-1445.283) (-1446.319) [-1447.289] * [-1449.425] (-1446.570) (-1448.481) (-1446.978) -- 0:00:38
394500 -- (-1446.531) (-1446.005) (-1447.819) [-1448.368] * (-1447.958) (-1445.590) (-1449.907) [-1445.394] -- 0:00:38
395000 -- (-1446.457) (-1448.740) (-1448.683) [-1446.739] * (-1448.560) (-1446.529) [-1448.474] (-1445.889) -- 0:00:38
Average standard deviation of split frequencies: 0.013095
395500 -- (-1452.347) [-1446.719] (-1450.474) (-1445.532) * (-1448.145) (-1447.968) (-1448.643) [-1446.346] -- 0:00:38
396000 -- (-1447.499) (-1445.766) (-1448.995) [-1448.045] * [-1455.671] (-1453.038) (-1449.717) (-1447.734) -- 0:00:38
396500 -- (-1445.968) [-1445.499] (-1447.311) (-1445.878) * (-1450.278) (-1448.779) (-1448.625) [-1446.102] -- 0:00:38
397000 -- [-1450.205] (-1447.029) (-1448.029) (-1446.556) * (-1454.187) (-1449.077) [-1448.781] (-1446.388) -- 0:00:37
397500 -- (-1449.246) (-1451.977) [-1446.250] (-1452.288) * (-1447.994) [-1447.209] (-1455.731) (-1448.531) -- 0:00:37
398000 -- (-1447.537) (-1447.242) (-1446.582) [-1445.843] * (-1447.003) (-1445.891) [-1451.456] (-1449.919) -- 0:00:37
398500 -- (-1448.599) (-1445.937) [-1446.526] (-1448.986) * (-1451.718) (-1450.594) (-1447.598) [-1448.735] -- 0:00:37
399000 -- [-1447.573] (-1448.868) (-1447.855) (-1448.619) * (-1451.202) (-1451.752) [-1446.990] (-1449.581) -- 0:00:37
399500 -- (-1446.469) (-1450.695) [-1448.341] (-1448.850) * (-1447.891) (-1448.728) (-1447.236) [-1450.884] -- 0:00:37
400000 -- [-1446.805] (-1447.901) (-1448.157) (-1446.561) * (-1448.963) [-1446.216] (-1446.990) (-1446.588) -- 0:00:37
Average standard deviation of split frequencies: 0.013269
400500 -- (-1449.150) (-1448.867) [-1449.662] (-1446.466) * (-1446.474) [-1447.662] (-1447.363) (-1445.554) -- 0:00:37
401000 -- [-1448.659] (-1450.873) (-1448.155) (-1450.987) * (-1446.283) (-1448.335) (-1447.710) [-1445.113] -- 0:00:37
401500 -- (-1447.455) [-1445.533] (-1449.317) (-1448.177) * (-1448.985) (-1449.135) (-1450.141) [-1446.178] -- 0:00:37
402000 -- (-1448.821) (-1448.155) [-1447.805] (-1449.046) * [-1445.669] (-1448.338) (-1451.148) (-1445.902) -- 0:00:38
402500 -- (-1448.857) [-1449.846] (-1447.710) (-1448.927) * (-1445.813) [-1448.952] (-1450.425) (-1446.322) -- 0:00:38
403000 -- (-1447.121) (-1449.637) [-1448.146] (-1449.784) * (-1446.939) (-1445.868) (-1450.529) [-1445.915] -- 0:00:38
403500 -- (-1446.455) [-1450.892] (-1452.267) (-1446.760) * (-1447.659) (-1445.072) [-1450.905] (-1449.852) -- 0:00:38
404000 -- [-1451.537] (-1447.495) (-1449.428) (-1446.334) * (-1446.301) (-1447.179) (-1447.018) [-1446.632] -- 0:00:38
404500 -- (-1455.734) [-1446.441] (-1449.903) (-1448.274) * (-1448.193) [-1448.086] (-1447.869) (-1448.608) -- 0:00:38
405000 -- (-1451.545) (-1447.800) (-1450.420) [-1448.556] * (-1449.155) (-1445.901) (-1446.831) [-1447.520] -- 0:00:38
Average standard deviation of split frequencies: 0.013159
405500 -- [-1450.257] (-1449.729) (-1448.829) (-1447.459) * (-1449.957) [-1446.097] (-1448.764) (-1447.226) -- 0:00:38
406000 -- (-1447.239) [-1452.864] (-1448.608) (-1445.107) * (-1449.315) (-1446.253) (-1448.343) [-1445.585] -- 0:00:38
406500 -- [-1446.047] (-1451.365) (-1453.216) (-1445.460) * [-1445.623] (-1446.429) (-1447.055) (-1445.600) -- 0:00:37
407000 -- (-1448.485) (-1447.327) (-1455.950) [-1446.197] * [-1447.753] (-1446.702) (-1448.958) (-1448.262) -- 0:00:37
407500 -- (-1449.311) (-1449.324) (-1459.113) [-1448.084] * (-1450.759) [-1448.851] (-1454.673) (-1446.898) -- 0:00:37
408000 -- (-1447.835) [-1446.029] (-1449.357) (-1446.817) * [-1449.982] (-1450.728) (-1445.550) (-1447.799) -- 0:00:37
408500 -- [-1450.546] (-1445.497) (-1446.650) (-1448.723) * (-1448.132) (-1448.286) [-1447.848] (-1446.296) -- 0:00:37
409000 -- (-1448.664) (-1447.955) [-1447.377] (-1446.988) * (-1449.739) (-1447.368) [-1451.862] (-1446.374) -- 0:00:37
409500 -- (-1447.226) (-1446.580) (-1445.924) [-1447.117] * (-1446.530) [-1448.206] (-1447.372) (-1446.127) -- 0:00:37
410000 -- (-1447.469) [-1447.354] (-1445.924) (-1448.482) * (-1447.549) (-1448.366) [-1446.082] (-1445.785) -- 0:00:37
Average standard deviation of split frequencies: 0.012818
410500 -- (-1449.605) (-1446.935) [-1445.585] (-1448.126) * (-1450.283) (-1447.298) [-1448.064] (-1449.566) -- 0:00:37
411000 -- (-1447.461) (-1448.413) (-1448.132) [-1446.130] * (-1448.014) (-1449.570) [-1446.538] (-1448.018) -- 0:00:37
411500 -- (-1447.614) (-1448.508) (-1447.387) [-1445.391] * [-1447.302] (-1448.318) (-1448.244) (-1447.248) -- 0:00:37
412000 -- (-1450.842) [-1446.721] (-1447.841) (-1448.303) * [-1445.878] (-1447.623) (-1447.383) (-1447.154) -- 0:00:37
412500 -- (-1450.521) (-1446.680) [-1448.858] (-1450.829) * [-1450.405] (-1447.442) (-1449.235) (-1446.713) -- 0:00:37
413000 -- (-1447.458) [-1446.691] (-1452.094) (-1448.932) * (-1448.366) (-1450.240) [-1448.307] (-1448.404) -- 0:00:36
413500 -- (-1448.607) [-1449.024] (-1446.359) (-1446.891) * (-1450.050) (-1450.370) (-1446.913) [-1448.097] -- 0:00:36
414000 -- (-1447.525) [-1447.500] (-1447.496) (-1448.412) * (-1451.114) (-1448.753) (-1449.730) [-1448.537] -- 0:00:36
414500 -- (-1446.665) [-1448.895] (-1445.788) (-1450.913) * [-1447.381] (-1447.072) (-1450.044) (-1446.843) -- 0:00:36
415000 -- (-1449.794) [-1449.593] (-1451.328) (-1448.946) * [-1448.172] (-1447.029) (-1445.224) (-1446.815) -- 0:00:36
Average standard deviation of split frequencies: 0.012465
415500 -- [-1451.627] (-1451.223) (-1447.341) (-1448.585) * (-1447.231) [-1447.370] (-1448.171) (-1448.018) -- 0:00:36
416000 -- (-1445.900) [-1446.708] (-1448.075) (-1448.694) * (-1447.491) (-1448.620) (-1450.244) [-1445.997] -- 0:00:36
416500 -- (-1446.481) (-1446.258) [-1451.202] (-1447.979) * (-1450.914) (-1448.869) [-1450.460] (-1446.301) -- 0:00:36
417000 -- [-1445.603] (-1446.744) (-1453.163) (-1448.518) * (-1446.197) (-1450.445) [-1448.265] (-1446.302) -- 0:00:36
417500 -- (-1447.136) (-1447.023) (-1448.407) [-1447.899] * [-1446.848] (-1448.233) (-1448.831) (-1447.657) -- 0:00:36
418000 -- (-1446.989) [-1447.654] (-1447.570) (-1445.953) * (-1446.176) (-1448.229) (-1446.162) [-1446.123] -- 0:00:37
418500 -- (-1452.688) [-1449.054] (-1451.093) (-1447.894) * (-1446.082) (-1448.136) [-1446.580] (-1445.574) -- 0:00:37
419000 -- (-1446.962) (-1449.756) [-1445.954] (-1448.720) * (-1446.029) [-1448.345] (-1446.881) (-1445.574) -- 0:00:37
419500 -- (-1447.454) (-1446.089) (-1448.225) [-1447.543] * (-1445.749) [-1447.399] (-1447.755) (-1447.042) -- 0:00:37
420000 -- (-1451.285) (-1446.334) (-1447.036) [-1451.209] * (-1445.425) [-1446.728] (-1447.828) (-1446.999) -- 0:00:37
Average standard deviation of split frequencies: 0.012202
420500 -- (-1448.234) [-1445.397] (-1448.516) (-1448.353) * (-1445.582) (-1445.973) [-1451.081] (-1448.548) -- 0:00:37
421000 -- (-1448.234) [-1447.600] (-1445.695) (-1446.192) * (-1446.622) [-1445.807] (-1447.136) (-1445.876) -- 0:00:37
421500 -- (-1450.433) (-1446.761) (-1446.283) [-1447.532] * (-1450.144) (-1446.068) (-1446.185) [-1446.693] -- 0:00:37
422000 -- (-1447.628) (-1446.146) (-1447.365) [-1448.527] * (-1453.531) (-1447.707) [-1449.292] (-1446.620) -- 0:00:36
422500 -- (-1446.271) (-1446.280) (-1448.335) [-1448.466] * [-1447.311] (-1449.152) (-1448.025) (-1448.274) -- 0:00:36
423000 -- (-1450.791) [-1449.103] (-1447.506) (-1451.919) * (-1448.139) (-1447.552) (-1445.979) [-1446.557] -- 0:00:36
423500 -- [-1447.088] (-1448.675) (-1445.265) (-1449.860) * (-1448.621) [-1445.292] (-1447.485) (-1446.076) -- 0:00:36
424000 -- (-1447.069) (-1447.798) (-1445.330) [-1446.959] * (-1450.870) [-1446.779] (-1450.417) (-1446.136) -- 0:00:36
424500 -- (-1449.600) (-1448.990) [-1446.463] (-1446.910) * [-1449.435] (-1446.383) (-1452.902) (-1448.870) -- 0:00:36
425000 -- (-1449.867) (-1449.168) (-1446.461) [-1445.608] * [-1446.170] (-1448.872) (-1449.498) (-1450.989) -- 0:00:36
Average standard deviation of split frequencies: 0.012234
425500 -- (-1447.095) [-1449.198] (-1447.399) (-1448.710) * [-1448.104] (-1449.658) (-1449.077) (-1446.855) -- 0:00:36
426000 -- [-1445.552] (-1449.912) (-1447.053) (-1446.681) * [-1447.273] (-1447.181) (-1448.304) (-1449.588) -- 0:00:36
426500 -- [-1445.183] (-1445.528) (-1448.272) (-1447.900) * (-1446.531) (-1447.237) (-1448.714) [-1448.713] -- 0:00:36
427000 -- [-1447.584] (-1445.934) (-1447.011) (-1446.232) * (-1445.929) (-1446.201) [-1449.456] (-1451.114) -- 0:00:36
427500 -- (-1447.250) [-1445.494] (-1446.667) (-1446.404) * [-1447.036] (-1446.208) (-1446.495) (-1446.741) -- 0:00:36
428000 -- (-1449.624) (-1447.999) (-1447.615) [-1447.207] * [-1448.909] (-1446.282) (-1447.773) (-1446.626) -- 0:00:36
428500 -- (-1446.665) (-1446.209) (-1451.511) [-1446.723] * (-1447.373) (-1448.063) [-1446.108] (-1452.255) -- 0:00:36
429000 -- (-1446.523) (-1446.021) [-1450.191] (-1446.276) * (-1446.785) [-1446.663] (-1453.570) (-1446.689) -- 0:00:35
429500 -- (-1447.380) [-1445.988] (-1446.380) (-1450.355) * [-1447.726] (-1447.765) (-1450.215) (-1450.867) -- 0:00:35
430000 -- (-1447.181) (-1446.126) (-1446.642) [-1448.056] * (-1446.116) (-1445.684) (-1449.673) [-1450.724] -- 0:00:35
Average standard deviation of split frequencies: 0.012527
430500 -- [-1445.771] (-1446.444) (-1446.553) (-1448.133) * (-1447.204) [-1445.495] (-1448.749) (-1446.790) -- 0:00:35
431000 -- (-1447.964) (-1446.286) [-1446.183] (-1447.317) * (-1446.929) [-1447.709] (-1448.382) (-1448.310) -- 0:00:35
431500 -- (-1445.748) [-1447.171] (-1446.284) (-1447.580) * (-1446.718) (-1446.967) (-1445.701) [-1446.252] -- 0:00:35
432000 -- [-1445.879] (-1447.293) (-1447.116) (-1446.858) * (-1446.233) [-1447.565] (-1446.275) (-1447.737) -- 0:00:35
432500 -- [-1445.762] (-1446.566) (-1447.095) (-1452.276) * (-1449.325) [-1447.602] (-1448.367) (-1445.416) -- 0:00:35
433000 -- (-1446.477) [-1445.702] (-1448.926) (-1451.213) * (-1446.056) (-1447.501) [-1449.431] (-1445.546) -- 0:00:35
433500 -- [-1447.698] (-1447.365) (-1448.595) (-1449.992) * (-1447.600) (-1446.480) (-1445.232) [-1446.146] -- 0:00:35
434000 -- (-1449.103) (-1449.612) (-1445.906) [-1446.656] * (-1448.290) (-1446.246) [-1451.010] (-1446.095) -- 0:00:36
434500 -- (-1446.683) (-1448.604) (-1446.995) [-1453.691] * (-1448.751) (-1446.923) (-1446.617) [-1446.043] -- 0:00:36
435000 -- (-1447.274) (-1449.870) (-1447.849) [-1445.423] * [-1447.330] (-1445.758) (-1446.866) (-1449.270) -- 0:00:36
Average standard deviation of split frequencies: 0.013395
435500 -- (-1447.827) [-1449.870] (-1449.411) (-1446.123) * [-1447.794] (-1446.709) (-1449.115) (-1447.999) -- 0:00:36
436000 -- (-1447.227) (-1449.211) (-1446.437) [-1448.853] * (-1447.410) (-1446.517) [-1447.060] (-1448.670) -- 0:00:36
436500 -- [-1447.456] (-1447.163) (-1448.115) (-1446.819) * [-1447.451] (-1450.985) (-1450.153) (-1450.930) -- 0:00:36
437000 -- (-1450.196) (-1447.338) (-1450.532) [-1447.242] * (-1451.729) (-1448.434) (-1446.119) [-1448.009] -- 0:00:36
437500 -- (-1448.480) (-1448.854) (-1454.429) [-1446.394] * (-1451.133) (-1446.705) (-1445.872) [-1447.074] -- 0:00:36
438000 -- (-1449.033) (-1446.660) (-1451.882) [-1448.394] * (-1451.912) (-1445.908) (-1445.872) [-1448.602] -- 0:00:35
438500 -- [-1446.230] (-1450.113) (-1450.841) (-1446.454) * [-1446.295] (-1445.941) (-1447.755) (-1450.640) -- 0:00:35
439000 -- [-1447.825] (-1448.434) (-1447.641) (-1446.479) * (-1451.756) (-1447.078) [-1448.577] (-1448.543) -- 0:00:35
439500 -- (-1447.825) (-1451.568) (-1447.154) [-1446.187] * [-1449.755] (-1448.434) (-1446.423) (-1449.246) -- 0:00:35
440000 -- [-1450.913] (-1447.493) (-1448.067) (-1445.654) * (-1445.161) (-1448.882) [-1449.996] (-1450.733) -- 0:00:35
Average standard deviation of split frequencies: 0.013312
440500 -- (-1445.826) (-1447.658) (-1451.021) [-1446.191] * [-1447.087] (-1447.617) (-1445.337) (-1450.889) -- 0:00:35
441000 -- (-1445.824) (-1447.068) (-1449.446) [-1446.959] * [-1447.876] (-1446.113) (-1445.800) (-1446.251) -- 0:00:35
441500 -- (-1446.053) (-1448.342) (-1450.368) [-1446.070] * (-1449.871) (-1447.638) [-1448.143] (-1447.441) -- 0:00:35
442000 -- (-1446.327) [-1447.660] (-1447.143) (-1450.423) * [-1449.124] (-1447.433) (-1456.648) (-1451.167) -- 0:00:35
442500 -- (-1446.392) (-1447.109) (-1447.689) [-1446.696] * [-1448.437] (-1448.442) (-1448.887) (-1448.105) -- 0:00:35
443000 -- (-1446.089) (-1446.379) (-1448.040) [-1447.180] * (-1446.552) (-1447.576) [-1448.505] (-1446.610) -- 0:00:35
443500 -- [-1446.055] (-1447.495) (-1447.276) (-1452.252) * [-1448.387] (-1448.520) (-1449.284) (-1446.860) -- 0:00:35
444000 -- (-1446.104) [-1449.656] (-1447.350) (-1446.793) * (-1446.575) (-1448.520) (-1446.502) [-1447.757] -- 0:00:35
444500 -- [-1446.078] (-1446.621) (-1448.866) (-1447.415) * (-1447.190) (-1450.876) [-1445.670] (-1447.674) -- 0:00:34
445000 -- (-1453.289) [-1446.865] (-1447.694) (-1448.487) * (-1447.921) (-1445.504) (-1446.387) [-1450.492] -- 0:00:34
Average standard deviation of split frequencies: 0.013907
445500 -- (-1448.384) [-1447.146] (-1447.315) (-1447.421) * [-1448.584] (-1447.992) (-1447.327) (-1448.245) -- 0:00:34
446000 -- (-1450.531) [-1446.377] (-1446.836) (-1446.998) * (-1448.622) (-1447.265) (-1454.237) [-1453.152] -- 0:00:34
446500 -- (-1450.046) (-1447.247) [-1448.561] (-1445.843) * [-1451.843] (-1446.576) (-1447.375) (-1448.366) -- 0:00:34
447000 -- (-1447.161) (-1449.452) [-1449.768] (-1449.699) * (-1453.439) (-1446.518) (-1447.756) [-1448.265] -- 0:00:34
447500 -- (-1447.014) (-1448.288) (-1446.402) [-1448.239] * (-1447.399) (-1445.656) (-1446.535) [-1445.388] -- 0:00:34
448000 -- (-1449.033) [-1446.350] (-1445.914) (-1446.285) * (-1451.199) (-1446.046) [-1447.072] (-1446.891) -- 0:00:34
448500 -- (-1448.957) [-1446.746] (-1446.574) (-1446.823) * (-1445.981) (-1446.579) [-1448.896] (-1447.769) -- 0:00:34
449000 -- [-1447.906] (-1446.567) (-1446.866) (-1448.536) * (-1446.131) [-1448.630] (-1446.356) (-1446.701) -- 0:00:34
449500 -- (-1447.411) [-1448.601] (-1450.248) (-1449.962) * (-1446.750) [-1447.505] (-1449.839) (-1447.309) -- 0:00:34
450000 -- (-1446.677) (-1448.382) [-1448.086] (-1446.875) * (-1446.696) (-1447.182) (-1449.614) [-1446.216] -- 0:00:35
Average standard deviation of split frequencies: 0.013929
450500 -- (-1447.423) (-1449.191) [-1448.873] (-1446.420) * (-1446.178) (-1446.212) (-1447.770) [-1447.873] -- 0:00:35
451000 -- (-1448.562) (-1447.713) (-1445.840) [-1447.641] * (-1445.300) (-1448.212) (-1445.325) [-1446.960] -- 0:00:35
451500 -- [-1446.629] (-1447.803) (-1447.109) (-1445.646) * (-1447.572) (-1446.449) (-1447.279) [-1449.138] -- 0:00:35
452000 -- (-1447.407) [-1446.675] (-1446.234) (-1446.188) * (-1446.324) (-1447.801) [-1447.717] (-1452.867) -- 0:00:35
452500 -- (-1445.937) [-1446.555] (-1446.840) (-1445.620) * (-1445.773) (-1447.397) (-1455.898) [-1447.626] -- 0:00:35
453000 -- (-1446.583) (-1447.628) (-1448.149) [-1448.106] * (-1449.334) (-1451.406) (-1447.049) [-1448.248] -- 0:00:35
453500 -- (-1450.255) (-1450.807) [-1447.214] (-1446.570) * (-1449.948) (-1447.857) (-1448.710) [-1447.830] -- 0:00:34
454000 -- (-1447.959) (-1445.919) (-1446.962) [-1446.800] * (-1448.718) (-1448.799) (-1447.780) [-1445.387] -- 0:00:34
454500 -- (-1446.285) (-1447.773) [-1446.404] (-1447.643) * (-1450.112) [-1446.406] (-1449.023) (-1445.801) -- 0:00:34
455000 -- (-1446.815) (-1446.769) (-1447.195) [-1445.906] * (-1447.616) (-1446.693) [-1449.643] (-1449.942) -- 0:00:34
Average standard deviation of split frequencies: 0.014255
455500 -- (-1447.085) (-1448.573) [-1449.707] (-1445.837) * (-1452.185) [-1446.563] (-1449.158) (-1447.646) -- 0:00:34
456000 -- (-1450.719) (-1449.394) [-1445.302] (-1446.426) * (-1448.718) (-1450.916) (-1450.991) [-1448.582] -- 0:00:34
456500 -- (-1449.120) (-1452.365) [-1448.446] (-1450.656) * (-1447.348) [-1447.983] (-1448.757) (-1446.840) -- 0:00:34
457000 -- (-1447.356) [-1453.357] (-1446.801) (-1448.459) * (-1445.944) (-1447.521) [-1448.413] (-1446.502) -- 0:00:34
457500 -- (-1448.309) (-1450.278) (-1450.866) [-1449.096] * (-1447.249) [-1447.380] (-1448.474) (-1446.905) -- 0:00:34
458000 -- (-1450.385) (-1449.123) [-1447.810] (-1450.275) * [-1446.491] (-1446.277) (-1448.099) (-1446.734) -- 0:00:34
458500 -- (-1446.240) (-1454.474) [-1448.917] (-1446.802) * (-1447.041) (-1445.577) [-1448.524] (-1449.588) -- 0:00:34
459000 -- (-1450.226) (-1449.157) [-1447.140] (-1446.367) * (-1446.621) [-1446.712] (-1446.284) (-1446.576) -- 0:00:34
459500 -- [-1455.765] (-1448.239) (-1450.401) (-1447.412) * (-1448.324) [-1446.629] (-1445.768) (-1448.141) -- 0:00:34
460000 -- (-1452.314) (-1448.978) (-1449.872) [-1446.677] * (-1449.143) (-1449.349) (-1446.934) [-1450.752] -- 0:00:34
Average standard deviation of split frequencies: 0.013530
460500 -- (-1448.109) (-1449.168) (-1448.845) [-1448.749] * [-1447.073] (-1451.927) (-1446.953) (-1449.699) -- 0:00:33
461000 -- [-1447.054] (-1445.944) (-1448.282) (-1447.496) * (-1447.343) (-1448.295) [-1450.041] (-1448.240) -- 0:00:33
461500 -- [-1446.421] (-1446.333) (-1450.455) (-1450.525) * [-1446.275] (-1448.535) (-1449.461) (-1451.496) -- 0:00:33
462000 -- [-1447.761] (-1448.976) (-1447.114) (-1447.755) * (-1449.492) [-1447.983] (-1449.833) (-1450.398) -- 0:00:33
462500 -- (-1449.823) (-1446.561) (-1447.265) [-1448.456] * (-1449.553) (-1447.591) [-1450.812] (-1449.465) -- 0:00:33
463000 -- (-1449.335) (-1446.507) (-1452.683) [-1446.292] * (-1449.575) (-1447.484) [-1452.557] (-1447.592) -- 0:00:33
463500 -- (-1448.410) (-1445.715) [-1448.663] (-1447.351) * (-1448.213) [-1448.999] (-1454.112) (-1453.163) -- 0:00:33
464000 -- (-1448.587) (-1446.625) [-1446.065] (-1449.745) * [-1448.937] (-1447.410) (-1447.067) (-1448.738) -- 0:00:33
464500 -- (-1446.943) (-1447.199) (-1447.738) [-1447.652] * (-1448.611) [-1445.445] (-1445.705) (-1451.073) -- 0:00:33
465000 -- (-1447.905) (-1447.045) (-1447.206) [-1448.209] * (-1447.400) (-1446.252) [-1447.180] (-1449.327) -- 0:00:33
Average standard deviation of split frequencies: 0.013151
465500 -- (-1450.132) (-1446.493) [-1450.224] (-1447.617) * (-1446.467) [-1446.163] (-1446.782) (-1448.040) -- 0:00:34
466000 -- (-1447.735) [-1447.722] (-1447.953) (-1446.830) * [-1446.990] (-1446.608) (-1447.209) (-1447.149) -- 0:00:34
466500 -- (-1449.595) (-1446.471) [-1448.388] (-1449.840) * [-1446.963] (-1446.716) (-1447.541) (-1445.835) -- 0:00:34
467000 -- (-1446.947) (-1446.969) (-1449.598) [-1446.807] * (-1445.612) (-1446.367) (-1447.768) [-1445.750] -- 0:00:34
467500 -- (-1447.685) (-1446.425) [-1445.905] (-1445.911) * (-1445.775) (-1448.157) [-1445.528] (-1445.905) -- 0:00:34
468000 -- (-1447.889) (-1445.794) (-1448.612) [-1447.721] * (-1446.854) [-1447.851] (-1446.212) (-1446.337) -- 0:00:34
468500 -- (-1449.662) [-1446.410] (-1447.309) (-1448.517) * (-1448.668) [-1449.800] (-1449.430) (-1448.078) -- 0:00:34
469000 -- (-1447.998) (-1446.424) (-1450.598) [-1446.383] * (-1450.249) [-1445.914] (-1449.033) (-1448.264) -- 0:00:33
469500 -- (-1446.936) (-1448.551) [-1446.507] (-1449.396) * (-1449.540) (-1446.408) [-1451.239] (-1447.013) -- 0:00:33
470000 -- (-1450.419) [-1447.657] (-1446.932) (-1445.761) * (-1448.643) [-1449.367] (-1447.353) (-1448.076) -- 0:00:33
Average standard deviation of split frequencies: 0.013126
470500 -- (-1448.199) (-1448.190) (-1447.820) [-1445.698] * (-1446.531) (-1448.381) (-1451.603) [-1446.078] -- 0:00:33
471000 -- (-1448.640) [-1452.058] (-1452.416) (-1446.698) * (-1446.518) (-1446.150) (-1453.833) [-1448.099] -- 0:00:33
471500 -- (-1451.404) [-1450.978] (-1447.623) (-1446.253) * (-1445.987) (-1447.446) (-1447.389) [-1447.989] -- 0:00:33
472000 -- (-1446.912) (-1449.311) [-1448.747] (-1449.969) * (-1446.509) (-1448.310) [-1447.174] (-1446.355) -- 0:00:33
472500 -- (-1451.299) (-1448.071) [-1446.323] (-1446.907) * (-1450.102) [-1448.702] (-1447.822) (-1446.437) -- 0:00:33
473000 -- [-1448.086] (-1448.838) (-1448.134) (-1449.595) * (-1450.114) (-1449.187) [-1447.607] (-1448.009) -- 0:00:33
473500 -- (-1445.871) (-1448.767) (-1447.892) [-1449.620] * (-1449.214) (-1446.851) (-1445.847) [-1448.330] -- 0:00:33
474000 -- (-1447.410) (-1449.710) (-1446.336) [-1446.894] * (-1448.128) (-1448.274) [-1447.944] (-1448.530) -- 0:00:33
474500 -- (-1447.898) (-1448.434) [-1445.400] (-1448.441) * (-1445.873) (-1446.154) [-1448.983] (-1448.666) -- 0:00:33
475000 -- (-1445.549) (-1447.371) [-1446.194] (-1447.478) * [-1447.956] (-1449.987) (-1447.403) (-1449.697) -- 0:00:33
Average standard deviation of split frequencies: 0.012822
475500 -- (-1448.826) (-1446.855) (-1445.699) [-1448.577] * (-1447.061) [-1448.394] (-1450.441) (-1448.426) -- 0:00:33
476000 -- [-1448.825] (-1446.894) (-1445.977) (-1445.579) * (-1446.282) (-1446.518) (-1451.683) [-1445.523] -- 0:00:33
476500 -- (-1449.243) (-1445.916) (-1445.673) [-1445.627] * (-1446.387) (-1454.885) [-1447.003] (-1445.309) -- 0:00:32
477000 -- (-1448.705) [-1446.595] (-1445.380) (-1445.466) * [-1446.898] (-1447.185) (-1449.366) (-1445.308) -- 0:00:32
477500 -- (-1447.010) (-1446.239) [-1446.678] (-1445.857) * (-1446.442) [-1446.490] (-1445.795) (-1446.293) -- 0:00:32
478000 -- (-1449.054) (-1446.976) [-1447.839] (-1445.731) * (-1446.685) [-1448.431] (-1446.821) (-1447.407) -- 0:00:32
478500 -- [-1446.581] (-1446.112) (-1447.125) (-1447.646) * (-1447.499) (-1456.056) (-1446.354) [-1446.638] -- 0:00:32
479000 -- (-1447.054) (-1450.187) (-1445.595) [-1447.126] * [-1447.442] (-1447.375) (-1446.560) (-1448.437) -- 0:00:32
479500 -- [-1445.952] (-1448.161) (-1447.452) (-1447.253) * (-1447.153) (-1449.693) [-1446.474] (-1445.808) -- 0:00:32
480000 -- (-1447.296) (-1448.766) (-1447.972) [-1450.180] * (-1448.076) (-1448.013) [-1446.749] (-1447.718) -- 0:00:32
Average standard deviation of split frequencies: 0.013403
480500 -- [-1447.127] (-1451.007) (-1446.900) (-1447.226) * (-1448.996) (-1449.225) [-1447.096] (-1449.219) -- 0:00:32
481000 -- (-1448.453) (-1447.914) (-1448.237) [-1446.592] * (-1447.139) (-1448.352) [-1447.195] (-1449.166) -- 0:00:32
481500 -- (-1448.170) [-1447.104] (-1447.873) (-1447.025) * (-1447.219) (-1447.580) [-1448.762] (-1449.109) -- 0:00:33
482000 -- (-1446.822) [-1447.393] (-1445.673) (-1446.887) * (-1449.376) (-1449.110) [-1448.694] (-1447.435) -- 0:00:33
482500 -- (-1446.786) (-1448.545) (-1445.992) [-1445.533] * (-1448.561) (-1450.124) [-1448.162] (-1447.346) -- 0:00:33
483000 -- (-1446.257) [-1449.520] (-1446.141) (-1445.593) * (-1447.043) (-1446.875) (-1446.659) [-1447.627] -- 0:00:33
483500 -- (-1447.438) (-1448.852) (-1446.838) [-1446.808] * [-1446.198] (-1446.582) (-1450.970) (-1447.545) -- 0:00:33
484000 -- (-1447.708) (-1449.466) (-1450.695) [-1446.842] * (-1445.994) [-1449.622] (-1449.533) (-1451.413) -- 0:00:33
484500 -- [-1448.687] (-1449.937) (-1445.192) (-1448.379) * (-1446.591) (-1451.341) [-1445.781] (-1448.107) -- 0:00:32
485000 -- (-1446.986) (-1451.337) [-1447.025] (-1449.857) * (-1446.721) (-1445.875) (-1446.972) [-1445.755] -- 0:00:32
Average standard deviation of split frequencies: 0.013682
485500 -- [-1445.508] (-1449.710) (-1449.221) (-1448.040) * (-1446.723) [-1445.350] (-1446.347) (-1449.506) -- 0:00:32
486000 -- (-1446.325) (-1449.491) [-1449.092] (-1447.377) * [-1447.467] (-1445.930) (-1450.035) (-1451.325) -- 0:00:32
486500 -- [-1445.492] (-1449.070) (-1449.334) (-1447.142) * (-1448.233) (-1446.647) (-1451.270) [-1452.047] -- 0:00:32
487000 -- (-1453.419) (-1446.557) (-1451.516) [-1446.268] * (-1447.573) [-1448.509] (-1450.316) (-1456.722) -- 0:00:32
487500 -- [-1447.662] (-1448.459) (-1452.232) (-1446.624) * [-1448.400] (-1445.432) (-1446.062) (-1448.391) -- 0:00:32
488000 -- (-1446.441) (-1449.931) [-1447.769] (-1447.994) * (-1446.225) [-1446.279] (-1446.783) (-1447.319) -- 0:00:32
488500 -- (-1448.758) [-1448.750] (-1447.445) (-1450.819) * (-1452.407) [-1447.182] (-1448.324) (-1449.152) -- 0:00:32
489000 -- (-1449.592) (-1447.431) [-1446.150] (-1447.313) * (-1451.318) (-1446.103) [-1445.758] (-1450.595) -- 0:00:32
489500 -- (-1451.860) (-1447.477) (-1449.253) [-1446.123] * (-1452.297) (-1447.405) (-1445.578) [-1448.141] -- 0:00:32
490000 -- (-1447.920) (-1449.765) [-1449.296] (-1446.566) * (-1446.859) (-1446.132) (-1453.757) [-1450.082] -- 0:00:32
Average standard deviation of split frequencies: 0.013501
490500 -- (-1448.971) (-1448.088) [-1450.528] (-1448.553) * (-1447.355) [-1446.892] (-1448.111) (-1448.737) -- 0:00:32
491000 -- (-1448.238) (-1449.995) (-1449.783) [-1446.251] * (-1446.949) (-1446.441) [-1448.793] (-1446.280) -- 0:00:32
491500 -- (-1447.746) (-1447.709) (-1449.855) [-1447.865] * (-1446.352) (-1446.576) [-1445.723] (-1445.651) -- 0:00:32
492000 -- (-1448.748) (-1450.180) (-1446.719) [-1448.072] * (-1447.570) [-1446.177] (-1448.026) (-1454.161) -- 0:00:32
492500 -- (-1446.954) [-1446.043] (-1446.459) (-1450.431) * [-1449.652] (-1447.552) (-1446.594) (-1450.883) -- 0:00:31
493000 -- [-1447.668] (-1447.284) (-1447.297) (-1450.630) * (-1447.494) (-1449.967) [-1452.172] (-1447.273) -- 0:00:31
493500 -- (-1446.809) (-1448.023) [-1446.636] (-1449.498) * [-1446.826] (-1447.388) (-1451.016) (-1446.947) -- 0:00:31
494000 -- [-1445.708] (-1446.896) (-1446.801) (-1447.065) * (-1448.490) (-1449.989) [-1447.073] (-1447.427) -- 0:00:31
494500 -- (-1446.319) (-1446.005) (-1451.155) [-1445.796] * (-1448.138) (-1450.085) (-1450.391) [-1446.646] -- 0:00:31
495000 -- (-1446.194) [-1445.277] (-1447.519) (-1446.066) * (-1449.328) [-1449.623] (-1447.918) (-1448.701) -- 0:00:31
Average standard deviation of split frequencies: 0.012250
495500 -- (-1445.454) (-1445.629) (-1446.718) [-1445.602] * (-1449.391) (-1446.089) (-1447.359) [-1447.775] -- 0:00:31
496000 -- (-1445.453) (-1445.641) [-1447.613] (-1446.198) * (-1446.276) (-1447.207) (-1447.443) [-1447.653] -- 0:00:31
496500 -- (-1446.215) [-1447.876] (-1448.574) (-1450.479) * (-1451.310) (-1452.563) (-1448.097) [-1447.447] -- 0:00:31
497000 -- (-1446.246) (-1447.554) [-1445.531] (-1449.180) * (-1449.522) (-1451.560) [-1447.707] (-1447.325) -- 0:00:31
497500 -- (-1449.456) [-1445.802] (-1446.195) (-1445.612) * [-1447.327] (-1448.338) (-1450.527) (-1447.237) -- 0:00:32
498000 -- (-1449.480) (-1445.826) (-1450.801) [-1445.649] * (-1446.074) (-1447.194) [-1445.598] (-1447.457) -- 0:00:32
498500 -- (-1448.168) [-1448.092] (-1449.700) (-1445.631) * (-1449.551) (-1445.636) (-1445.601) [-1447.437] -- 0:00:32
499000 -- (-1448.278) (-1447.852) [-1445.727] (-1451.865) * [-1445.628] (-1449.393) (-1447.143) (-1448.088) -- 0:00:32
499500 -- [-1448.045] (-1445.407) (-1448.025) (-1451.712) * (-1446.217) (-1446.804) [-1446.094] (-1449.113) -- 0:00:32
500000 -- (-1448.381) (-1447.287) (-1445.861) [-1449.787] * (-1445.703) (-1446.608) [-1446.238] (-1450.987) -- 0:00:32
Average standard deviation of split frequencies: 0.012554
500500 -- [-1445.698] (-1445.194) (-1446.120) (-1447.498) * (-1445.985) (-1446.251) [-1445.508] (-1450.865) -- 0:00:31
501000 -- (-1445.455) (-1445.971) [-1447.444] (-1449.948) * (-1446.267) (-1446.916) [-1445.447] (-1450.225) -- 0:00:31
501500 -- (-1445.501) (-1447.476) [-1447.801] (-1446.788) * [-1446.741] (-1449.967) (-1450.039) (-1452.194) -- 0:00:31
502000 -- (-1446.630) (-1450.906) [-1448.400] (-1450.203) * (-1446.562) (-1447.677) [-1448.777] (-1447.533) -- 0:00:31
502500 -- [-1447.122] (-1447.282) (-1447.640) (-1446.825) * (-1448.918) [-1446.317] (-1446.750) (-1448.931) -- 0:00:31
503000 -- (-1445.915) (-1446.191) (-1446.258) [-1448.333] * (-1449.694) (-1448.009) (-1448.336) [-1448.389] -- 0:00:31
503500 -- (-1446.102) (-1447.955) (-1448.120) [-1447.565] * (-1446.407) (-1450.176) (-1445.662) [-1448.961] -- 0:00:31
504000 -- (-1447.382) [-1447.891] (-1448.943) (-1446.005) * (-1446.367) (-1448.035) [-1447.099] (-1453.088) -- 0:00:31
504500 -- (-1446.930) (-1447.569) (-1448.997) [-1449.543] * (-1446.108) (-1448.202) [-1446.493] (-1449.176) -- 0:00:31
505000 -- (-1446.934) (-1446.846) [-1448.422] (-1447.527) * (-1447.134) (-1445.444) (-1447.201) [-1449.422] -- 0:00:31
Average standard deviation of split frequencies: 0.013457
505500 -- (-1447.671) (-1445.625) (-1448.438) [-1446.172] * (-1448.351) [-1445.526] (-1445.814) (-1448.017) -- 0:00:31
506000 -- [-1451.161] (-1445.644) (-1448.311) (-1446.558) * (-1452.311) (-1445.974) (-1450.834) [-1446.197] -- 0:00:31
506500 -- (-1449.942) [-1447.523] (-1451.637) (-1448.467) * [-1447.083] (-1445.523) (-1446.123) (-1446.566) -- 0:00:31
507000 -- (-1448.410) (-1446.415) (-1446.987) [-1447.424] * (-1446.079) (-1446.905) [-1447.409] (-1450.511) -- 0:00:31
507500 -- (-1446.202) [-1449.721] (-1448.660) (-1445.697) * [-1446.316] (-1446.252) (-1446.946) (-1447.320) -- 0:00:31
508000 -- [-1447.783] (-1447.457) (-1446.459) (-1447.626) * (-1447.309) [-1446.252] (-1449.948) (-1447.308) -- 0:00:30
508500 -- [-1448.483] (-1451.011) (-1448.361) (-1447.439) * (-1452.240) (-1446.218) [-1446.217] (-1448.140) -- 0:00:30
509000 -- [-1445.865] (-1449.294) (-1449.678) (-1446.716) * (-1450.324) [-1445.409] (-1446.875) (-1449.406) -- 0:00:30
509500 -- (-1446.907) (-1448.307) (-1449.135) [-1445.504] * (-1449.871) (-1448.537) (-1451.163) [-1450.754] -- 0:00:30
510000 -- (-1450.277) [-1447.186] (-1448.055) (-1445.943) * [-1449.218] (-1452.100) (-1448.057) (-1448.751) -- 0:00:30
Average standard deviation of split frequencies: 0.013249
510500 -- (-1447.408) (-1447.862) [-1446.046] (-1447.679) * (-1448.781) [-1447.187] (-1445.431) (-1447.199) -- 0:00:30
511000 -- [-1447.102] (-1446.270) (-1446.000) (-1446.429) * (-1448.800) [-1446.880] (-1445.835) (-1447.017) -- 0:00:30
511500 -- (-1446.427) (-1447.732) [-1448.923] (-1450.084) * (-1446.937) (-1446.369) [-1448.051] (-1447.143) -- 0:00:30
512000 -- (-1446.256) (-1450.473) [-1447.108] (-1449.330) * [-1446.923] (-1446.900) (-1451.435) (-1446.603) -- 0:00:30
512500 -- (-1448.003) [-1446.643] (-1448.331) (-1451.155) * (-1446.675) (-1446.777) [-1445.891] (-1446.287) -- 0:00:30
513000 -- (-1445.558) (-1449.723) (-1449.337) [-1448.189] * [-1451.592] (-1446.082) (-1449.301) (-1446.282) -- 0:00:30
513500 -- (-1445.419) [-1450.565] (-1448.445) (-1447.491) * (-1454.952) (-1447.208) (-1450.126) [-1446.267] -- 0:00:31
514000 -- [-1446.893] (-1447.066) (-1449.707) (-1446.669) * (-1448.032) (-1454.667) (-1446.221) [-1445.438] -- 0:00:31
514500 -- (-1449.175) (-1445.400) (-1451.011) [-1447.648] * (-1449.987) (-1451.244) (-1447.901) [-1445.427] -- 0:00:31
515000 -- (-1450.116) [-1446.323] (-1447.953) (-1448.820) * [-1448.759] (-1452.023) (-1448.397) (-1447.932) -- 0:00:31
Average standard deviation of split frequencies: 0.012145
515500 -- (-1447.191) (-1446.041) (-1450.129) [-1445.525] * [-1448.411] (-1447.979) (-1447.317) (-1448.652) -- 0:00:31
516000 -- (-1445.407) (-1445.930) (-1449.968) [-1445.525] * (-1445.700) (-1447.620) [-1447.794] (-1449.498) -- 0:00:30
516500 -- (-1445.406) (-1445.480) (-1446.145) [-1449.590] * [-1448.534] (-1445.924) (-1447.271) (-1446.513) -- 0:00:30
517000 -- [-1446.118] (-1445.218) (-1445.963) (-1450.110) * [-1448.140] (-1450.082) (-1447.628) (-1445.410) -- 0:00:30
517500 -- (-1445.830) (-1447.972) (-1448.920) [-1449.463] * (-1452.027) (-1449.264) (-1446.533) [-1445.841] -- 0:00:30
518000 -- (-1445.747) (-1445.634) [-1446.322] (-1448.167) * [-1447.369] (-1447.417) (-1447.089) (-1446.250) -- 0:00:30
518500 -- (-1446.361) [-1447.153] (-1449.035) (-1446.364) * (-1446.970) [-1447.761] (-1447.959) (-1446.479) -- 0:00:30
519000 -- (-1448.228) [-1446.609] (-1449.946) (-1460.193) * (-1449.856) (-1445.482) (-1446.035) [-1447.348] -- 0:00:30
519500 -- [-1449.009] (-1448.171) (-1445.377) (-1451.515) * (-1449.722) (-1445.980) [-1446.242] (-1446.478) -- 0:00:30
520000 -- (-1448.310) [-1447.137] (-1445.536) (-1447.933) * (-1448.492) (-1450.432) (-1447.336) [-1446.904] -- 0:00:30
Average standard deviation of split frequencies: 0.012303
520500 -- (-1447.109) (-1451.334) (-1448.413) [-1446.251] * (-1448.598) (-1448.064) (-1447.329) [-1450.286] -- 0:00:30
521000 -- (-1447.071) (-1446.631) (-1449.514) [-1446.718] * (-1450.377) (-1448.415) (-1447.461) [-1446.719] -- 0:00:30
521500 -- [-1447.690] (-1450.039) (-1449.985) (-1447.411) * (-1449.107) (-1448.340) (-1445.556) [-1448.402] -- 0:00:30
522000 -- (-1449.984) (-1451.926) (-1449.453) [-1445.830] * (-1445.764) (-1453.354) [-1447.206] (-1448.251) -- 0:00:30
522500 -- (-1452.450) (-1449.525) (-1447.366) [-1446.365] * (-1446.777) [-1453.015] (-1447.284) (-1448.031) -- 0:00:30
523000 -- [-1446.509] (-1449.414) (-1447.534) (-1446.251) * (-1446.417) (-1447.290) [-1445.957] (-1448.624) -- 0:00:30
523500 -- (-1445.860) (-1447.006) (-1447.426) [-1447.921] * (-1445.914) [-1446.435] (-1446.210) (-1447.326) -- 0:00:30
524000 -- (-1450.296) [-1446.893] (-1449.016) (-1449.584) * (-1447.023) (-1446.639) (-1447.084) [-1445.336] -- 0:00:29
524500 -- (-1448.013) (-1446.893) (-1451.238) [-1447.981] * (-1447.123) (-1448.883) (-1445.818) [-1445.315] -- 0:00:29
525000 -- (-1446.517) (-1447.045) (-1453.981) [-1446.200] * (-1446.948) [-1448.563] (-1447.837) (-1445.813) -- 0:00:29
Average standard deviation of split frequencies: 0.011900
525500 -- (-1448.906) (-1451.555) (-1445.813) [-1447.388] * (-1446.270) (-1447.644) [-1450.310] (-1446.745) -- 0:00:29
526000 -- (-1446.273) [-1450.365] (-1450.216) (-1446.672) * (-1447.080) (-1446.224) [-1449.124] (-1447.075) -- 0:00:29
526500 -- (-1445.373) (-1450.397) [-1450.643] (-1446.977) * (-1447.480) (-1446.907) [-1448.126] (-1446.376) -- 0:00:29
527000 -- (-1448.944) [-1447.492] (-1445.656) (-1445.692) * (-1448.813) (-1446.443) [-1445.713] (-1445.532) -- 0:00:29
527500 -- (-1451.487) (-1447.833) (-1446.378) [-1445.964] * [-1449.818] (-1446.463) (-1445.490) (-1447.513) -- 0:00:29
528000 -- (-1449.442) [-1447.635] (-1447.288) (-1447.382) * (-1447.335) [-1446.557] (-1447.790) (-1447.954) -- 0:00:29
528500 -- (-1447.731) (-1446.788) [-1448.180] (-1446.606) * (-1447.273) [-1448.255] (-1447.428) (-1445.723) -- 0:00:29
529000 -- (-1447.532) [-1445.706] (-1448.462) (-1447.893) * [-1446.874] (-1447.235) (-1450.693) (-1448.516) -- 0:00:30
529500 -- (-1446.845) [-1447.254] (-1449.916) (-1446.217) * (-1447.284) (-1446.624) [-1447.496] (-1449.483) -- 0:00:30
530000 -- (-1446.653) (-1447.369) [-1446.284] (-1446.549) * (-1451.472) (-1445.930) [-1447.589] (-1446.044) -- 0:00:30
Average standard deviation of split frequencies: 0.011160
530500 -- [-1447.285] (-1448.296) (-1447.920) (-1445.908) * [-1446.129] (-1445.604) (-1451.204) (-1446.751) -- 0:00:30
531000 -- [-1447.919] (-1447.995) (-1447.161) (-1445.585) * (-1446.912) (-1447.251) [-1447.744] (-1446.508) -- 0:00:30
531500 -- (-1447.158) (-1450.269) [-1448.511] (-1445.413) * (-1450.346) (-1445.281) (-1450.440) [-1445.700] -- 0:00:29
532000 -- (-1447.282) (-1448.804) [-1448.106] (-1445.422) * (-1446.767) [-1446.438] (-1451.267) (-1447.791) -- 0:00:29
532500 -- [-1446.871] (-1449.804) (-1447.966) (-1445.491) * [-1446.331] (-1445.805) (-1451.009) (-1445.136) -- 0:00:29
533000 -- (-1446.906) (-1447.367) (-1446.761) [-1451.171] * (-1445.688) (-1447.282) [-1447.513] (-1445.136) -- 0:00:29
533500 -- (-1446.479) [-1447.621] (-1446.577) (-1448.420) * (-1446.967) (-1445.607) (-1445.707) [-1445.945] -- 0:00:29
534000 -- [-1445.947] (-1446.550) (-1449.930) (-1447.339) * (-1447.348) [-1446.851] (-1447.757) (-1448.264) -- 0:00:29
534500 -- [-1448.962] (-1449.827) (-1446.398) (-1447.059) * [-1446.290] (-1446.132) (-1446.197) (-1449.320) -- 0:00:29
535000 -- (-1447.249) (-1448.523) [-1447.293] (-1446.730) * (-1446.049) (-1446.093) (-1445.693) [-1449.750] -- 0:00:29
Average standard deviation of split frequencies: 0.010719
535500 -- (-1446.584) (-1448.605) [-1446.267] (-1451.051) * [-1448.582] (-1445.543) (-1446.881) (-1449.132) -- 0:00:29
536000 -- (-1446.225) (-1449.197) (-1446.500) [-1446.472] * (-1447.605) [-1447.235] (-1454.152) (-1447.454) -- 0:00:29
536500 -- (-1451.457) [-1446.481] (-1446.036) (-1448.655) * [-1445.913] (-1447.741) (-1448.194) (-1446.565) -- 0:00:29
537000 -- (-1446.407) [-1446.563] (-1448.457) (-1450.282) * (-1448.367) (-1447.760) (-1447.458) [-1445.833] -- 0:00:29
537500 -- (-1446.416) (-1446.290) [-1450.199] (-1452.000) * (-1448.630) (-1446.218) (-1447.038) [-1446.865] -- 0:00:29
538000 -- (-1449.108) (-1450.658) (-1446.047) [-1446.939] * (-1447.205) (-1446.205) (-1447.157) [-1448.638] -- 0:00:29
538500 -- [-1445.888] (-1446.544) (-1447.063) (-1447.643) * (-1445.634) [-1447.026] (-1447.558) (-1447.058) -- 0:00:29
539000 -- [-1445.347] (-1448.766) (-1449.134) (-1449.548) * (-1445.488) [-1448.320] (-1448.627) (-1447.263) -- 0:00:29
539500 -- (-1450.921) [-1446.423] (-1447.541) (-1448.783) * (-1445.871) [-1447.937] (-1447.546) (-1446.554) -- 0:00:29
540000 -- (-1448.044) [-1447.620] (-1447.932) (-1448.496) * (-1445.698) (-1447.334) (-1446.821) [-1448.706] -- 0:00:28
Average standard deviation of split frequencies: 0.010899
540500 -- [-1447.750] (-1446.852) (-1449.809) (-1448.183) * [-1445.833] (-1448.204) (-1447.988) (-1449.887) -- 0:00:28
541000 -- (-1446.568) [-1448.544] (-1446.913) (-1447.113) * (-1450.298) (-1450.648) [-1446.651] (-1446.564) -- 0:00:28
541500 -- (-1446.849) (-1445.633) [-1447.208] (-1447.568) * (-1446.453) (-1448.437) (-1446.554) [-1446.116] -- 0:00:28
542000 -- (-1449.058) (-1448.560) [-1449.171] (-1446.819) * (-1448.638) [-1446.340] (-1449.114) (-1446.453) -- 0:00:28
542500 -- (-1447.206) (-1452.624) [-1447.479] (-1447.660) * [-1449.664] (-1447.893) (-1450.576) (-1448.373) -- 0:00:28
543000 -- (-1447.186) (-1447.405) (-1446.760) [-1446.060] * (-1446.872) [-1445.546] (-1450.022) (-1449.965) -- 0:00:28
543500 -- [-1447.334] (-1447.396) (-1445.803) (-1445.682) * (-1447.272) [-1447.174] (-1449.310) (-1446.271) -- 0:00:28
544000 -- [-1446.562] (-1447.298) (-1445.520) (-1445.858) * [-1447.151] (-1448.529) (-1447.042) (-1448.415) -- 0:00:28
544500 -- (-1447.121) (-1448.506) [-1449.874] (-1450.328) * (-1446.864) (-1447.128) [-1447.570] (-1447.188) -- 0:00:28
545000 -- (-1447.239) [-1449.274] (-1449.612) (-1447.042) * (-1447.825) (-1448.712) [-1445.836] (-1448.625) -- 0:00:28
Average standard deviation of split frequencies: 0.011386
545500 -- (-1446.938) (-1447.240) (-1453.237) [-1447.740] * (-1447.277) [-1447.594] (-1447.010) (-1453.617) -- 0:00:29
546000 -- (-1453.903) (-1447.806) (-1447.459) [-1447.685] * [-1447.267] (-1446.791) (-1446.203) (-1448.690) -- 0:00:29
546500 -- (-1454.003) [-1446.704] (-1448.770) (-1449.274) * [-1446.033] (-1445.879) (-1447.594) (-1447.552) -- 0:00:29
547000 -- [-1447.389] (-1447.408) (-1446.298) (-1449.419) * [-1448.412] (-1449.483) (-1450.274) (-1448.348) -- 0:00:28
547500 -- (-1448.897) (-1447.823) [-1448.426] (-1449.096) * (-1446.696) (-1446.987) [-1447.972] (-1454.126) -- 0:00:28
548000 -- (-1448.816) (-1447.423) [-1447.539] (-1452.775) * (-1446.439) [-1446.390] (-1446.287) (-1452.199) -- 0:00:28
548500 -- (-1446.295) (-1445.966) [-1447.814] (-1452.174) * (-1445.896) (-1446.522) (-1448.952) [-1451.357] -- 0:00:28
549000 -- (-1447.349) (-1445.882) (-1446.901) [-1447.837] * (-1446.487) (-1447.256) [-1448.697] (-1455.400) -- 0:00:28
549500 -- (-1447.079) (-1448.210) [-1447.816] (-1448.170) * (-1446.654) (-1446.979) [-1446.977] (-1450.617) -- 0:00:28
550000 -- (-1446.611) [-1447.491] (-1449.117) (-1448.815) * (-1446.352) (-1446.231) [-1450.110] (-1447.797) -- 0:00:28
Average standard deviation of split frequencies: 0.011610
550500 -- (-1447.979) (-1446.336) [-1447.544] (-1447.879) * (-1447.213) (-1447.955) [-1448.592] (-1446.560) -- 0:00:28
551000 -- (-1448.013) [-1447.628] (-1449.358) (-1447.361) * (-1445.600) (-1449.106) (-1447.919) [-1447.442] -- 0:00:28
551500 -- (-1450.600) (-1452.962) [-1449.023] (-1445.992) * [-1445.469] (-1445.948) (-1450.474) (-1447.372) -- 0:00:28
552000 -- (-1446.303) (-1450.049) [-1446.757] (-1446.906) * [-1447.378] (-1445.897) (-1447.412) (-1446.924) -- 0:00:28
552500 -- (-1449.473) [-1451.377] (-1452.046) (-1446.352) * (-1447.240) [-1445.973] (-1447.322) (-1452.346) -- 0:00:28
553000 -- (-1448.538) (-1451.039) [-1445.728] (-1446.336) * (-1453.547) (-1447.912) [-1448.850] (-1447.072) -- 0:00:28
553500 -- [-1449.254] (-1450.280) (-1449.224) (-1447.424) * (-1449.102) (-1446.611) [-1447.253] (-1445.644) -- 0:00:28
554000 -- (-1448.732) (-1445.398) [-1448.497] (-1447.951) * (-1446.181) (-1448.655) (-1446.790) [-1446.266] -- 0:00:28
554500 -- (-1448.150) (-1446.338) [-1449.123] (-1448.595) * (-1449.263) [-1445.711] (-1445.531) (-1447.099) -- 0:00:28
555000 -- (-1449.165) [-1448.472] (-1446.728) (-1448.011) * (-1447.004) (-1445.556) [-1449.780] (-1446.135) -- 0:00:28
Average standard deviation of split frequencies: 0.011923
555500 -- (-1448.516) (-1447.639) (-1446.684) [-1447.661] * (-1449.775) [-1448.537] (-1447.461) (-1446.488) -- 0:00:28
556000 -- (-1447.661) (-1445.880) (-1446.675) [-1446.634] * [-1449.265] (-1449.118) (-1445.801) (-1449.343) -- 0:00:27
556500 -- (-1446.508) (-1447.323) [-1446.155] (-1446.740) * (-1445.396) [-1450.161] (-1447.262) (-1447.856) -- 0:00:27
557000 -- (-1445.985) (-1451.561) (-1445.740) [-1446.264] * [-1447.480] (-1447.554) (-1447.742) (-1445.962) -- 0:00:27
557500 -- (-1447.978) (-1449.177) [-1447.903] (-1445.650) * (-1447.896) [-1447.109] (-1448.567) (-1448.724) -- 0:00:27
558000 -- (-1449.516) (-1449.434) (-1453.598) [-1446.205] * (-1447.277) (-1446.313) (-1450.503) [-1447.055] -- 0:00:27
558500 -- (-1447.726) [-1449.997] (-1447.347) (-1445.797) * (-1450.400) (-1445.524) (-1448.371) [-1447.357] -- 0:00:27
559000 -- (-1448.694) (-1446.436) (-1447.465) [-1446.160] * (-1449.529) (-1447.064) [-1446.711] (-1446.588) -- 0:00:27
559500 -- (-1447.603) (-1445.465) [-1454.064] (-1450.343) * (-1447.798) [-1446.542] (-1445.543) (-1445.838) -- 0:00:27
560000 -- [-1446.213] (-1447.320) (-1448.935) (-1446.615) * (-1445.713) (-1446.530) [-1447.409] (-1447.390) -- 0:00:27
Average standard deviation of split frequencies: 0.010983
560500 -- (-1447.120) (-1448.422) (-1448.195) [-1448.123] * (-1445.723) (-1446.549) [-1446.904] (-1448.597) -- 0:00:27
561000 -- (-1446.347) [-1448.750] (-1447.487) (-1447.662) * [-1445.755] (-1447.902) (-1446.407) (-1450.409) -- 0:00:28
561500 -- (-1452.478) (-1448.701) (-1449.131) [-1448.685] * (-1448.191) [-1450.947] (-1448.215) (-1447.829) -- 0:00:28
562000 -- [-1453.322] (-1448.786) (-1446.874) (-1447.179) * (-1449.586) (-1453.117) (-1447.749) [-1446.315] -- 0:00:28
562500 -- (-1450.377) (-1446.284) [-1446.348] (-1448.156) * (-1447.498) [-1451.743] (-1447.353) (-1446.035) -- 0:00:28
563000 -- (-1447.272) (-1447.248) [-1446.248] (-1446.711) * (-1449.419) (-1451.566) [-1448.720] (-1447.468) -- 0:00:27
563500 -- [-1447.079] (-1447.579) (-1446.188) (-1448.720) * (-1446.681) (-1453.852) (-1449.783) [-1449.509] -- 0:00:27
564000 -- (-1446.621) (-1448.211) (-1447.226) [-1449.914] * (-1447.143) (-1446.407) (-1449.098) [-1448.085] -- 0:00:27
564500 -- (-1446.986) [-1445.673] (-1449.509) (-1446.533) * (-1450.023) [-1446.395] (-1451.856) (-1448.119) -- 0:00:27
565000 -- (-1447.911) (-1446.031) [-1451.185] (-1448.198) * (-1446.518) [-1446.344] (-1447.097) (-1449.343) -- 0:00:27
Average standard deviation of split frequencies: 0.011036
565500 -- [-1448.438] (-1446.947) (-1451.284) (-1446.631) * (-1450.034) (-1450.592) [-1446.436] (-1445.935) -- 0:00:27
566000 -- (-1450.068) (-1445.654) (-1446.066) [-1447.530] * (-1450.411) (-1448.904) (-1446.936) [-1449.095] -- 0:00:27
566500 -- (-1446.737) [-1447.989] (-1447.073) (-1447.224) * [-1448.383] (-1447.497) (-1450.307) (-1455.188) -- 0:00:27
567000 -- (-1446.738) (-1450.037) [-1447.960] (-1446.197) * (-1447.908) [-1446.325] (-1452.262) (-1447.635) -- 0:00:27
567500 -- (-1446.381) (-1446.240) (-1447.292) [-1448.996] * (-1447.420) (-1445.441) (-1452.540) [-1448.324] -- 0:00:27
568000 -- [-1447.450] (-1446.538) (-1447.313) (-1446.386) * (-1449.507) [-1445.361] (-1453.506) (-1446.274) -- 0:00:27
568500 -- (-1450.958) [-1446.695] (-1447.035) (-1446.608) * (-1448.277) [-1447.183] (-1449.429) (-1449.208) -- 0:00:27
569000 -- [-1447.403] (-1445.916) (-1445.632) (-1447.399) * (-1447.535) [-1449.527] (-1446.669) (-1451.063) -- 0:00:27
569500 -- (-1447.878) (-1446.601) [-1451.509] (-1449.225) * [-1447.907] (-1447.348) (-1449.184) (-1447.079) -- 0:00:27
570000 -- (-1446.607) (-1446.937) (-1446.649) [-1447.648] * (-1446.986) [-1446.991] (-1446.911) (-1447.136) -- 0:00:27
Average standard deviation of split frequencies: 0.009573
570500 -- [-1446.341] (-1446.971) (-1447.665) (-1449.381) * (-1446.057) [-1445.444] (-1445.275) (-1449.883) -- 0:00:27
571000 -- [-1446.168] (-1449.512) (-1446.074) (-1448.128) * (-1447.029) (-1448.720) (-1446.395) [-1448.521] -- 0:00:27
571500 -- (-1447.563) (-1449.351) [-1445.637] (-1445.959) * (-1446.725) [-1447.288] (-1448.513) (-1449.336) -- 0:00:26
572000 -- [-1447.315] (-1449.651) (-1446.250) (-1445.871) * (-1449.328) [-1446.157] (-1447.489) (-1447.766) -- 0:00:26
572500 -- (-1446.809) (-1450.800) (-1445.549) [-1445.286] * [-1446.200] (-1449.047) (-1447.437) (-1449.028) -- 0:00:26
573000 -- [-1447.962] (-1445.557) (-1447.948) (-1447.030) * [-1446.076] (-1450.427) (-1446.513) (-1446.881) -- 0:00:26
573500 -- (-1448.596) [-1446.977] (-1448.190) (-1448.355) * (-1446.065) [-1446.369] (-1448.475) (-1449.161) -- 0:00:26
574000 -- [-1449.001] (-1445.439) (-1448.497) (-1450.012) * [-1446.390] (-1448.612) (-1446.927) (-1451.222) -- 0:00:26
574500 -- (-1445.787) (-1447.033) (-1446.582) [-1446.353] * (-1447.550) (-1446.475) (-1446.306) [-1447.865] -- 0:00:26
575000 -- (-1449.268) [-1445.296] (-1446.284) (-1447.401) * (-1448.536) (-1446.810) (-1445.860) [-1445.930] -- 0:00:26
Average standard deviation of split frequencies: 0.009436
575500 -- (-1446.482) [-1445.995] (-1446.966) (-1447.270) * (-1447.170) [-1447.868] (-1445.916) (-1447.107) -- 0:00:26
576000 -- [-1446.602] (-1449.934) (-1447.413) (-1446.633) * (-1447.445) (-1445.682) [-1446.905] (-1447.395) -- 0:00:26
576500 -- (-1446.490) (-1448.850) (-1446.119) [-1448.443] * (-1448.018) (-1449.389) (-1446.735) [-1446.153] -- 0:00:26
577000 -- (-1450.843) (-1446.337) [-1446.206] (-1447.293) * (-1451.329) (-1447.908) [-1450.301] (-1446.246) -- 0:00:27
577500 -- [-1447.697] (-1449.436) (-1446.257) (-1449.210) * (-1449.067) [-1447.504] (-1448.468) (-1447.457) -- 0:00:27
578000 -- (-1447.273) (-1446.803) [-1446.225] (-1447.597) * (-1449.341) [-1447.616] (-1447.787) (-1447.456) -- 0:00:27
578500 -- (-1446.236) [-1447.641] (-1446.659) (-1447.215) * (-1449.304) (-1449.323) (-1447.068) [-1447.457] -- 0:00:26
579000 -- (-1447.378) [-1447.621] (-1451.342) (-1447.030) * (-1446.218) (-1446.747) [-1450.866] (-1448.001) -- 0:00:26
579500 -- [-1446.513] (-1448.276) (-1449.032) (-1448.523) * (-1446.926) (-1446.247) [-1446.170] (-1449.150) -- 0:00:26
580000 -- (-1447.815) (-1446.383) [-1448.968] (-1454.323) * (-1448.030) (-1446.572) (-1446.468) [-1447.567] -- 0:00:26
Average standard deviation of split frequencies: 0.009408
580500 -- (-1455.642) (-1446.369) [-1448.203] (-1462.007) * (-1450.329) [-1445.618] (-1445.982) (-1447.698) -- 0:00:26
581000 -- (-1447.779) [-1449.208] (-1448.798) (-1451.267) * [-1446.103] (-1451.697) (-1448.999) (-1445.986) -- 0:00:26
581500 -- [-1448.783] (-1447.552) (-1447.582) (-1448.063) * (-1446.200) (-1453.267) [-1446.152] (-1448.757) -- 0:00:26
582000 -- (-1447.417) (-1447.666) [-1449.735] (-1447.570) * (-1445.881) [-1448.382] (-1447.169) (-1447.200) -- 0:00:26
582500 -- [-1446.145] (-1448.166) (-1450.524) (-1448.714) * [-1446.760] (-1452.542) (-1446.474) (-1446.052) -- 0:00:26
583000 -- [-1446.790] (-1448.706) (-1446.444) (-1446.904) * (-1446.731) (-1446.953) (-1447.055) [-1450.207] -- 0:00:26
583500 -- (-1447.038) (-1447.797) [-1448.910] (-1446.692) * (-1446.491) (-1449.680) [-1446.374] (-1449.366) -- 0:00:26
584000 -- (-1446.892) (-1448.215) [-1449.843] (-1448.258) * [-1446.881] (-1447.087) (-1450.054) (-1446.852) -- 0:00:26
584500 -- (-1448.032) (-1446.808) (-1450.623) [-1450.210] * (-1447.892) [-1447.042] (-1446.061) (-1448.225) -- 0:00:26
585000 -- (-1445.671) (-1449.467) [-1448.796] (-1448.635) * (-1446.394) (-1445.570) [-1446.828] (-1445.571) -- 0:00:26
Average standard deviation of split frequencies: 0.009417
585500 -- (-1446.024) [-1447.428] (-1446.030) (-1450.673) * (-1448.188) [-1447.073] (-1446.521) (-1445.999) -- 0:00:26
586000 -- (-1445.820) (-1446.018) (-1446.070) [-1450.064] * (-1447.994) (-1446.534) [-1447.725] (-1446.315) -- 0:00:26
586500 -- (-1445.823) [-1446.176] (-1445.964) (-1448.857) * [-1445.855] (-1445.595) (-1448.669) (-1451.224) -- 0:00:26
587000 -- (-1445.936) (-1448.429) (-1449.015) [-1447.547] * (-1445.361) (-1448.599) [-1448.753] (-1447.526) -- 0:00:26
587500 -- (-1447.180) (-1445.424) [-1445.167] (-1447.773) * (-1446.541) (-1448.617) [-1449.026] (-1447.897) -- 0:00:25
588000 -- [-1450.873] (-1447.158) (-1448.365) (-1446.814) * (-1449.537) [-1448.490] (-1448.734) (-1446.159) -- 0:00:25
588500 -- (-1453.564) [-1446.799] (-1448.064) (-1446.802) * (-1449.056) (-1447.263) (-1455.316) [-1445.560] -- 0:00:25
589000 -- [-1446.594] (-1447.804) (-1448.293) (-1451.447) * [-1449.169] (-1448.911) (-1447.948) (-1446.989) -- 0:00:25
589500 -- (-1447.218) (-1446.856) (-1446.474) [-1448.551] * (-1448.414) (-1445.310) [-1449.887] (-1448.475) -- 0:00:25
590000 -- (-1445.541) [-1448.010] (-1448.455) (-1445.586) * (-1450.604) (-1451.968) [-1447.318] (-1448.761) -- 0:00:25
Average standard deviation of split frequencies: 0.009389
590500 -- (-1450.616) (-1447.666) (-1450.860) [-1447.125] * (-1454.617) (-1449.068) [-1446.350] (-1446.758) -- 0:00:25
591000 -- [-1447.919] (-1452.480) (-1447.143) (-1448.591) * (-1447.443) [-1448.262] (-1448.081) (-1449.116) -- 0:00:25
591500 -- (-1447.113) [-1448.769] (-1446.699) (-1447.057) * (-1447.510) (-1446.577) (-1448.718) [-1446.831] -- 0:00:25
592000 -- (-1447.367) [-1446.501] (-1447.877) (-1448.198) * (-1446.199) (-1446.163) (-1449.640) [-1449.637] -- 0:00:25
592500 -- [-1448.131] (-1445.487) (-1447.357) (-1450.295) * (-1446.971) (-1446.004) (-1449.139) [-1446.240] -- 0:00:25
593000 -- [-1448.061] (-1447.159) (-1446.838) (-1449.651) * (-1446.762) (-1446.548) (-1447.827) [-1446.257] -- 0:00:26
593500 -- (-1449.474) [-1446.166] (-1452.951) (-1451.925) * (-1447.679) [-1445.601] (-1446.762) (-1450.038) -- 0:00:26
594000 -- (-1446.437) (-1446.035) (-1449.185) [-1447.253] * (-1447.315) (-1445.632) [-1446.406] (-1453.454) -- 0:00:25
594500 -- (-1447.277) (-1445.694) (-1447.674) [-1446.762] * [-1446.269] (-1445.648) (-1446.434) (-1447.711) -- 0:00:25
595000 -- (-1448.821) [-1447.459] (-1446.185) (-1445.242) * [-1448.173] (-1445.534) (-1449.518) (-1447.248) -- 0:00:25
Average standard deviation of split frequencies: 0.009259
595500 -- [-1447.014] (-1448.769) (-1446.208) (-1447.902) * (-1448.642) [-1447.909] (-1449.010) (-1447.042) -- 0:00:25
596000 -- (-1446.072) [-1447.468] (-1445.750) (-1448.542) * (-1449.138) (-1447.648) (-1446.547) [-1446.827] -- 0:00:25
596500 -- (-1451.609) (-1446.730) [-1445.389] (-1455.752) * (-1449.127) (-1451.359) (-1450.363) [-1446.278] -- 0:00:25
597000 -- [-1447.775] (-1451.755) (-1447.106) (-1447.183) * (-1447.379) [-1446.877] (-1453.094) (-1448.334) -- 0:00:25
597500 -- (-1447.112) (-1451.311) (-1446.568) [-1447.500] * (-1451.319) [-1446.496] (-1446.646) (-1445.450) -- 0:00:25
598000 -- [-1446.589] (-1448.198) (-1447.244) (-1447.390) * (-1447.914) (-1447.316) (-1446.115) [-1445.344] -- 0:00:25
598500 -- (-1447.657) [-1447.769] (-1446.973) (-1447.462) * (-1447.780) (-1448.252) (-1447.584) [-1445.392] -- 0:00:25
599000 -- [-1445.501] (-1447.898) (-1446.045) (-1449.526) * (-1447.358) [-1445.961] (-1451.599) (-1446.718) -- 0:00:25
599500 -- (-1447.135) [-1447.296] (-1445.257) (-1448.498) * (-1448.926) [-1446.052] (-1447.554) (-1446.816) -- 0:00:25
600000 -- (-1447.378) (-1447.742) [-1448.714] (-1446.670) * (-1452.323) [-1448.343] (-1449.899) (-1446.224) -- 0:00:25
Average standard deviation of split frequencies: 0.008780
600500 -- (-1447.398) [-1447.924] (-1446.178) (-1448.331) * (-1448.681) (-1445.407) [-1449.907] (-1448.182) -- 0:00:25
601000 -- (-1447.344) (-1445.564) (-1447.597) [-1446.541] * (-1449.825) (-1445.721) (-1449.920) [-1448.546] -- 0:00:25
601500 -- (-1451.541) (-1453.249) (-1445.445) [-1447.224] * (-1450.117) [-1448.248] (-1453.248) (-1446.153) -- 0:00:25
602000 -- (-1449.007) [-1448.485] (-1449.767) (-1445.824) * [-1447.785] (-1445.968) (-1448.985) (-1446.509) -- 0:00:25
602500 -- (-1446.840) [-1451.720] (-1450.276) (-1447.904) * (-1451.568) (-1448.061) [-1447.053] (-1446.969) -- 0:00:25
603000 -- (-1448.057) (-1445.809) (-1446.898) [-1448.329] * (-1452.601) (-1447.167) (-1452.101) [-1445.386] -- 0:00:25
603500 -- (-1445.872) (-1447.880) [-1447.561] (-1447.962) * (-1448.760) [-1446.932] (-1452.772) (-1448.543) -- 0:00:24
604000 -- [-1446.290] (-1446.345) (-1447.286) (-1449.881) * (-1448.184) (-1449.739) [-1447.986] (-1449.192) -- 0:00:24
604500 -- (-1447.798) (-1447.308) [-1449.420] (-1448.939) * [-1446.739] (-1450.472) (-1448.003) (-1446.077) -- 0:00:24
605000 -- (-1446.645) (-1447.309) (-1449.047) [-1447.628] * (-1449.600) (-1449.157) [-1449.101] (-1448.891) -- 0:00:24
Average standard deviation of split frequencies: 0.008877
605500 -- (-1448.321) (-1451.915) [-1447.882] (-1447.072) * (-1449.382) [-1446.037] (-1447.776) (-1446.388) -- 0:00:24
606000 -- (-1448.314) (-1447.863) (-1445.542) [-1447.608] * (-1450.097) [-1445.858] (-1447.933) (-1447.315) -- 0:00:24
606500 -- (-1449.405) (-1445.718) [-1452.265] (-1446.890) * [-1446.271] (-1445.740) (-1451.478) (-1450.608) -- 0:00:24
607000 -- (-1446.897) [-1446.501] (-1449.975) (-1450.516) * (-1446.849) (-1446.692) (-1446.678) [-1446.667] -- 0:00:24
607500 -- [-1445.595] (-1446.538) (-1447.380) (-1451.981) * [-1448.798] (-1448.275) (-1448.106) (-1446.284) -- 0:00:24
608000 -- (-1446.662) (-1450.871) (-1446.526) [-1450.059] * (-1447.420) (-1448.732) [-1447.715] (-1445.600) -- 0:00:24
608500 -- (-1445.389) [-1447.521] (-1447.796) (-1451.322) * [-1447.877] (-1448.228) (-1449.335) (-1446.187) -- 0:00:24
609000 -- (-1446.799) (-1448.816) [-1447.986] (-1447.779) * (-1446.140) (-1447.078) (-1448.438) [-1445.689] -- 0:00:25
609500 -- (-1448.631) (-1446.380) [-1447.903] (-1446.623) * [-1447.861] (-1449.291) (-1447.795) (-1446.214) -- 0:00:24
610000 -- (-1446.226) (-1446.032) (-1447.724) [-1448.105] * [-1447.470] (-1448.469) (-1446.798) (-1451.779) -- 0:00:24
Average standard deviation of split frequencies: 0.009218
610500 -- [-1446.000] (-1448.039) (-1446.825) (-1447.729) * [-1445.557] (-1446.833) (-1449.684) (-1448.594) -- 0:00:24
611000 -- (-1448.684) (-1451.429) [-1446.778] (-1446.441) * (-1445.932) [-1446.460] (-1448.738) (-1448.020) -- 0:00:24
611500 -- (-1445.819) (-1445.753) [-1454.486] (-1447.751) * [-1447.922] (-1446.358) (-1448.122) (-1452.410) -- 0:00:24
612000 -- [-1449.377] (-1445.602) (-1448.012) (-1448.665) * [-1446.490] (-1449.827) (-1447.559) (-1446.834) -- 0:00:24
612500 -- [-1446.638] (-1446.981) (-1448.642) (-1450.596) * (-1449.098) [-1450.335] (-1446.421) (-1445.468) -- 0:00:24
613000 -- [-1448.224] (-1452.777) (-1449.401) (-1454.021) * (-1447.482) (-1449.283) [-1449.281] (-1449.217) -- 0:00:24
613500 -- (-1448.066) [-1448.901] (-1448.427) (-1447.591) * [-1449.139] (-1447.069) (-1447.800) (-1449.838) -- 0:00:24
614000 -- (-1445.424) [-1450.524] (-1450.103) (-1446.966) * (-1448.404) (-1446.158) [-1447.483] (-1447.049) -- 0:00:24
614500 -- (-1446.988) (-1447.610) (-1452.429) [-1447.494] * [-1449.143] (-1446.673) (-1446.372) (-1447.762) -- 0:00:24
615000 -- [-1446.984] (-1446.825) (-1452.680) (-1449.661) * (-1449.114) (-1449.155) [-1445.432] (-1449.095) -- 0:00:24
Average standard deviation of split frequencies: 0.009948
615500 -- (-1447.310) [-1447.830] (-1450.569) (-1448.190) * (-1447.974) [-1447.303] (-1450.569) (-1449.832) -- 0:00:24
616000 -- [-1448.344] (-1446.998) (-1447.115) (-1446.051) * (-1447.930) (-1448.004) (-1451.202) [-1446.349] -- 0:00:24
616500 -- (-1448.376) (-1446.474) [-1445.612] (-1447.676) * (-1448.182) (-1447.120) [-1447.394] (-1445.883) -- 0:00:24
617000 -- (-1447.818) (-1447.872) (-1445.465) [-1449.748] * (-1452.383) [-1446.903] (-1447.228) (-1448.390) -- 0:00:24
617500 -- [-1446.209] (-1447.553) (-1445.475) (-1446.736) * [-1448.282] (-1446.133) (-1446.031) (-1447.376) -- 0:00:24
618000 -- (-1446.700) (-1449.529) [-1445.408] (-1445.655) * (-1451.581) [-1448.411] (-1452.194) (-1446.116) -- 0:00:24
618500 -- (-1448.816) [-1450.187] (-1446.990) (-1447.122) * [-1446.740] (-1448.153) (-1446.201) (-1446.286) -- 0:00:24
619000 -- (-1445.817) (-1450.967) [-1447.489] (-1446.758) * (-1446.950) (-1448.632) (-1458.060) [-1445.886] -- 0:00:24
619500 -- (-1446.742) (-1447.245) (-1446.878) [-1447.769] * (-1448.482) (-1447.330) [-1447.911] (-1448.348) -- 0:00:23
620000 -- [-1445.984] (-1446.735) (-1446.402) (-1446.749) * (-1448.484) [-1448.442] (-1446.812) (-1449.147) -- 0:00:23
Average standard deviation of split frequencies: 0.008782
620500 -- [-1448.679] (-1447.604) (-1447.618) (-1452.159) * [-1446.840] (-1446.146) (-1453.758) (-1447.628) -- 0:00:23
621000 -- [-1446.378] (-1449.463) (-1447.740) (-1449.472) * (-1447.360) [-1447.571] (-1453.944) (-1450.526) -- 0:00:23
621500 -- [-1446.269] (-1448.858) (-1448.575) (-1449.185) * (-1455.264) [-1450.045] (-1448.118) (-1448.428) -- 0:00:23
622000 -- (-1453.993) [-1447.958] (-1447.989) (-1445.348) * (-1451.978) [-1447.829] (-1446.855) (-1445.786) -- 0:00:23
622500 -- (-1447.724) (-1448.238) [-1445.372] (-1448.132) * (-1445.589) (-1447.220) (-1449.935) [-1448.279] -- 0:00:23
623000 -- (-1448.928) [-1446.863] (-1445.353) (-1447.900) * [-1445.790] (-1449.304) (-1451.783) (-1447.202) -- 0:00:23
623500 -- (-1449.994) (-1446.736) [-1454.045] (-1449.632) * (-1447.871) (-1446.330) (-1446.701) [-1445.931] -- 0:00:23
624000 -- (-1451.482) (-1449.595) (-1448.398) [-1447.347] * (-1449.153) (-1446.229) [-1447.292] (-1448.289) -- 0:00:24
624500 -- (-1447.736) (-1452.241) [-1448.047] (-1446.946) * [-1448.251] (-1447.438) (-1447.740) (-1448.890) -- 0:00:24
625000 -- (-1448.332) (-1446.179) [-1448.479] (-1449.522) * (-1448.192) (-1447.701) [-1447.722] (-1447.780) -- 0:00:24
Average standard deviation of split frequencies: 0.008989
625500 -- (-1449.374) (-1446.456) [-1445.784] (-1449.774) * (-1448.891) (-1447.172) (-1447.449) [-1448.197] -- 0:00:23
626000 -- (-1450.511) [-1446.975] (-1450.271) (-1451.243) * (-1452.186) (-1447.407) (-1448.558) [-1447.988] -- 0:00:23
626500 -- (-1450.290) [-1448.205] (-1446.651) (-1446.742) * [-1449.146] (-1446.609) (-1445.776) (-1451.400) -- 0:00:23
627000 -- [-1448.401] (-1446.938) (-1448.876) (-1446.087) * (-1449.769) (-1449.432) [-1447.343] (-1451.824) -- 0:00:23
627500 -- (-1450.924) [-1449.849] (-1446.216) (-1452.550) * (-1448.418) (-1448.637) [-1448.779] (-1451.078) -- 0:00:23
628000 -- (-1447.719) (-1447.554) (-1448.103) [-1448.909] * (-1448.395) (-1447.392) (-1461.471) [-1450.487] -- 0:00:23
628500 -- (-1445.990) (-1447.372) [-1447.997] (-1448.397) * (-1447.981) (-1451.181) [-1447.057] (-1446.841) -- 0:00:23
629000 -- (-1446.608) [-1445.827] (-1445.897) (-1453.613) * (-1446.588) [-1446.827] (-1447.845) (-1446.872) -- 0:00:23
629500 -- [-1447.175] (-1448.578) (-1447.052) (-1446.875) * (-1449.262) [-1445.588] (-1448.173) (-1446.710) -- 0:00:23
630000 -- (-1447.897) (-1449.874) [-1447.801] (-1445.732) * [-1449.260] (-1447.218) (-1447.644) (-1447.265) -- 0:00:23
Average standard deviation of split frequencies: 0.008970
630500 -- (-1450.012) (-1448.958) [-1450.414] (-1446.726) * (-1451.696) (-1446.701) (-1447.398) [-1446.498] -- 0:00:23
631000 -- (-1446.931) (-1447.278) (-1449.317) [-1448.946] * (-1452.156) [-1447.088] (-1446.676) (-1447.400) -- 0:00:23
631500 -- [-1446.781] (-1447.693) (-1446.739) (-1446.476) * (-1446.887) (-1447.527) (-1449.653) [-1446.084] -- 0:00:23
632000 -- [-1447.968] (-1446.783) (-1447.240) (-1445.308) * [-1448.797] (-1447.569) (-1445.920) (-1446.597) -- 0:00:23
632500 -- (-1446.510) [-1445.430] (-1446.989) (-1445.871) * (-1447.814) (-1448.295) (-1446.060) [-1447.678] -- 0:00:23
633000 -- (-1447.332) (-1447.068) (-1448.812) [-1446.687] * (-1449.810) [-1447.676] (-1448.503) (-1448.180) -- 0:00:23
633500 -- [-1446.033] (-1448.406) (-1453.075) (-1451.593) * (-1453.682) (-1445.906) (-1447.322) [-1447.626] -- 0:00:23
634000 -- [-1448.399] (-1446.412) (-1450.909) (-1449.667) * (-1450.917) (-1448.303) [-1449.060] (-1447.505) -- 0:00:23
634500 -- [-1447.859] (-1446.317) (-1448.004) (-1446.800) * (-1451.337) [-1446.903] (-1448.061) (-1453.621) -- 0:00:23
635000 -- (-1446.664) [-1446.198] (-1448.912) (-1449.690) * (-1447.801) (-1448.695) [-1446.705] (-1446.842) -- 0:00:22
Average standard deviation of split frequencies: 0.009126
635500 -- [-1446.668] (-1446.336) (-1450.938) (-1448.262) * [-1445.919] (-1447.453) (-1446.080) (-1447.606) -- 0:00:22
636000 -- (-1446.247) (-1447.337) (-1449.186) [-1453.299] * (-1450.313) (-1451.118) (-1448.427) [-1445.258] -- 0:00:22
636500 -- (-1447.111) [-1446.862] (-1446.641) (-1453.120) * (-1448.400) [-1447.406] (-1448.113) (-1446.293) -- 0:00:23
637000 -- (-1447.835) (-1446.147) [-1449.170] (-1452.215) * (-1446.834) (-1446.910) [-1446.267] (-1447.140) -- 0:00:23
637500 -- (-1449.127) (-1446.736) (-1446.268) [-1449.378] * (-1446.262) (-1445.864) [-1447.265] (-1447.246) -- 0:00:23
638000 -- [-1445.861] (-1447.563) (-1451.763) (-1447.146) * (-1447.408) [-1445.857] (-1447.055) (-1449.467) -- 0:00:23
638500 -- [-1446.184] (-1447.079) (-1445.349) (-1446.363) * (-1451.306) (-1445.799) [-1449.014] (-1445.599) -- 0:00:23
639000 -- [-1446.515] (-1445.508) (-1448.148) (-1451.088) * [-1446.844] (-1447.090) (-1449.334) (-1445.603) -- 0:00:23
639500 -- (-1446.549) [-1447.437] (-1447.323) (-1450.011) * (-1448.997) (-1449.972) [-1446.900] (-1446.553) -- 0:00:23
640000 -- [-1445.467] (-1445.900) (-1445.870) (-1447.281) * (-1452.275) (-1447.891) [-1447.110] (-1449.747) -- 0:00:23
Average standard deviation of split frequencies: 0.010301
640500 -- (-1446.491) [-1447.845] (-1446.426) (-1445.789) * (-1452.859) (-1450.258) [-1448.111] (-1446.673) -- 0:00:23
641000 -- (-1451.639) (-1448.037) [-1446.571] (-1448.521) * (-1448.442) (-1446.180) [-1445.368] (-1448.145) -- 0:00:22
641500 -- (-1449.564) [-1446.579] (-1450.538) (-1454.467) * (-1448.696) (-1446.673) [-1449.624] (-1446.987) -- 0:00:22
642000 -- (-1449.931) (-1449.688) [-1447.504] (-1449.640) * [-1447.252] (-1446.400) (-1450.982) (-1449.187) -- 0:00:22
642500 -- (-1447.977) (-1446.480) (-1451.614) [-1446.088] * [-1448.657] (-1446.340) (-1447.666) (-1450.079) -- 0:00:22
643000 -- (-1447.515) (-1448.442) [-1446.124] (-1446.617) * (-1447.615) (-1447.634) [-1447.687] (-1451.015) -- 0:00:22
643500 -- [-1447.258] (-1448.774) (-1447.208) (-1445.979) * (-1448.393) (-1451.577) (-1445.988) [-1448.285] -- 0:00:22
644000 -- (-1448.325) (-1448.683) (-1449.751) [-1446.648] * (-1445.467) [-1447.116] (-1447.368) (-1448.750) -- 0:00:22
644500 -- (-1446.868) (-1445.438) [-1446.018] (-1448.651) * (-1447.430) (-1447.481) (-1448.974) [-1445.393] -- 0:00:22
645000 -- [-1448.631] (-1445.594) (-1446.748) (-1453.718) * (-1446.528) (-1447.120) [-1447.478] (-1446.521) -- 0:00:22
Average standard deviation of split frequencies: 0.010216
645500 -- (-1447.296) (-1451.005) (-1447.986) [-1448.665] * (-1446.556) (-1446.967) (-1452.026) [-1446.220] -- 0:00:22
646000 -- [-1447.052] (-1449.258) (-1447.809) (-1449.906) * (-1447.023) (-1450.509) (-1452.140) [-1446.449] -- 0:00:22
646500 -- (-1446.551) (-1448.107) [-1446.011] (-1447.979) * [-1448.271] (-1445.972) (-1451.175) (-1445.209) -- 0:00:22
647000 -- (-1447.426) (-1448.369) [-1445.956] (-1449.774) * (-1453.407) [-1445.963] (-1447.793) (-1447.176) -- 0:00:22
647500 -- (-1450.501) (-1449.160) [-1445.365] (-1454.548) * (-1448.001) (-1447.171) (-1447.173) [-1445.402] -- 0:00:22
648000 -- (-1449.673) (-1447.925) [-1449.097] (-1446.610) * [-1446.024] (-1446.222) (-1449.687) (-1446.724) -- 0:00:22
648500 -- (-1449.623) [-1447.038] (-1449.852) (-1451.691) * (-1446.438) (-1446.635) (-1451.295) [-1445.432] -- 0:00:22
649000 -- [-1447.766] (-1450.862) (-1449.994) (-1446.141) * [-1446.509] (-1448.244) (-1449.151) (-1446.584) -- 0:00:22
649500 -- [-1446.200] (-1448.794) (-1445.481) (-1446.517) * (-1445.918) [-1445.575] (-1448.174) (-1446.591) -- 0:00:22
650000 -- (-1445.964) (-1446.840) [-1446.360] (-1447.985) * (-1446.096) (-1445.402) (-1450.569) [-1445.685] -- 0:00:22
Average standard deviation of split frequencies: 0.010143
650500 -- (-1445.536) [-1446.323] (-1446.664) (-1447.662) * (-1446.857) (-1446.774) (-1448.376) [-1445.920] -- 0:00:22
651000 -- (-1447.847) (-1447.087) [-1447.355] (-1447.656) * (-1446.576) [-1445.195] (-1448.746) (-1445.578) -- 0:00:22
651500 -- (-1449.622) (-1446.833) (-1446.139) [-1446.913] * [-1446.752] (-1445.274) (-1447.657) (-1446.943) -- 0:00:22
652000 -- (-1446.414) (-1445.943) [-1446.524] (-1447.677) * (-1445.428) (-1448.320) [-1448.290] (-1446.829) -- 0:00:22
652500 -- (-1446.438) (-1446.826) [-1446.524] (-1450.211) * (-1447.984) (-1448.286) [-1445.751] (-1446.529) -- 0:00:22
653000 -- [-1447.035] (-1445.238) (-1449.467) (-1449.368) * (-1448.371) [-1448.230] (-1446.320) (-1448.291) -- 0:00:22
653500 -- (-1446.476) (-1445.228) [-1449.504] (-1446.010) * [-1446.570] (-1447.791) (-1446.200) (-1446.862) -- 0:00:22
654000 -- (-1447.959) (-1445.174) [-1453.290] (-1447.284) * (-1446.716) [-1445.605] (-1445.583) (-1447.900) -- 0:00:22
654500 -- (-1448.204) (-1445.922) [-1452.246] (-1447.304) * [-1445.770] (-1446.220) (-1445.982) (-1449.374) -- 0:00:22
655000 -- [-1449.643] (-1446.353) (-1450.189) (-1448.197) * (-1447.304) [-1446.767] (-1451.418) (-1451.522) -- 0:00:22
Average standard deviation of split frequencies: 0.010314
655500 -- [-1447.462] (-1447.892) (-1446.426) (-1449.222) * [-1447.455] (-1447.578) (-1446.489) (-1450.693) -- 0:00:22
656000 -- (-1445.477) (-1448.658) (-1449.770) [-1449.506] * (-1449.613) [-1448.660] (-1446.556) (-1448.953) -- 0:00:22
656500 -- (-1446.159) (-1449.453) (-1447.286) [-1445.624] * (-1453.348) (-1448.713) (-1448.533) [-1448.112] -- 0:00:21
657000 -- (-1446.228) (-1448.932) (-1448.438) [-1447.948] * (-1449.027) [-1448.830] (-1449.068) (-1447.752) -- 0:00:21
657500 -- (-1447.030) (-1448.120) [-1447.668] (-1449.874) * (-1448.703) (-1448.591) [-1446.173] (-1445.495) -- 0:00:21
658000 -- (-1447.216) [-1445.709] (-1446.704) (-1448.908) * (-1448.087) [-1447.975] (-1446.263) (-1447.361) -- 0:00:21
658500 -- (-1446.998) (-1449.937) [-1451.182] (-1450.559) * [-1448.022] (-1448.417) (-1446.478) (-1447.085) -- 0:00:21
659000 -- (-1446.556) (-1448.153) [-1447.670] (-1448.978) * (-1445.838) (-1447.390) [-1448.055] (-1448.772) -- 0:00:21
659500 -- (-1447.199) [-1447.932] (-1446.368) (-1449.149) * (-1446.537) (-1448.181) (-1449.568) [-1446.803] -- 0:00:21
660000 -- (-1447.141) (-1447.341) [-1446.295] (-1446.859) * [-1446.793] (-1447.177) (-1448.718) (-1447.782) -- 0:00:21
Average standard deviation of split frequencies: 0.010703
660500 -- (-1446.166) (-1449.240) [-1447.969] (-1447.394) * [-1447.788] (-1447.903) (-1451.831) (-1447.420) -- 0:00:21
661000 -- (-1445.667) (-1452.384) [-1448.294] (-1445.945) * (-1449.215) [-1445.534] (-1448.381) (-1449.542) -- 0:00:21
661500 -- [-1445.300] (-1446.576) (-1448.589) (-1447.546) * (-1447.745) (-1445.450) [-1447.009] (-1451.492) -- 0:00:21
662000 -- [-1445.330] (-1446.652) (-1450.226) (-1446.143) * (-1448.692) (-1445.467) [-1448.427] (-1447.887) -- 0:00:21
662500 -- (-1453.058) (-1446.968) (-1451.237) [-1447.828] * [-1448.696] (-1446.312) (-1447.071) (-1450.071) -- 0:00:21
663000 -- (-1453.229) (-1447.076) [-1447.896] (-1446.513) * (-1450.796) [-1449.260] (-1446.123) (-1446.715) -- 0:00:21
663500 -- (-1452.234) [-1445.495] (-1446.582) (-1446.784) * (-1453.010) (-1450.120) [-1446.764] (-1448.462) -- 0:00:21
664000 -- (-1452.777) (-1449.533) [-1449.994] (-1446.400) * (-1447.064) [-1447.880] (-1446.901) (-1452.051) -- 0:00:21
664500 -- (-1448.852) (-1447.552) (-1447.021) [-1448.230] * (-1446.856) [-1450.347] (-1447.297) (-1445.546) -- 0:00:21
665000 -- (-1448.641) [-1445.787] (-1447.457) (-1449.674) * (-1446.612) [-1447.944] (-1445.822) (-1446.349) -- 0:00:21
Average standard deviation of split frequencies: 0.010451
665500 -- [-1446.747] (-1446.013) (-1447.319) (-1449.416) * (-1446.447) (-1445.453) (-1445.420) [-1446.073] -- 0:00:21
666000 -- [-1446.718] (-1449.982) (-1446.664) (-1450.694) * (-1450.317) (-1445.338) [-1446.210] (-1446.932) -- 0:00:21
666500 -- (-1445.582) (-1447.052) (-1448.516) [-1446.814] * (-1448.372) [-1445.479] (-1447.852) (-1447.196) -- 0:00:21
667000 -- (-1447.680) (-1448.378) [-1447.538] (-1448.451) * (-1449.104) (-1448.591) [-1446.844] (-1448.274) -- 0:00:21
667500 -- [-1446.170] (-1446.862) (-1446.517) (-1451.137) * (-1447.456) (-1450.147) (-1450.010) [-1446.092] -- 0:00:21
668000 -- [-1445.716] (-1452.403) (-1445.775) (-1451.785) * [-1446.986] (-1448.821) (-1447.648) (-1446.480) -- 0:00:21
668500 -- (-1447.942) [-1445.949] (-1448.893) (-1447.186) * (-1446.551) (-1450.129) (-1447.467) [-1447.565] -- 0:00:21
669000 -- (-1445.504) (-1446.772) (-1447.274) [-1446.097] * (-1445.973) (-1447.890) [-1452.223] (-1447.661) -- 0:00:21
669500 -- [-1446.608] (-1446.119) (-1447.910) (-1446.413) * (-1447.772) [-1450.754] (-1449.501) (-1449.468) -- 0:00:21
670000 -- (-1447.715) (-1450.302) (-1446.190) [-1448.906] * (-1446.262) (-1447.547) (-1448.646) [-1449.444] -- 0:00:21
Average standard deviation of split frequencies: 0.009313
670500 -- (-1450.904) [-1449.638] (-1451.123) (-1446.793) * (-1449.703) [-1450.018] (-1446.639) (-1448.429) -- 0:00:21
671000 -- (-1445.580) [-1448.668] (-1449.830) (-1447.685) * (-1445.770) (-1445.505) [-1449.611] (-1445.416) -- 0:00:21
671500 -- (-1446.185) [-1446.673] (-1447.652) (-1449.004) * (-1446.949) (-1445.248) (-1447.366) [-1445.941] -- 0:00:21
672000 -- (-1446.503) (-1446.706) [-1447.096] (-1451.934) * [-1449.390] (-1446.160) (-1446.149) (-1448.803) -- 0:00:20
672500 -- (-1446.528) [-1449.942] (-1451.283) (-1446.508) * (-1447.694) [-1449.334] (-1447.602) (-1447.520) -- 0:00:20
673000 -- (-1447.245) (-1449.695) (-1446.016) [-1448.411] * (-1448.480) (-1447.878) (-1446.946) [-1447.476] -- 0:00:20
673500 -- (-1446.568) (-1446.405) (-1446.670) [-1446.889] * (-1449.899) (-1450.428) [-1447.830] (-1447.822) -- 0:00:20
674000 -- (-1451.244) (-1448.578) (-1447.493) [-1447.477] * (-1448.059) (-1451.094) [-1445.912] (-1447.803) -- 0:00:20
674500 -- (-1447.181) [-1448.308] (-1454.034) (-1449.841) * [-1446.784] (-1447.401) (-1445.862) (-1445.491) -- 0:00:20
675000 -- (-1448.999) [-1447.596] (-1446.094) (-1449.874) * (-1449.651) (-1447.600) [-1445.801] (-1449.798) -- 0:00:20
Average standard deviation of split frequencies: 0.009501
675500 -- (-1447.355) (-1453.755) [-1446.121] (-1447.671) * [-1447.438] (-1448.746) (-1445.988) (-1447.446) -- 0:00:20
676000 -- (-1449.072) (-1452.115) (-1451.152) [-1447.854] * (-1448.404) (-1446.880) [-1446.346] (-1446.239) -- 0:00:20
676500 -- (-1449.907) (-1448.888) (-1448.530) [-1448.685] * (-1448.210) [-1448.962] (-1448.843) (-1445.876) -- 0:00:20
677000 -- (-1447.725) (-1448.173) [-1453.505] (-1446.303) * (-1448.985) (-1449.130) (-1447.843) [-1447.419] -- 0:00:20
677500 -- (-1450.255) [-1445.451] (-1447.457) (-1447.575) * [-1451.842] (-1450.061) (-1449.339) (-1448.810) -- 0:00:20
678000 -- (-1446.674) (-1447.630) (-1447.243) [-1445.710] * (-1445.782) (-1453.836) (-1446.518) [-1447.544] -- 0:00:20
678500 -- (-1446.675) [-1447.323] (-1446.727) (-1446.302) * (-1448.398) (-1453.961) (-1448.460) [-1449.102] -- 0:00:20
679000 -- (-1446.067) (-1446.619) (-1448.725) [-1447.516] * (-1448.803) (-1449.249) [-1446.951] (-1448.735) -- 0:00:20
679500 -- (-1447.621) [-1446.233] (-1448.437) (-1450.719) * (-1449.963) (-1446.986) [-1447.458] (-1449.158) -- 0:00:20
680000 -- [-1448.611] (-1448.460) (-1451.725) (-1451.114) * [-1453.648] (-1449.346) (-1447.346) (-1446.060) -- 0:00:20
Average standard deviation of split frequencies: 0.009436
680500 -- (-1448.851) (-1447.155) (-1447.213) [-1447.231] * (-1446.674) (-1446.517) [-1448.908] (-1449.444) -- 0:00:20
681000 -- (-1448.268) (-1449.592) (-1448.457) [-1448.800] * (-1452.064) (-1446.052) [-1447.204] (-1448.314) -- 0:00:20
681500 -- (-1446.955) (-1448.581) (-1447.846) [-1447.707] * [-1445.362] (-1448.179) (-1447.779) (-1446.006) -- 0:00:20
682000 -- (-1446.547) (-1447.124) (-1445.971) [-1449.540] * [-1445.117] (-1450.709) (-1446.245) (-1446.356) -- 0:00:20
682500 -- (-1446.006) [-1449.723] (-1451.924) (-1452.319) * (-1448.790) [-1447.861] (-1447.198) (-1447.711) -- 0:00:20
683000 -- (-1445.855) (-1446.165) [-1447.550] (-1453.868) * [-1449.893] (-1449.174) (-1450.425) (-1445.683) -- 0:00:20
683500 -- (-1446.425) (-1448.130) (-1446.732) [-1446.792] * (-1448.831) (-1448.949) (-1447.455) [-1448.355] -- 0:00:20
684000 -- (-1446.079) (-1446.357) (-1449.150) [-1447.911] * [-1448.568] (-1446.056) (-1449.443) (-1446.748) -- 0:00:20
684500 -- (-1446.417) (-1446.449) (-1452.983) [-1450.325] * (-1449.511) [-1448.850] (-1448.041) (-1447.692) -- 0:00:20
685000 -- [-1448.554] (-1448.860) (-1446.821) (-1446.572) * (-1446.730) (-1446.564) [-1448.098] (-1446.382) -- 0:00:20
Average standard deviation of split frequencies: 0.010186
685500 -- [-1447.983] (-1449.706) (-1447.282) (-1448.348) * (-1449.332) [-1446.074] (-1446.974) (-1446.783) -- 0:00:20
686000 -- (-1447.562) (-1446.957) (-1447.356) [-1449.626] * (-1450.310) (-1446.110) [-1449.838] (-1448.280) -- 0:00:20
686500 -- (-1446.956) [-1447.543] (-1447.941) (-1445.143) * (-1448.877) (-1446.037) (-1448.097) [-1446.193] -- 0:00:20
687000 -- [-1445.623] (-1446.330) (-1449.239) (-1445.812) * (-1448.564) [-1449.026] (-1447.437) (-1447.015) -- 0:00:20
687500 -- (-1449.198) (-1446.819) (-1450.333) [-1448.972] * (-1446.020) [-1448.346] (-1451.038) (-1446.923) -- 0:00:20
688000 -- (-1446.280) (-1449.797) [-1449.074] (-1447.142) * [-1452.061] (-1446.870) (-1448.336) (-1446.440) -- 0:00:19
688500 -- (-1446.750) (-1451.404) [-1451.362] (-1448.217) * (-1450.679) [-1447.675] (-1445.393) (-1447.577) -- 0:00:19
689000 -- (-1451.087) [-1450.345] (-1451.603) (-1446.379) * (-1452.442) (-1446.755) [-1447.209] (-1448.530) -- 0:00:19
689500 -- [-1448.216] (-1446.276) (-1452.721) (-1445.845) * (-1446.087) (-1446.587) [-1446.291] (-1448.386) -- 0:00:19
690000 -- [-1447.016] (-1448.762) (-1448.934) (-1446.076) * (-1447.432) [-1445.588] (-1446.386) (-1448.635) -- 0:00:19
Average standard deviation of split frequencies: 0.010358
690500 -- (-1446.621) (-1449.803) (-1446.113) [-1446.203] * (-1447.995) (-1445.230) [-1448.225] (-1446.173) -- 0:00:19
691000 -- (-1446.265) (-1450.189) (-1446.052) [-1449.084] * (-1446.946) [-1446.170] (-1448.770) (-1446.070) -- 0:00:19
691500 -- [-1446.789] (-1446.816) (-1447.159) (-1449.812) * (-1447.235) [-1446.442] (-1448.606) (-1445.734) -- 0:00:19
692000 -- (-1447.417) [-1445.328] (-1447.662) (-1450.345) * (-1449.739) [-1447.828] (-1446.908) (-1447.781) -- 0:00:19
692500 -- [-1447.734] (-1446.739) (-1447.239) (-1445.482) * (-1447.966) (-1451.096) [-1447.187] (-1450.705) -- 0:00:19
693000 -- (-1447.301) (-1445.106) [-1446.628] (-1445.461) * (-1447.588) (-1448.683) [-1447.869] (-1448.664) -- 0:00:19
693500 -- [-1445.266] (-1447.844) (-1447.601) (-1454.661) * (-1448.010) (-1451.799) (-1450.019) [-1446.862] -- 0:00:19
694000 -- (-1445.952) (-1446.055) (-1450.658) [-1446.424] * (-1450.215) (-1447.783) [-1448.094] (-1445.543) -- 0:00:19
694500 -- (-1447.777) (-1446.523) [-1452.976] (-1447.583) * (-1447.793) (-1450.710) (-1451.136) [-1446.171] -- 0:00:19
695000 -- [-1446.002] (-1448.642) (-1446.593) (-1445.454) * (-1448.423) [-1448.775] (-1445.642) (-1448.719) -- 0:00:19
Average standard deviation of split frequencies: 0.010757
695500 -- [-1449.081] (-1446.734) (-1449.383) (-1445.360) * (-1451.381) (-1447.926) [-1448.193] (-1448.383) -- 0:00:19
696000 -- (-1452.397) (-1447.787) [-1446.740] (-1445.995) * [-1450.816] (-1447.658) (-1448.354) (-1449.329) -- 0:00:19
696500 -- (-1450.264) [-1447.049] (-1446.095) (-1446.118) * (-1446.478) [-1446.314] (-1447.129) (-1450.648) -- 0:00:19
697000 -- (-1447.897) (-1449.239) (-1446.213) [-1451.289] * (-1445.785) (-1455.577) [-1448.938] (-1446.107) -- 0:00:19
697500 -- (-1452.609) (-1449.045) (-1449.213) [-1446.109] * (-1446.611) (-1457.800) [-1445.842] (-1448.351) -- 0:00:19
698000 -- (-1450.475) [-1450.401] (-1451.908) (-1446.955) * (-1447.825) (-1447.262) (-1445.790) [-1448.349] -- 0:00:19
698500 -- (-1446.942) (-1451.573) (-1447.969) [-1446.493] * (-1446.659) (-1447.307) (-1447.670) [-1445.636] -- 0:00:19
699000 -- (-1446.215) [-1447.662] (-1448.842) (-1448.817) * (-1446.757) [-1448.150] (-1451.746) (-1446.474) -- 0:00:19
699500 -- (-1446.370) [-1447.783] (-1447.105) (-1445.346) * (-1446.215) (-1447.344) (-1454.162) [-1446.527] -- 0:00:19
700000 -- (-1447.750) (-1454.612) [-1448.420] (-1448.377) * (-1446.810) [-1446.827] (-1449.613) (-1449.796) -- 0:00:19
Average standard deviation of split frequencies: 0.010686
700500 -- (-1450.902) [-1446.247] (-1446.509) (-1447.698) * (-1447.550) (-1446.751) (-1449.568) [-1446.877] -- 0:00:19
701000 -- (-1445.917) (-1446.895) [-1446.552] (-1447.261) * [-1447.351] (-1446.333) (-1449.523) (-1448.158) -- 0:00:19
701500 -- (-1447.454) [-1447.516] (-1446.951) (-1446.089) * [-1449.791] (-1446.537) (-1448.913) (-1448.740) -- 0:00:19
702000 -- (-1447.127) (-1445.635) [-1448.509] (-1446.815) * (-1450.666) (-1446.765) [-1447.090] (-1446.859) -- 0:00:19
702500 -- [-1450.551] (-1447.632) (-1447.937) (-1446.017) * (-1447.693) (-1447.944) (-1450.436) [-1450.203] -- 0:00:19
703000 -- (-1446.449) [-1445.473] (-1446.454) (-1447.615) * (-1445.556) (-1447.295) [-1446.592] (-1449.509) -- 0:00:19
703500 -- (-1448.178) [-1447.829] (-1448.101) (-1445.325) * (-1445.980) (-1448.732) [-1450.003] (-1446.648) -- 0:00:18
704000 -- (-1449.868) (-1449.108) [-1448.974] (-1451.484) * (-1449.364) (-1446.769) (-1452.654) [-1447.988] -- 0:00:18
704500 -- (-1450.110) (-1448.003) [-1449.342] (-1449.494) * (-1446.281) [-1447.940] (-1449.161) (-1447.716) -- 0:00:18
705000 -- (-1452.983) [-1446.705] (-1446.681) (-1446.157) * (-1447.066) [-1446.546] (-1446.700) (-1445.966) -- 0:00:18
Average standard deviation of split frequencies: 0.010762
705500 -- (-1450.624) (-1448.439) [-1447.898] (-1448.891) * (-1447.730) (-1451.215) [-1448.346] (-1450.358) -- 0:00:18
706000 -- (-1449.058) (-1449.127) [-1451.996] (-1446.679) * (-1447.035) [-1447.038] (-1447.855) (-1446.803) -- 0:00:18
706500 -- (-1448.464) (-1448.085) (-1451.264) [-1446.945] * [-1447.329] (-1446.730) (-1448.779) (-1447.025) -- 0:00:18
707000 -- (-1449.314) [-1448.468] (-1448.088) (-1449.508) * [-1447.762] (-1446.492) (-1451.933) (-1445.817) -- 0:00:18
707500 -- [-1446.525] (-1446.190) (-1447.199) (-1450.444) * (-1448.920) (-1449.821) [-1446.650] (-1445.491) -- 0:00:18
708000 -- (-1450.061) [-1446.482] (-1450.404) (-1449.436) * (-1446.063) [-1448.509] (-1455.955) (-1447.385) -- 0:00:18
708500 -- (-1449.653) (-1448.958) (-1447.580) [-1451.786] * (-1445.410) (-1447.400) (-1445.956) [-1446.436] -- 0:00:18
709000 -- (-1445.982) (-1451.051) [-1448.140] (-1452.650) * (-1445.904) [-1445.517] (-1447.392) (-1448.595) -- 0:00:18
709500 -- [-1445.927] (-1446.515) (-1446.152) (-1445.282) * (-1445.962) (-1446.349) (-1446.872) [-1451.649] -- 0:00:18
710000 -- [-1446.700] (-1446.881) (-1446.174) (-1446.894) * [-1446.270] (-1450.404) (-1447.307) (-1446.213) -- 0:00:18
Average standard deviation of split frequencies: 0.010847
710500 -- (-1446.663) (-1448.127) [-1445.416] (-1445.559) * (-1445.372) (-1450.040) [-1449.409] (-1447.321) -- 0:00:18
711000 -- [-1448.670] (-1451.370) (-1446.750) (-1447.865) * (-1447.151) (-1448.920) (-1450.130) [-1446.124] -- 0:00:18
711500 -- (-1449.283) (-1447.154) [-1446.459] (-1448.279) * (-1447.104) (-1448.158) [-1445.962] (-1448.054) -- 0:00:18
712000 -- (-1447.560) (-1448.391) [-1447.537] (-1449.992) * (-1449.128) (-1448.623) [-1448.393] (-1446.930) -- 0:00:18
712500 -- [-1447.154] (-1450.292) (-1445.900) (-1447.970) * (-1450.504) (-1447.492) (-1448.669) [-1446.411] -- 0:00:18
713000 -- [-1446.251] (-1448.027) (-1446.937) (-1448.069) * (-1446.303) (-1446.809) [-1447.425] (-1445.722) -- 0:00:18
713500 -- (-1447.721) (-1447.676) [-1447.512] (-1448.584) * (-1447.900) [-1447.620] (-1445.889) (-1447.758) -- 0:00:18
714000 -- [-1448.548] (-1448.603) (-1447.279) (-1449.711) * [-1448.978] (-1446.828) (-1445.430) (-1445.536) -- 0:00:18
714500 -- (-1448.936) (-1447.137) [-1448.365] (-1448.322) * [-1446.545] (-1448.024) (-1451.745) (-1446.024) -- 0:00:18
715000 -- [-1449.362] (-1449.755) (-1448.063) (-1448.210) * (-1447.722) (-1453.370) (-1452.637) [-1448.023] -- 0:00:18
Average standard deviation of split frequencies: 0.010844
715500 -- (-1448.492) (-1447.323) [-1451.811] (-1446.791) * (-1447.048) (-1446.997) [-1446.439] (-1447.441) -- 0:00:18
716000 -- (-1447.982) (-1450.624) [-1448.318] (-1451.248) * [-1450.900] (-1451.374) (-1446.954) (-1446.637) -- 0:00:18
716500 -- (-1450.418) (-1447.999) (-1447.910) [-1449.425] * (-1447.047) [-1449.054] (-1447.313) (-1448.052) -- 0:00:18
717000 -- [-1447.953] (-1447.093) (-1447.879) (-1448.442) * [-1447.561] (-1447.935) (-1446.553) (-1447.916) -- 0:00:18
717500 -- [-1446.598] (-1448.010) (-1447.431) (-1450.294) * (-1445.965) [-1447.018] (-1445.568) (-1445.657) -- 0:00:18
718000 -- (-1450.854) [-1448.457] (-1446.857) (-1446.667) * (-1450.420) (-1447.820) (-1446.637) [-1445.875] -- 0:00:18
718500 -- [-1448.225] (-1446.457) (-1446.676) (-1446.455) * [-1448.724] (-1455.844) (-1445.112) (-1445.356) -- 0:00:18
719000 -- (-1450.934) [-1447.319] (-1447.256) (-1450.940) * (-1447.176) (-1449.485) (-1445.479) [-1447.569] -- 0:00:17
719500 -- (-1447.596) (-1446.593) [-1446.163] (-1449.438) * (-1447.140) (-1447.213) [-1446.033] (-1446.637) -- 0:00:17
720000 -- (-1446.134) (-1446.799) (-1448.237) [-1446.790] * (-1446.353) [-1447.547] (-1445.742) (-1448.802) -- 0:00:17
Average standard deviation of split frequencies: 0.010966
720500 -- (-1446.962) (-1445.944) [-1448.945] (-1447.190) * (-1448.344) (-1448.189) (-1449.258) [-1448.531] -- 0:00:17
721000 -- (-1445.489) [-1445.566] (-1451.988) (-1447.358) * (-1445.519) (-1449.369) (-1448.723) [-1448.476] -- 0:00:17
721500 -- (-1445.791) (-1446.211) [-1446.251] (-1447.479) * (-1445.179) (-1446.956) [-1446.568] (-1447.234) -- 0:00:17
722000 -- [-1446.011] (-1445.659) (-1446.672) (-1446.398) * (-1448.788) [-1446.614] (-1446.029) (-1446.088) -- 0:00:17
722500 -- [-1446.096] (-1445.637) (-1446.466) (-1448.333) * (-1445.521) [-1449.205] (-1445.951) (-1448.224) -- 0:00:17
723000 -- (-1451.038) (-1455.009) [-1445.700] (-1449.349) * (-1446.612) (-1451.745) [-1446.556] (-1447.420) -- 0:00:17
723500 -- (-1452.760) (-1447.389) (-1447.424) [-1446.858] * (-1445.945) (-1447.367) (-1449.495) [-1446.759] -- 0:00:17
724000 -- (-1447.059) (-1450.016) (-1448.091) [-1447.421] * (-1450.141) (-1447.092) (-1450.240) [-1447.784] -- 0:00:17
724500 -- (-1452.445) [-1449.058] (-1447.620) (-1450.382) * (-1448.924) (-1447.269) [-1448.191] (-1446.495) -- 0:00:17
725000 -- [-1446.034] (-1446.389) (-1446.618) (-1446.285) * (-1446.884) [-1446.861] (-1446.608) (-1446.747) -- 0:00:17
Average standard deviation of split frequencies: 0.010809
725500 -- (-1447.174) (-1446.322) [-1448.592] (-1450.047) * [-1446.813] (-1449.678) (-1448.265) (-1446.406) -- 0:00:17
726000 -- (-1447.319) (-1449.932) [-1447.625] (-1452.971) * (-1450.002) [-1448.663] (-1447.952) (-1447.768) -- 0:00:17
726500 -- (-1445.507) [-1447.231] (-1451.575) (-1454.162) * [-1446.862] (-1451.846) (-1446.812) (-1446.357) -- 0:00:17
727000 -- [-1450.699] (-1446.537) (-1451.952) (-1450.347) * (-1446.371) (-1448.298) [-1445.989] (-1448.981) -- 0:00:17
727500 -- (-1446.822) [-1445.508] (-1448.589) (-1447.555) * (-1448.505) (-1448.611) [-1447.537] (-1448.920) -- 0:00:17
728000 -- (-1446.993) [-1445.126] (-1450.420) (-1447.415) * (-1447.469) [-1446.964] (-1448.234) (-1449.022) -- 0:00:17
728500 -- (-1446.402) (-1447.370) (-1447.580) [-1446.965] * (-1447.664) (-1448.402) [-1446.935] (-1451.430) -- 0:00:17
729000 -- (-1450.279) (-1448.138) [-1447.104] (-1446.466) * (-1449.913) (-1446.982) [-1445.508] (-1453.022) -- 0:00:17
729500 -- [-1449.540] (-1447.068) (-1445.662) (-1448.416) * [-1447.181] (-1447.524) (-1449.272) (-1446.506) -- 0:00:17
730000 -- (-1447.982) [-1446.961] (-1445.857) (-1449.667) * (-1447.556) (-1447.782) (-1451.550) [-1445.461] -- 0:00:17
Average standard deviation of split frequencies: 0.009355
730500 -- [-1447.081] (-1448.095) (-1446.604) (-1448.720) * (-1448.647) (-1446.637) [-1449.735] (-1445.843) -- 0:00:17
731000 -- (-1449.524) (-1447.535) (-1447.884) [-1447.529] * [-1447.692] (-1446.349) (-1449.420) (-1447.577) -- 0:00:17
731500 -- (-1447.820) (-1445.944) [-1446.345] (-1447.135) * (-1447.627) (-1448.337) [-1448.534] (-1447.021) -- 0:00:17
732000 -- [-1445.801] (-1445.864) (-1445.958) (-1449.066) * (-1451.289) (-1446.134) (-1447.548) [-1453.612] -- 0:00:17
732500 -- (-1450.731) (-1446.269) (-1446.375) [-1448.288] * [-1448.552] (-1446.479) (-1445.983) (-1447.432) -- 0:00:17
733000 -- (-1447.174) (-1446.767) (-1446.389) [-1450.939] * [-1446.680] (-1451.200) (-1446.773) (-1446.692) -- 0:00:17
733500 -- (-1447.325) [-1446.421] (-1446.632) (-1449.511) * [-1449.482] (-1446.825) (-1446.782) (-1447.760) -- 0:00:17
734000 -- [-1445.865] (-1446.788) (-1446.943) (-1447.732) * (-1446.876) [-1445.922] (-1448.095) (-1448.044) -- 0:00:17
734500 -- (-1449.627) (-1445.194) [-1449.837] (-1445.555) * (-1448.400) (-1446.026) [-1445.731] (-1447.995) -- 0:00:16
735000 -- (-1447.297) [-1445.381] (-1448.503) (-1447.162) * (-1447.266) (-1447.115) (-1449.209) [-1446.409] -- 0:00:16
Average standard deviation of split frequencies: 0.009728
735500 -- (-1447.293) [-1445.564] (-1449.967) (-1446.678) * (-1446.591) [-1447.736] (-1451.165) (-1449.897) -- 0:00:16
736000 -- (-1448.151) (-1447.428) (-1448.481) [-1448.720] * (-1447.023) (-1446.302) [-1449.724] (-1449.639) -- 0:00:16
736500 -- (-1446.812) (-1449.173) (-1448.498) [-1447.666] * (-1450.787) (-1446.341) (-1447.386) [-1447.884] -- 0:00:16
737000 -- (-1451.057) (-1447.826) (-1451.414) [-1446.870] * [-1445.322] (-1448.642) (-1447.568) (-1446.852) -- 0:00:16
737500 -- (-1447.333) [-1447.932] (-1448.454) (-1447.092) * (-1445.757) (-1447.989) (-1449.880) [-1446.344] -- 0:00:16
738000 -- (-1447.307) (-1449.198) [-1447.907] (-1446.246) * (-1445.371) [-1447.660] (-1448.693) (-1446.351) -- 0:00:16
738500 -- (-1449.021) (-1447.525) (-1449.282) [-1446.663] * (-1447.989) (-1445.711) [-1446.284] (-1447.101) -- 0:00:16
739000 -- (-1447.460) (-1445.679) [-1448.745] (-1445.804) * (-1449.745) (-1446.513) (-1447.353) [-1446.227] -- 0:00:16
739500 -- (-1446.539) [-1445.815] (-1450.963) (-1449.677) * (-1448.913) (-1446.991) (-1451.231) [-1447.819] -- 0:00:16
740000 -- (-1445.629) (-1446.114) (-1447.241) [-1448.084] * (-1447.353) [-1452.091] (-1449.095) (-1448.177) -- 0:00:16
Average standard deviation of split frequencies: 0.009388
740500 -- [-1446.721] (-1447.646) (-1445.552) (-1446.701) * (-1447.585) (-1447.372) (-1446.964) [-1448.601] -- 0:00:16
741000 -- (-1446.802) [-1446.168] (-1445.845) (-1447.933) * (-1447.229) (-1447.690) (-1448.726) [-1449.491] -- 0:00:16
741500 -- (-1447.431) [-1446.226] (-1445.914) (-1448.515) * [-1445.955] (-1447.814) (-1447.208) (-1451.903) -- 0:00:16
742000 -- (-1448.930) [-1449.446] (-1450.041) (-1446.756) * [-1446.551] (-1448.902) (-1447.287) (-1448.298) -- 0:00:16
742500 -- (-1447.093) (-1446.975) [-1447.063] (-1448.215) * (-1445.412) [-1447.134] (-1447.510) (-1446.870) -- 0:00:16
743000 -- (-1445.515) (-1447.963) [-1448.239] (-1449.106) * [-1446.686] (-1446.853) (-1448.576) (-1445.737) -- 0:00:16
743500 -- (-1447.409) [-1446.600] (-1445.939) (-1448.193) * (-1450.128) [-1446.023] (-1445.763) (-1446.496) -- 0:00:16
744000 -- (-1450.524) [-1445.893] (-1446.513) (-1445.691) * (-1447.280) (-1448.750) (-1450.976) [-1446.657] -- 0:00:16
744500 -- (-1448.346) (-1446.900) (-1448.594) [-1447.181] * [-1448.293] (-1446.386) (-1447.928) (-1448.349) -- 0:00:16
745000 -- (-1448.839) [-1450.512] (-1447.259) (-1447.548) * (-1451.866) (-1446.080) [-1449.494] (-1447.011) -- 0:00:16
Average standard deviation of split frequencies: 0.009360
745500 -- (-1447.227) (-1448.965) (-1446.968) [-1446.110] * (-1447.688) (-1447.028) (-1446.456) [-1445.771] -- 0:00:16
746000 -- [-1446.050] (-1447.063) (-1446.934) (-1452.063) * [-1448.595] (-1448.463) (-1446.511) (-1446.693) -- 0:00:16
746500 -- (-1447.580) [-1445.634] (-1446.446) (-1448.838) * [-1446.308] (-1447.992) (-1447.039) (-1446.192) -- 0:00:16
747000 -- (-1447.707) [-1446.704] (-1446.516) (-1448.281) * (-1448.008) [-1446.620] (-1447.462) (-1449.970) -- 0:00:16
747500 -- (-1447.421) (-1448.747) (-1447.029) [-1449.411] * (-1446.923) (-1449.231) [-1446.210] (-1446.014) -- 0:00:16
748000 -- (-1446.738) (-1450.720) [-1447.554] (-1447.585) * (-1446.490) (-1451.364) [-1446.481] (-1446.439) -- 0:00:16
748500 -- (-1447.638) (-1449.740) (-1447.708) [-1450.898] * (-1449.645) (-1446.362) (-1446.871) [-1446.664] -- 0:00:16
749000 -- [-1446.345] (-1447.070) (-1447.474) (-1446.496) * (-1446.212) (-1446.412) [-1447.901] (-1446.566) -- 0:00:16
749500 -- [-1446.457] (-1447.090) (-1446.402) (-1448.481) * (-1446.422) (-1453.375) (-1455.004) [-1448.029] -- 0:00:16
750000 -- (-1446.029) (-1450.484) [-1446.653] (-1458.375) * [-1447.661] (-1453.480) (-1450.767) (-1451.377) -- 0:00:16
Average standard deviation of split frequencies: 0.008988
750500 -- (-1450.607) (-1449.823) (-1445.353) [-1447.763] * (-1453.699) (-1448.627) (-1447.932) [-1447.212] -- 0:00:15
751000 -- (-1449.188) [-1447.201] (-1446.971) (-1451.064) * (-1445.889) (-1449.917) (-1447.043) [-1446.782] -- 0:00:15
751500 -- (-1450.096) (-1447.079) [-1446.186] (-1446.274) * (-1445.361) (-1446.379) (-1446.368) [-1449.322] -- 0:00:15
752000 -- (-1446.413) [-1447.587] (-1447.526) (-1446.744) * (-1446.278) [-1445.485] (-1447.199) (-1453.414) -- 0:00:15
752500 -- (-1446.240) (-1450.083) [-1447.327] (-1449.404) * (-1447.722) (-1445.725) [-1448.102] (-1452.098) -- 0:00:15
753000 -- (-1446.119) (-1454.413) [-1448.787] (-1447.943) * (-1446.392) [-1445.326] (-1447.568) (-1449.749) -- 0:00:15
753500 -- (-1448.170) (-1458.248) (-1448.685) [-1448.896] * [-1447.105] (-1446.741) (-1447.842) (-1446.757) -- 0:00:15
754000 -- [-1446.510] (-1446.214) (-1446.756) (-1447.224) * [-1447.810] (-1445.982) (-1448.592) (-1447.057) -- 0:00:15
754500 -- (-1448.906) (-1449.136) [-1447.405] (-1458.026) * (-1445.501) (-1448.152) (-1448.933) [-1445.865] -- 0:00:15
755000 -- [-1448.614] (-1449.319) (-1446.836) (-1452.952) * [-1448.923] (-1446.405) (-1450.221) (-1446.837) -- 0:00:15
Average standard deviation of split frequencies: 0.009119
755500 -- (-1449.941) [-1446.832] (-1445.724) (-1455.222) * [-1446.927] (-1450.104) (-1446.448) (-1446.795) -- 0:00:15
756000 -- (-1448.558) [-1445.320] (-1448.741) (-1446.103) * (-1445.499) (-1446.817) [-1446.657] (-1448.340) -- 0:00:15
756500 -- [-1450.214] (-1447.863) (-1447.283) (-1449.025) * (-1445.678) [-1446.996] (-1447.563) (-1447.104) -- 0:00:15
757000 -- (-1451.290) [-1447.284] (-1450.044) (-1449.204) * (-1449.534) [-1448.012] (-1451.616) (-1446.747) -- 0:00:15
757500 -- (-1453.328) (-1447.413) (-1448.337) [-1447.609] * (-1448.946) [-1446.015] (-1450.469) (-1447.746) -- 0:00:15
758000 -- (-1448.161) (-1447.191) (-1446.943) [-1447.987] * [-1448.374] (-1452.314) (-1448.253) (-1448.974) -- 0:00:15
758500 -- (-1450.152) (-1447.785) (-1447.101) [-1447.414] * (-1448.996) (-1448.317) (-1446.734) [-1446.700] -- 0:00:15
759000 -- (-1448.770) [-1447.281] (-1447.799) (-1446.943) * (-1450.161) [-1446.236] (-1445.888) (-1446.379) -- 0:00:15
759500 -- (-1449.459) (-1447.321) (-1450.765) [-1447.434] * (-1445.878) (-1448.723) [-1445.903] (-1446.386) -- 0:00:15
760000 -- (-1447.118) (-1448.103) [-1450.048] (-1451.154) * [-1446.300] (-1452.616) (-1445.923) (-1451.704) -- 0:00:15
Average standard deviation of split frequencies: 0.009063
760500 -- (-1449.001) (-1450.358) (-1452.382) [-1447.141] * (-1447.185) (-1456.172) [-1446.328] (-1447.157) -- 0:00:15
761000 -- (-1449.244) (-1449.884) (-1451.443) [-1447.249] * [-1448.855] (-1448.889) (-1446.626) (-1449.276) -- 0:00:15
761500 -- (-1448.658) [-1446.159] (-1447.605) (-1445.196) * (-1450.797) (-1451.196) [-1448.750] (-1450.337) -- 0:00:15
762000 -- (-1453.181) (-1446.346) [-1446.864] (-1448.702) * (-1447.995) (-1448.715) [-1445.307] (-1452.221) -- 0:00:15
762500 -- [-1445.954] (-1446.883) (-1447.660) (-1446.521) * (-1449.389) (-1447.244) [-1446.013] (-1451.214) -- 0:00:15
763000 -- (-1448.634) [-1446.158] (-1448.055) (-1449.148) * (-1446.744) (-1449.026) (-1445.829) [-1447.543] -- 0:00:15
763500 -- (-1447.097) (-1446.564) [-1446.141] (-1448.123) * (-1448.357) (-1448.948) (-1448.727) [-1447.848] -- 0:00:15
764000 -- (-1453.918) (-1446.696) [-1446.105] (-1448.028) * (-1448.073) [-1446.111] (-1449.808) (-1452.394) -- 0:00:15
764500 -- [-1445.966] (-1446.370) (-1446.802) (-1446.464) * (-1451.898) [-1446.018] (-1446.107) (-1445.850) -- 0:00:15
765000 -- [-1449.825] (-1445.236) (-1447.541) (-1449.729) * (-1446.668) (-1450.369) (-1448.243) [-1446.607] -- 0:00:15
Average standard deviation of split frequencies: 0.009847
765500 -- (-1446.932) (-1451.470) [-1447.903] (-1452.647) * (-1446.242) (-1445.938) [-1446.065] (-1446.563) -- 0:00:15
766000 -- (-1446.368) (-1448.702) (-1448.604) [-1446.994] * (-1445.671) (-1446.837) (-1445.924) [-1445.423] -- 0:00:14
766500 -- [-1446.280] (-1451.372) (-1453.168) (-1451.324) * [-1446.306] (-1446.518) (-1449.066) (-1446.043) -- 0:00:14
767000 -- (-1446.091) (-1448.483) (-1446.504) [-1445.762] * (-1446.135) (-1448.107) [-1446.486] (-1450.383) -- 0:00:14
767500 -- (-1448.009) (-1447.553) (-1447.360) [-1446.714] * [-1446.325] (-1446.172) (-1446.220) (-1449.021) -- 0:00:14
768000 -- (-1447.230) (-1447.061) [-1448.120] (-1449.757) * (-1446.722) (-1447.329) (-1447.833) [-1447.350] -- 0:00:14
768500 -- (-1448.914) [-1445.703] (-1446.925) (-1451.402) * (-1448.692) (-1448.883) [-1450.896] (-1445.835) -- 0:00:14
769000 -- (-1451.772) (-1446.656) [-1446.776] (-1449.159) * (-1448.603) (-1445.961) [-1445.534] (-1446.074) -- 0:00:14
769500 -- (-1447.715) [-1446.536] (-1449.659) (-1447.860) * (-1448.958) (-1446.043) (-1450.046) [-1448.633] -- 0:00:14
770000 -- [-1446.151] (-1447.051) (-1447.540) (-1448.764) * (-1451.744) [-1450.256] (-1448.906) (-1447.167) -- 0:00:14
Average standard deviation of split frequencies: 0.009859
770500 -- (-1446.053) [-1446.696] (-1450.928) (-1446.545) * (-1449.090) [-1447.772] (-1452.820) (-1449.979) -- 0:00:14
771000 -- (-1445.201) [-1445.770] (-1449.341) (-1446.528) * (-1448.278) (-1447.200) (-1447.792) [-1448.371] -- 0:00:14
771500 -- (-1445.957) [-1447.639] (-1446.785) (-1446.087) * (-1449.129) [-1449.750] (-1446.852) (-1449.670) -- 0:00:14
772000 -- [-1448.278] (-1447.079) (-1448.428) (-1447.507) * (-1452.604) [-1450.462] (-1445.584) (-1448.600) -- 0:00:14
772500 -- (-1447.467) (-1448.005) [-1448.779] (-1445.558) * (-1449.869) (-1447.500) [-1449.744] (-1446.433) -- 0:00:14
773000 -- [-1445.874] (-1446.476) (-1448.055) (-1445.302) * (-1447.930) [-1447.274] (-1448.403) (-1447.591) -- 0:00:14
773500 -- [-1446.276] (-1448.537) (-1452.137) (-1446.040) * (-1448.003) (-1447.537) (-1447.139) [-1448.031] -- 0:00:14
774000 -- (-1447.528) (-1449.491) [-1449.124] (-1446.282) * (-1447.998) (-1446.769) [-1449.054] (-1456.862) -- 0:00:14
774500 -- (-1446.501) (-1447.231) (-1448.138) [-1448.259] * (-1449.144) [-1445.269] (-1448.936) (-1452.035) -- 0:00:14
775000 -- (-1446.808) (-1446.348) [-1449.626] (-1446.314) * (-1451.648) [-1446.530] (-1446.061) (-1449.194) -- 0:00:14
Average standard deviation of split frequencies: 0.009934
775500 -- (-1448.833) (-1446.664) (-1448.753) [-1446.000] * (-1447.490) (-1445.268) (-1448.934) [-1446.175] -- 0:00:14
776000 -- [-1448.175] (-1448.943) (-1446.968) (-1445.950) * [-1447.965] (-1448.183) (-1451.179) (-1446.227) -- 0:00:14
776500 -- (-1446.637) (-1448.652) [-1450.133] (-1447.950) * [-1446.216] (-1445.136) (-1450.480) (-1450.014) -- 0:00:14
777000 -- (-1449.725) (-1445.540) (-1448.388) [-1448.385] * [-1447.139] (-1446.371) (-1449.482) (-1449.262) -- 0:00:14
777500 -- (-1448.238) (-1449.979) (-1446.036) [-1447.267] * (-1449.920) (-1447.488) [-1446.372] (-1454.333) -- 0:00:14
778000 -- (-1449.744) [-1448.577] (-1447.046) (-1448.686) * (-1448.349) (-1448.026) [-1448.241] (-1449.409) -- 0:00:14
778500 -- (-1450.979) (-1447.694) (-1448.008) [-1446.695] * (-1446.103) [-1447.717] (-1451.744) (-1450.722) -- 0:00:14
779000 -- (-1448.097) (-1446.350) (-1448.304) [-1450.089] * (-1446.115) (-1446.240) (-1449.315) [-1446.636] -- 0:00:14
779500 -- (-1447.673) (-1446.368) [-1447.764] (-1446.551) * (-1445.545) [-1447.241] (-1447.003) (-1447.259) -- 0:00:14
780000 -- (-1446.975) (-1445.683) [-1447.808] (-1446.026) * (-1446.115) (-1446.497) (-1445.684) [-1445.714] -- 0:00:14
Average standard deviation of split frequencies: 0.010408
780500 -- (-1448.249) [-1446.048] (-1448.174) (-1446.824) * (-1449.462) (-1446.054) [-1446.776] (-1445.675) -- 0:00:14
781000 -- (-1447.487) [-1446.036] (-1450.906) (-1451.559) * (-1447.492) (-1450.194) [-1449.160] (-1447.100) -- 0:00:14
781500 -- [-1445.604] (-1448.282) (-1450.516) (-1447.319) * (-1446.176) (-1450.366) [-1448.178] (-1450.086) -- 0:00:13
782000 -- (-1447.787) [-1450.763] (-1446.512) (-1449.943) * (-1449.596) [-1448.414] (-1447.516) (-1445.886) -- 0:00:13
782500 -- (-1445.938) (-1448.120) (-1449.054) [-1448.185] * (-1448.563) (-1447.708) (-1448.535) [-1445.304] -- 0:00:13
783000 -- (-1447.210) [-1447.706] (-1447.734) (-1446.634) * (-1449.525) [-1445.597] (-1449.770) (-1450.066) -- 0:00:13
783500 -- (-1446.835) [-1451.405] (-1446.140) (-1448.609) * (-1448.497) (-1447.176) [-1447.441] (-1446.152) -- 0:00:13
784000 -- (-1447.545) (-1448.732) [-1445.657] (-1447.747) * (-1448.358) (-1446.848) [-1447.894] (-1446.109) -- 0:00:13
784500 -- [-1447.269] (-1447.473) (-1447.011) (-1445.829) * (-1450.719) (-1447.666) [-1446.768] (-1446.734) -- 0:00:13
785000 -- (-1445.999) (-1451.508) (-1447.711) [-1446.131] * [-1449.045] (-1446.702) (-1447.665) (-1447.014) -- 0:00:13
Average standard deviation of split frequencies: 0.010337
785500 -- (-1446.124) [-1451.894] (-1447.426) (-1445.894) * (-1447.357) (-1451.011) (-1449.954) [-1449.117] -- 0:00:13
786000 -- (-1447.561) (-1448.431) [-1447.220] (-1445.812) * [-1448.074] (-1446.183) (-1450.230) (-1447.212) -- 0:00:13
786500 -- [-1446.322] (-1445.652) (-1447.880) (-1449.550) * (-1448.263) [-1447.546] (-1447.684) (-1446.993) -- 0:00:13
787000 -- [-1445.524] (-1453.697) (-1447.336) (-1452.733) * (-1448.951) (-1447.503) [-1447.683] (-1446.738) -- 0:00:13
787500 -- (-1445.524) (-1448.549) (-1446.904) [-1449.585] * [-1449.576] (-1449.069) (-1447.875) (-1447.750) -- 0:00:13
788000 -- [-1447.147] (-1447.715) (-1448.308) (-1446.563) * (-1447.543) (-1448.663) (-1446.458) [-1449.561] -- 0:00:13
788500 -- (-1447.291) (-1447.700) [-1448.001] (-1446.303) * [-1445.495] (-1450.264) (-1447.603) (-1449.188) -- 0:00:13
789000 -- (-1447.239) (-1447.288) [-1445.810] (-1446.787) * (-1448.093) (-1449.542) (-1446.583) [-1450.498] -- 0:00:13
789500 -- (-1445.964) (-1447.244) [-1445.883] (-1447.265) * (-1445.664) (-1448.909) [-1445.549] (-1448.566) -- 0:00:13
790000 -- [-1445.606] (-1448.950) (-1448.610) (-1449.642) * [-1446.092] (-1448.244) (-1445.424) (-1448.399) -- 0:00:13
Average standard deviation of split frequencies: 0.010101
790500 -- (-1445.768) [-1446.021] (-1448.613) (-1446.724) * (-1447.933) [-1445.719] (-1445.975) (-1445.789) -- 0:00:13
791000 -- [-1446.311] (-1452.658) (-1446.723) (-1446.009) * (-1447.603) [-1446.627] (-1446.535) (-1445.540) -- 0:00:13
791500 -- [-1447.761] (-1450.807) (-1449.556) (-1447.710) * (-1447.612) (-1446.187) (-1446.437) [-1446.832] -- 0:00:13
792000 -- [-1453.390] (-1447.026) (-1448.128) (-1448.326) * (-1446.898) (-1448.159) [-1449.436] (-1446.665) -- 0:00:13
792500 -- (-1447.179) (-1446.934) [-1447.537] (-1445.824) * (-1446.834) (-1447.235) [-1450.320] (-1445.707) -- 0:00:13
793000 -- (-1446.934) (-1449.654) (-1446.069) [-1448.429] * (-1446.681) [-1446.490] (-1450.468) (-1446.303) -- 0:00:13
793500 -- (-1448.953) (-1450.673) [-1447.339] (-1446.630) * (-1446.958) [-1445.514] (-1445.987) (-1445.982) -- 0:00:13
794000 -- [-1453.905] (-1447.922) (-1447.290) (-1446.787) * (-1450.391) (-1446.671) [-1447.829] (-1446.905) -- 0:00:13
794500 -- (-1448.794) (-1450.092) [-1445.937] (-1446.114) * (-1447.391) (-1446.476) [-1448.838] (-1447.717) -- 0:00:13
795000 -- (-1446.556) (-1453.029) (-1446.576) [-1446.492] * (-1451.865) [-1449.150] (-1446.624) (-1449.412) -- 0:00:13
Average standard deviation of split frequencies: 0.009580
795500 -- [-1447.811] (-1450.960) (-1450.121) (-1445.970) * (-1452.255) (-1448.359) (-1447.627) [-1449.361] -- 0:00:13
796000 -- (-1446.871) (-1446.839) [-1446.379] (-1447.315) * (-1447.393) [-1448.006] (-1448.031) (-1454.634) -- 0:00:13
796500 -- (-1448.375) (-1447.649) [-1446.384] (-1449.238) * (-1448.055) (-1448.511) (-1446.758) [-1446.075] -- 0:00:13
797000 -- [-1446.825] (-1447.182) (-1446.859) (-1451.394) * (-1447.078) (-1445.488) [-1447.489] (-1446.782) -- 0:00:12
797500 -- (-1447.791) [-1446.388] (-1447.973) (-1447.987) * (-1445.884) [-1450.903] (-1447.653) (-1447.118) -- 0:00:12
798000 -- (-1449.333) (-1448.025) [-1447.471] (-1448.803) * (-1448.176) [-1445.861] (-1448.180) (-1451.314) -- 0:00:12
798500 -- (-1450.666) (-1447.132) (-1447.418) [-1445.671] * (-1446.022) (-1448.028) [-1448.205] (-1447.276) -- 0:00:12
799000 -- (-1452.703) (-1445.954) (-1448.528) [-1448.167] * (-1447.278) (-1447.741) (-1445.485) [-1446.951] -- 0:00:12
799500 -- [-1451.155] (-1446.767) (-1446.328) (-1450.180) * [-1449.906] (-1450.696) (-1446.408) (-1448.360) -- 0:00:12
800000 -- [-1451.636] (-1447.910) (-1446.405) (-1447.286) * (-1446.978) (-1447.318) [-1445.615] (-1449.799) -- 0:00:12
Average standard deviation of split frequencies: 0.008970
800500 -- (-1447.271) [-1445.788] (-1449.668) (-1447.428) * (-1446.872) (-1448.208) [-1446.044] (-1448.164) -- 0:00:12
801000 -- (-1447.878) [-1445.888] (-1446.328) (-1445.393) * (-1447.025) [-1449.207] (-1445.563) (-1447.967) -- 0:00:12
801500 -- (-1448.290) (-1445.738) [-1450.404] (-1446.642) * [-1448.749] (-1446.171) (-1445.813) (-1446.999) -- 0:00:12
802000 -- [-1446.588] (-1447.786) (-1446.891) (-1447.677) * (-1448.747) (-1446.486) (-1446.173) [-1448.037] -- 0:00:12
802500 -- (-1449.454) [-1447.883] (-1446.995) (-1446.621) * (-1446.487) [-1445.934] (-1449.194) (-1447.742) -- 0:00:12
803000 -- (-1450.639) [-1446.681] (-1446.235) (-1449.113) * (-1447.852) (-1449.854) [-1451.502] (-1450.185) -- 0:00:12
803500 -- (-1447.036) (-1447.039) [-1446.930] (-1449.513) * (-1449.015) [-1445.986] (-1446.133) (-1445.749) -- 0:00:12
804000 -- (-1446.859) [-1447.737] (-1447.148) (-1447.326) * (-1447.070) (-1446.667) (-1448.775) [-1450.692] -- 0:00:12
804500 -- (-1448.613) (-1447.673) (-1446.907) [-1447.331] * (-1451.141) (-1447.017) (-1448.511) [-1448.780] -- 0:00:12
805000 -- (-1448.187) (-1448.669) (-1445.889) [-1452.882] * [-1445.296] (-1445.737) (-1446.694) (-1449.550) -- 0:00:12
Average standard deviation of split frequencies: 0.008842
805500 -- (-1448.075) (-1446.738) (-1447.700) [-1451.643] * (-1446.702) [-1446.025] (-1445.920) (-1458.819) -- 0:00:12
806000 -- (-1448.434) [-1447.421] (-1446.455) (-1446.525) * [-1447.576] (-1446.782) (-1446.178) (-1450.328) -- 0:00:12
806500 -- [-1446.691] (-1447.277) (-1446.431) (-1447.749) * (-1445.331) (-1450.616) [-1446.762] (-1447.666) -- 0:00:12
807000 -- (-1447.274) (-1446.914) (-1446.601) [-1446.014] * (-1448.096) (-1448.265) [-1447.090] (-1449.567) -- 0:00:12
807500 -- [-1446.659] (-1447.342) (-1449.101) (-1447.881) * (-1446.083) [-1449.310] (-1446.314) (-1447.487) -- 0:00:12
808000 -- [-1446.313] (-1445.879) (-1446.895) (-1449.526) * (-1449.115) (-1448.585) (-1448.368) [-1445.833] -- 0:00:12
808500 -- (-1447.690) (-1446.545) (-1447.500) [-1448.532] * (-1445.899) [-1449.449] (-1447.762) (-1446.207) -- 0:00:12
809000 -- [-1447.622] (-1447.623) (-1446.077) (-1449.216) * (-1445.561) (-1448.727) [-1447.244] (-1447.815) -- 0:00:12
809500 -- (-1446.853) (-1447.379) [-1447.188] (-1449.268) * [-1449.403] (-1446.350) (-1447.309) (-1447.947) -- 0:00:12
810000 -- (-1446.635) [-1447.399] (-1446.454) (-1447.930) * (-1449.320) (-1447.422) (-1450.426) [-1447.687] -- 0:00:12
Average standard deviation of split frequencies: 0.008346
810500 -- (-1447.197) [-1446.230] (-1448.984) (-1451.698) * (-1447.643) (-1447.080) (-1447.962) [-1445.428] -- 0:00:12
811000 -- (-1450.354) (-1452.171) [-1445.473] (-1448.084) * [-1449.619] (-1447.273) (-1447.131) (-1448.025) -- 0:00:12
811500 -- (-1446.065) (-1448.298) (-1447.096) [-1448.183] * [-1450.857] (-1447.797) (-1446.495) (-1448.174) -- 0:00:12
812000 -- (-1446.541) [-1451.306] (-1448.929) (-1447.529) * (-1451.500) (-1452.474) (-1447.034) [-1445.293] -- 0:00:12
812500 -- (-1450.074) (-1446.288) [-1445.519] (-1449.368) * [-1447.231] (-1447.205) (-1447.764) (-1445.234) -- 0:00:12
813000 -- (-1450.247) (-1445.864) (-1450.699) [-1447.610] * (-1446.199) (-1448.691) (-1446.812) [-1446.160] -- 0:00:11
813500 -- [-1448.633] (-1448.942) (-1449.373) (-1447.498) * (-1447.126) (-1448.734) (-1448.029) [-1448.426] -- 0:00:11
814000 -- (-1447.546) [-1446.742] (-1448.323) (-1448.760) * [-1446.923] (-1445.668) (-1447.797) (-1447.685) -- 0:00:11
814500 -- (-1447.916) [-1448.043] (-1446.256) (-1447.647) * [-1445.995] (-1446.681) (-1447.871) (-1446.852) -- 0:00:11
815000 -- (-1447.542) (-1446.843) [-1445.952] (-1447.685) * (-1445.669) (-1446.897) (-1446.883) [-1446.504] -- 0:00:11
Average standard deviation of split frequencies: 0.008292
815500 -- (-1449.855) (-1449.912) (-1446.570) [-1447.510] * (-1446.121) (-1446.897) [-1448.994] (-1449.535) -- 0:00:11
816000 -- (-1450.160) (-1445.364) [-1446.545] (-1448.300) * [-1445.989] (-1445.775) (-1449.572) (-1446.019) -- 0:00:11
816500 -- (-1449.332) (-1449.763) [-1446.332] (-1448.678) * (-1446.857) [-1447.192] (-1451.410) (-1445.679) -- 0:00:11
817000 -- [-1451.272] (-1448.847) (-1446.715) (-1447.689) * [-1447.350] (-1447.671) (-1449.564) (-1448.797) -- 0:00:11
817500 -- (-1448.263) (-1447.280) (-1446.417) [-1445.585] * (-1448.038) (-1446.571) [-1446.717] (-1446.885) -- 0:00:11
818000 -- (-1448.625) (-1446.887) (-1450.725) [-1446.819] * (-1446.768) (-1446.125) [-1447.786] (-1448.281) -- 0:00:11
818500 -- (-1453.346) [-1446.686] (-1450.308) (-1447.403) * (-1447.544) (-1445.669) (-1450.093) [-1445.442] -- 0:00:11
819000 -- (-1449.990) (-1446.466) [-1448.458] (-1451.291) * (-1448.969) (-1449.300) (-1454.998) [-1445.682] -- 0:00:11
819500 -- (-1447.553) (-1447.886) [-1448.075] (-1449.047) * [-1448.015] (-1446.839) (-1447.054) (-1446.339) -- 0:00:11
820000 -- (-1449.206) (-1447.394) (-1446.073) [-1448.647] * [-1448.922] (-1448.143) (-1446.390) (-1446.309) -- 0:00:11
Average standard deviation of split frequencies: 0.007647
820500 -- [-1449.980] (-1446.937) (-1448.636) (-1447.901) * (-1446.326) (-1449.694) (-1447.982) [-1446.104] -- 0:00:11
821000 -- (-1446.519) (-1450.317) (-1448.242) [-1448.421] * (-1446.107) (-1446.723) (-1448.687) [-1450.184] -- 0:00:11
821500 -- (-1445.823) (-1453.903) [-1446.679] (-1446.815) * [-1445.460] (-1446.035) (-1448.278) (-1446.821) -- 0:00:11
822000 -- (-1448.050) (-1449.588) [-1447.105] (-1452.938) * [-1446.529] (-1448.402) (-1450.189) (-1450.081) -- 0:00:11
822500 -- (-1448.596) (-1448.119) [-1445.879] (-1447.957) * (-1447.196) [-1447.696] (-1449.182) (-1449.442) -- 0:00:11
823000 -- (-1448.612) (-1445.400) (-1447.196) [-1451.360] * (-1447.851) (-1446.043) [-1450.715] (-1448.028) -- 0:00:11
823500 -- (-1447.698) (-1449.215) (-1447.718) [-1447.136] * (-1454.901) (-1447.943) [-1449.198] (-1448.054) -- 0:00:11
824000 -- (-1445.764) [-1445.687] (-1448.124) (-1447.148) * (-1447.208) (-1446.288) [-1447.528] (-1445.994) -- 0:00:11
824500 -- (-1446.126) [-1445.707] (-1451.659) (-1451.830) * (-1446.746) [-1446.697] (-1447.226) (-1446.717) -- 0:00:11
825000 -- [-1446.294] (-1445.473) (-1445.923) (-1448.408) * [-1446.809] (-1447.965) (-1450.741) (-1447.527) -- 0:00:11
Average standard deviation of split frequencies: 0.007587
825500 -- (-1447.513) (-1446.906) [-1445.864] (-1448.473) * (-1445.335) [-1447.244] (-1445.825) (-1451.949) -- 0:00:11
826000 -- (-1447.796) (-1446.299) (-1449.432) [-1446.732] * (-1446.694) (-1449.830) [-1447.822] (-1449.811) -- 0:00:11
826500 -- (-1447.904) [-1447.526] (-1449.466) (-1445.716) * (-1447.934) (-1446.556) [-1446.833] (-1447.025) -- 0:00:11
827000 -- (-1446.813) (-1450.227) (-1445.891) [-1446.181] * (-1449.254) [-1446.382] (-1449.705) (-1449.005) -- 0:00:11
827500 -- (-1450.203) (-1449.366) (-1447.278) [-1446.116] * (-1447.530) (-1446.134) [-1447.636] (-1447.852) -- 0:00:11
828000 -- (-1448.300) [-1448.262] (-1448.682) (-1446.800) * [-1446.701] (-1446.910) (-1447.395) (-1449.967) -- 0:00:11
828500 -- (-1446.847) [-1447.423] (-1447.263) (-1449.795) * (-1446.389) [-1447.133] (-1445.628) (-1446.087) -- 0:00:10
829000 -- (-1447.214) (-1451.304) [-1447.568] (-1451.655) * (-1449.973) (-1447.276) (-1451.947) [-1446.878] -- 0:00:10
829500 -- [-1448.537] (-1449.607) (-1447.292) (-1449.612) * (-1446.603) (-1449.401) [-1450.271] (-1445.110) -- 0:00:10
830000 -- (-1447.692) [-1448.008] (-1446.313) (-1449.742) * (-1447.334) (-1449.888) (-1447.942) [-1447.590] -- 0:00:10
Average standard deviation of split frequencies: 0.006952
830500 -- [-1447.361] (-1448.184) (-1449.327) (-1447.472) * (-1447.917) [-1449.893] (-1446.997) (-1451.639) -- 0:00:10
831000 -- (-1451.082) (-1447.280) (-1448.423) [-1447.896] * [-1446.974] (-1447.319) (-1446.546) (-1446.700) -- 0:00:10
831500 -- (-1447.541) (-1449.506) (-1449.722) [-1448.254] * (-1449.137) [-1451.058] (-1447.710) (-1446.641) -- 0:00:10
832000 -- (-1446.465) [-1449.052] (-1449.240) (-1445.856) * (-1448.740) (-1447.325) [-1449.154] (-1445.725) -- 0:00:10
832500 -- [-1447.882] (-1449.503) (-1449.151) (-1445.190) * (-1449.585) [-1446.484] (-1451.679) (-1446.061) -- 0:00:10
833000 -- (-1447.023) (-1447.879) (-1447.451) [-1448.126] * [-1446.212] (-1445.676) (-1448.667) (-1445.980) -- 0:00:10
833500 -- (-1445.802) [-1446.966] (-1445.416) (-1448.971) * [-1446.221] (-1450.822) (-1449.007) (-1447.317) -- 0:00:10
834000 -- (-1446.470) (-1448.207) [-1446.598] (-1445.267) * (-1446.265) (-1449.166) [-1445.859] (-1447.596) -- 0:00:10
834500 -- (-1448.115) (-1445.848) [-1447.269] (-1448.287) * (-1447.433) (-1445.648) (-1446.431) [-1449.425] -- 0:00:10
835000 -- (-1446.293) (-1445.693) [-1446.428] (-1447.665) * [-1446.790] (-1446.547) (-1446.430) (-1449.227) -- 0:00:10
Average standard deviation of split frequencies: 0.007049
835500 -- (-1452.206) [-1448.056] (-1445.934) (-1449.138) * (-1449.476) [-1447.153] (-1448.485) (-1447.677) -- 0:00:10
836000 -- [-1448.585] (-1447.741) (-1445.969) (-1446.673) * (-1445.781) (-1445.973) (-1449.477) [-1445.895] -- 0:00:10
836500 -- (-1446.333) [-1446.182] (-1445.710) (-1446.719) * (-1449.833) (-1451.871) [-1448.762] (-1446.165) -- 0:00:10
837000 -- (-1446.310) (-1446.042) [-1446.567] (-1447.026) * (-1450.496) [-1448.379] (-1451.363) (-1445.656) -- 0:00:10
837500 -- (-1449.243) (-1447.760) (-1446.795) [-1449.070] * (-1449.045) [-1447.947] (-1446.626) (-1447.180) -- 0:00:10
838000 -- (-1447.732) (-1447.895) [-1448.844] (-1447.881) * (-1450.427) (-1445.598) [-1446.967] (-1451.147) -- 0:00:10
838500 -- (-1447.822) (-1448.817) [-1449.209] (-1446.227) * (-1448.027) [-1446.244] (-1446.956) (-1447.170) -- 0:00:10
839000 -- (-1446.649) (-1449.322) (-1449.377) [-1447.907] * (-1447.866) (-1446.244) (-1447.638) [-1448.454] -- 0:00:10
839500 -- [-1446.939] (-1449.766) (-1447.583) (-1447.948) * (-1447.437) [-1446.220] (-1449.046) (-1447.400) -- 0:00:10
840000 -- (-1447.331) [-1447.946] (-1449.752) (-1446.193) * (-1446.299) (-1448.542) [-1446.938] (-1451.827) -- 0:00:10
Average standard deviation of split frequencies: 0.007185
840500 -- (-1448.609) [-1446.783] (-1446.862) (-1445.976) * (-1447.821) (-1450.550) [-1447.160] (-1451.654) -- 0:00:10
841000 -- [-1447.605] (-1448.817) (-1446.802) (-1451.170) * (-1446.716) [-1451.017] (-1449.220) (-1449.255) -- 0:00:10
841500 -- [-1445.930] (-1447.469) (-1450.857) (-1450.423) * (-1445.160) [-1446.698] (-1449.941) (-1449.113) -- 0:00:10
842000 -- (-1445.379) (-1447.573) [-1447.489] (-1447.828) * [-1446.180] (-1445.570) (-1449.408) (-1448.524) -- 0:00:10
842500 -- (-1449.255) (-1448.517) [-1447.189] (-1446.544) * (-1447.092) (-1445.710) (-1446.742) [-1448.081] -- 0:00:10
843000 -- [-1446.561] (-1446.910) (-1450.080) (-1446.578) * (-1445.388) (-1445.628) (-1447.575) [-1447.043] -- 0:00:10
843500 -- (-1447.214) [-1447.358] (-1448.473) (-1447.284) * (-1448.359) [-1445.504] (-1447.486) (-1452.697) -- 0:00:10
844000 -- (-1446.951) [-1445.518] (-1447.397) (-1446.457) * (-1448.109) [-1446.791] (-1446.208) (-1452.494) -- 0:00:09
844500 -- (-1448.017) (-1446.899) [-1448.297] (-1447.898) * (-1449.890) [-1445.919] (-1446.293) (-1451.026) -- 0:00:09
845000 -- (-1447.869) (-1448.393) (-1448.663) [-1449.179] * (-1447.600) (-1448.354) (-1447.672) [-1447.630] -- 0:00:09
Average standard deviation of split frequencies: 0.007418
845500 -- (-1447.967) [-1445.458] (-1449.058) (-1456.603) * (-1447.995) [-1446.240] (-1447.025) (-1445.167) -- 0:00:09
846000 -- (-1452.297) (-1445.623) [-1446.941] (-1449.672) * (-1450.618) (-1447.742) (-1446.602) [-1446.267] -- 0:00:09
846500 -- (-1447.214) [-1446.120] (-1447.003) (-1446.747) * (-1449.863) [-1447.302] (-1446.282) (-1449.792) -- 0:00:09
847000 -- (-1447.111) (-1445.896) (-1446.717) [-1445.825] * (-1448.071) [-1449.386] (-1447.559) (-1446.481) -- 0:00:09
847500 -- (-1446.350) (-1446.907) (-1447.009) [-1447.201] * [-1446.957] (-1449.937) (-1445.857) (-1447.664) -- 0:00:09
848000 -- [-1446.549] (-1447.780) (-1445.761) (-1446.081) * (-1447.036) [-1447.176] (-1451.187) (-1447.941) -- 0:00:09
848500 -- (-1447.807) (-1449.289) (-1445.934) [-1445.546] * (-1449.014) [-1447.849] (-1449.017) (-1449.343) -- 0:00:09
849000 -- (-1447.816) (-1451.511) (-1445.287) [-1449.285] * [-1448.732] (-1446.550) (-1448.027) (-1450.749) -- 0:00:09
849500 -- (-1447.330) (-1447.597) [-1446.813] (-1449.494) * (-1445.852) (-1447.632) (-1446.822) [-1450.617] -- 0:00:09
850000 -- [-1450.099] (-1447.156) (-1446.119) (-1446.530) * (-1445.179) (-1448.331) (-1446.569) [-1445.467] -- 0:00:09
Average standard deviation of split frequencies: 0.007239
850500 -- [-1447.735] (-1450.297) (-1447.275) (-1449.380) * [-1445.531] (-1448.189) (-1445.211) (-1445.963) -- 0:00:09
851000 -- (-1446.341) [-1449.967] (-1448.174) (-1447.046) * (-1452.472) (-1452.005) (-1446.697) [-1446.355] -- 0:00:09
851500 -- (-1448.239) (-1450.795) (-1447.700) [-1446.125] * (-1447.494) (-1451.121) (-1445.436) [-1449.557] -- 0:00:09
852000 -- [-1448.548] (-1445.972) (-1448.143) (-1448.646) * (-1447.427) (-1446.464) [-1446.378] (-1448.046) -- 0:00:09
852500 -- [-1449.827] (-1446.756) (-1447.571) (-1449.422) * (-1445.965) (-1447.020) [-1446.559] (-1449.012) -- 0:00:09
853000 -- (-1448.389) (-1448.066) [-1447.652] (-1447.763) * (-1447.252) (-1446.615) (-1448.716) [-1447.090] -- 0:00:09
853500 -- (-1447.906) (-1448.178) [-1446.876] (-1447.130) * (-1446.655) (-1446.143) (-1449.890) [-1445.739] -- 0:00:09
854000 -- (-1446.969) (-1448.095) [-1445.502] (-1446.814) * (-1447.328) [-1445.736] (-1450.368) (-1446.967) -- 0:00:09
854500 -- (-1446.430) (-1447.175) (-1447.845) [-1446.795] * (-1452.480) (-1445.776) (-1447.827) [-1446.872] -- 0:00:09
855000 -- (-1447.310) (-1447.557) [-1447.112] (-1447.180) * (-1445.270) [-1447.197] (-1446.655) (-1449.262) -- 0:00:09
Average standard deviation of split frequencies: 0.007469
855500 -- [-1446.452] (-1448.021) (-1448.143) (-1450.950) * (-1445.276) [-1448.988] (-1447.166) (-1452.406) -- 0:00:09
856000 -- (-1447.674) (-1448.275) (-1449.692) [-1447.832] * (-1448.261) (-1448.412) (-1446.181) [-1451.548] -- 0:00:09
856500 -- (-1450.558) [-1445.560] (-1448.528) (-1447.583) * (-1447.301) (-1447.729) (-1448.979) [-1447.000] -- 0:00:09
857000 -- [-1447.451] (-1446.091) (-1446.906) (-1446.891) * (-1447.377) (-1448.215) (-1445.462) [-1452.669] -- 0:00:09
857500 -- (-1446.688) (-1449.139) (-1446.583) [-1445.283] * [-1450.946] (-1446.174) (-1446.344) (-1449.316) -- 0:00:09
858000 -- (-1448.756) (-1446.542) (-1446.378) [-1445.606] * (-1448.867) (-1448.330) [-1446.913] (-1446.737) -- 0:00:09
858500 -- (-1446.842) (-1447.126) (-1448.128) [-1445.453] * (-1449.006) (-1447.349) (-1450.746) [-1447.677] -- 0:00:09
859000 -- [-1447.304] (-1447.130) (-1451.525) (-1450.846) * (-1449.025) (-1446.640) [-1449.772] (-1448.418) -- 0:00:09
859500 -- (-1447.146) [-1448.043] (-1450.345) (-1449.915) * [-1447.228] (-1448.735) (-1451.520) (-1447.527) -- 0:00:08
860000 -- [-1446.289] (-1445.695) (-1451.337) (-1448.726) * (-1445.832) (-1450.213) (-1447.076) [-1447.011] -- 0:00:08
Average standard deviation of split frequencies: 0.007292
860500 -- [-1446.380] (-1445.272) (-1446.494) (-1446.988) * [-1448.208] (-1450.128) (-1448.485) (-1448.310) -- 0:00:08
861000 -- [-1446.044] (-1445.272) (-1445.677) (-1448.024) * (-1445.753) (-1447.377) [-1448.786] (-1448.180) -- 0:00:08
861500 -- [-1448.092] (-1445.791) (-1447.498) (-1447.311) * (-1446.347) (-1446.733) [-1450.704] (-1446.407) -- 0:00:08
862000 -- [-1447.306] (-1446.552) (-1447.596) (-1447.854) * (-1446.419) (-1446.890) (-1446.517) [-1447.453] -- 0:00:08
862500 -- (-1445.692) (-1445.919) [-1446.153] (-1449.206) * (-1450.136) (-1446.224) (-1446.059) [-1447.008] -- 0:00:08
863000 -- (-1447.798) (-1447.542) [-1446.813] (-1461.240) * [-1449.162] (-1446.103) (-1452.157) (-1446.874) -- 0:00:08
863500 -- (-1448.309) [-1447.836] (-1446.241) (-1447.491) * (-1449.873) (-1446.477) (-1458.094) [-1446.245] -- 0:00:08
864000 -- [-1447.282] (-1448.050) (-1448.325) (-1447.409) * [-1448.873] (-1447.929) (-1447.850) (-1447.034) -- 0:00:08
864500 -- (-1448.200) [-1448.149] (-1445.501) (-1446.469) * [-1446.737] (-1446.862) (-1446.631) (-1450.117) -- 0:00:08
865000 -- (-1448.106) (-1446.377) (-1446.176) [-1446.229] * (-1447.827) (-1445.605) (-1447.006) [-1446.663] -- 0:00:08
Average standard deviation of split frequencies: 0.007111
865500 -- (-1446.928) [-1448.140] (-1446.224) (-1449.195) * [-1445.558] (-1446.433) (-1451.684) (-1446.134) -- 0:00:08
866000 -- (-1445.721) [-1445.748] (-1447.211) (-1445.479) * [-1446.731] (-1445.702) (-1449.559) (-1445.754) -- 0:00:08
866500 -- [-1446.481] (-1445.376) (-1447.904) (-1446.248) * (-1446.862) (-1448.010) [-1448.196] (-1447.093) -- 0:00:08
867000 -- (-1446.590) [-1453.378] (-1452.343) (-1446.700) * (-1447.080) (-1450.277) (-1450.183) [-1447.412] -- 0:00:08
867500 -- (-1446.630) (-1453.993) [-1445.165] (-1447.428) * (-1445.316) (-1448.701) [-1447.185] (-1446.274) -- 0:00:08
868000 -- [-1445.737] (-1452.464) (-1445.333) (-1448.250) * [-1445.898] (-1451.451) (-1449.742) (-1446.363) -- 0:00:08
868500 -- (-1447.238) (-1447.697) [-1446.192] (-1447.968) * (-1448.458) (-1449.961) (-1449.580) [-1447.903] -- 0:00:08
869000 -- [-1445.878] (-1450.002) (-1449.787) (-1445.591) * (-1448.123) [-1446.441] (-1447.480) (-1446.642) -- 0:00:08
869500 -- (-1447.131) (-1446.551) [-1447.184] (-1447.257) * [-1445.737] (-1447.437) (-1452.898) (-1447.676) -- 0:00:08
870000 -- (-1447.500) (-1447.166) [-1447.806] (-1449.116) * (-1445.466) (-1448.311) (-1447.492) [-1447.086] -- 0:00:08
Average standard deviation of split frequencies: 0.007377
870500 -- (-1446.358) [-1447.315] (-1447.112) (-1452.413) * (-1446.125) (-1447.748) (-1446.130) [-1448.036] -- 0:00:08
871000 -- (-1447.273) (-1447.499) [-1447.808] (-1447.501) * [-1447.352] (-1445.553) (-1449.190) (-1450.061) -- 0:00:08
871500 -- [-1448.567] (-1450.017) (-1448.209) (-1449.413) * [-1446.508] (-1446.260) (-1450.622) (-1449.085) -- 0:00:08
872000 -- [-1446.659] (-1446.457) (-1447.467) (-1446.027) * (-1449.841) (-1447.477) [-1450.201] (-1448.409) -- 0:00:08
872500 -- (-1448.400) (-1447.451) (-1445.566) [-1448.406] * (-1450.299) [-1446.526] (-1447.338) (-1447.751) -- 0:00:08
873000 -- [-1448.348] (-1447.777) (-1445.495) (-1448.920) * (-1447.670) [-1448.929] (-1446.811) (-1452.588) -- 0:00:08
873500 -- (-1448.521) (-1454.235) [-1447.489] (-1447.139) * [-1447.454] (-1452.023) (-1448.973) (-1450.784) -- 0:00:08
874000 -- (-1447.641) [-1452.429] (-1446.939) (-1445.845) * (-1446.362) (-1445.901) (-1446.324) [-1449.497] -- 0:00:08
874500 -- (-1450.650) [-1452.619] (-1445.439) (-1448.401) * (-1445.171) (-1445.646) (-1446.030) [-1448.110] -- 0:00:08
875000 -- (-1449.057) (-1449.646) [-1445.532] (-1449.278) * [-1445.484] (-1446.172) (-1445.977) (-1447.899) -- 0:00:08
Average standard deviation of split frequencies: 0.007534
875500 -- (-1446.094) (-1448.299) (-1448.454) [-1450.497] * (-1445.945) [-1445.804] (-1448.283) (-1451.910) -- 0:00:07
876000 -- (-1447.197) [-1446.525] (-1449.270) (-1446.547) * (-1446.984) (-1446.518) (-1446.823) [-1446.176] -- 0:00:07
876500 -- (-1453.908) (-1445.700) (-1448.814) [-1446.761] * (-1449.871) (-1451.041) (-1449.628) [-1446.802] -- 0:00:07
877000 -- (-1449.028) [-1447.032] (-1448.824) (-1446.454) * (-1450.577) (-1451.067) (-1448.512) [-1447.754] -- 0:00:07
877500 -- (-1446.853) (-1446.714) (-1446.639) [-1448.387] * (-1448.737) (-1450.480) (-1447.981) [-1445.464] -- 0:00:07
878000 -- [-1449.204] (-1447.784) (-1447.704) (-1445.691) * (-1449.263) [-1449.703] (-1448.516) (-1447.538) -- 0:00:07
878500 -- (-1448.167) (-1449.055) [-1446.306] (-1446.938) * [-1446.623] (-1445.286) (-1446.451) (-1451.919) -- 0:00:07
879000 -- (-1448.547) [-1448.613] (-1445.314) (-1446.923) * (-1446.913) (-1446.756) [-1446.604] (-1448.626) -- 0:00:07
879500 -- (-1449.907) (-1448.699) [-1447.638] (-1450.723) * (-1445.303) [-1446.848] (-1447.174) (-1448.664) -- 0:00:07
880000 -- (-1448.308) (-1448.583) [-1448.787] (-1449.884) * (-1446.774) (-1449.042) [-1448.360] (-1450.470) -- 0:00:07
Average standard deviation of split frequencies: 0.007628
880500 -- [-1447.470] (-1445.749) (-1450.319) (-1447.752) * (-1446.859) (-1448.325) (-1448.789) [-1445.774] -- 0:00:07
881000 -- [-1447.804] (-1445.565) (-1448.856) (-1447.555) * (-1445.952) [-1446.640] (-1446.073) (-1446.458) -- 0:00:07
881500 -- (-1447.306) (-1446.965) (-1445.854) [-1446.711] * (-1446.187) [-1446.916] (-1446.081) (-1448.107) -- 0:00:07
882000 -- (-1450.015) (-1447.717) (-1446.399) [-1446.086] * (-1446.959) (-1447.024) [-1446.663] (-1448.915) -- 0:00:07
882500 -- (-1445.369) (-1446.813) (-1447.011) [-1446.370] * (-1449.973) (-1446.556) (-1446.061) [-1446.393] -- 0:00:07
883000 -- (-1449.824) [-1446.653] (-1447.961) (-1446.868) * (-1451.131) (-1446.975) [-1446.175] (-1446.298) -- 0:00:07
883500 -- (-1446.645) [-1446.564] (-1451.506) (-1446.329) * (-1451.000) (-1446.677) [-1447.318] (-1445.945) -- 0:00:07
884000 -- (-1446.688) (-1447.104) (-1446.493) [-1447.213] * (-1447.772) (-1449.278) [-1448.458] (-1449.032) -- 0:00:07
884500 -- (-1446.037) (-1449.139) (-1445.458) [-1446.131] * (-1450.602) [-1448.895] (-1445.915) (-1449.115) -- 0:00:07
885000 -- (-1446.582) (-1446.569) (-1447.347) [-1445.410] * (-1446.285) (-1453.579) [-1447.037] (-1449.745) -- 0:00:07
Average standard deviation of split frequencies: 0.007216
885500 -- (-1450.888) (-1447.480) [-1445.697] (-1447.722) * (-1446.209) [-1446.543] (-1446.667) (-1451.251) -- 0:00:07
886000 -- (-1452.287) (-1447.761) (-1447.157) [-1447.246] * (-1447.793) (-1446.674) [-1446.225] (-1448.379) -- 0:00:07
886500 -- (-1446.990) (-1446.633) (-1445.531) [-1445.606] * (-1453.678) [-1446.366] (-1446.772) (-1452.393) -- 0:00:07
887000 -- [-1447.014] (-1449.619) (-1445.531) (-1445.974) * (-1452.986) (-1447.527) [-1445.596] (-1451.362) -- 0:00:07
887500 -- (-1451.466) (-1445.717) (-1445.918) [-1445.442] * [-1445.788] (-1448.381) (-1446.709) (-1449.401) -- 0:00:07
888000 -- (-1447.879) [-1448.313] (-1445.611) (-1447.959) * (-1447.011) (-1452.634) (-1446.122) [-1447.268] -- 0:00:07
888500 -- (-1446.136) (-1447.185) [-1445.191] (-1459.364) * (-1453.164) (-1451.009) [-1446.123] (-1446.017) -- 0:00:07
889000 -- (-1447.968) (-1448.601) [-1446.788] (-1463.006) * (-1448.747) [-1448.247] (-1449.400) (-1448.050) -- 0:00:07
889500 -- (-1449.274) [-1448.665] (-1448.760) (-1461.735) * [-1445.712] (-1446.059) (-1450.369) (-1446.935) -- 0:00:07
890000 -- (-1447.817) [-1448.687] (-1446.833) (-1453.835) * (-1445.826) (-1449.679) (-1450.462) [-1447.801] -- 0:00:07
Average standard deviation of split frequencies: 0.007311
890500 -- (-1445.925) (-1448.143) [-1445.506] (-1445.485) * (-1446.102) (-1446.331) [-1445.231] (-1446.537) -- 0:00:07
891000 -- (-1446.122) (-1446.246) [-1447.526] (-1447.507) * [-1448.444] (-1447.503) (-1445.983) (-1447.386) -- 0:00:06
891500 -- (-1445.642) (-1447.082) (-1447.630) [-1446.846] * (-1447.410) (-1449.048) [-1452.122] (-1447.219) -- 0:00:06
892000 -- [-1447.651] (-1448.446) (-1450.132) (-1446.405) * (-1446.008) (-1447.166) (-1450.558) [-1445.205] -- 0:00:06
892500 -- [-1449.523] (-1451.977) (-1445.991) (-1450.120) * (-1447.172) [-1448.480] (-1450.819) (-1447.944) -- 0:00:06
893000 -- (-1449.668) [-1452.013] (-1454.433) (-1454.014) * (-1454.498) [-1446.960] (-1451.941) (-1447.187) -- 0:00:06
893500 -- [-1447.484] (-1446.851) (-1448.938) (-1450.059) * (-1448.308) (-1446.446) (-1449.204) [-1450.950] -- 0:00:06
894000 -- [-1447.860] (-1445.764) (-1447.899) (-1445.401) * (-1450.756) (-1450.342) [-1446.349] (-1446.960) -- 0:00:06
894500 -- (-1447.365) [-1445.296] (-1447.062) (-1445.344) * (-1448.367) [-1446.752] (-1446.997) (-1445.611) -- 0:00:06
895000 -- [-1448.955] (-1448.326) (-1447.890) (-1451.101) * (-1449.387) (-1445.856) [-1445.652] (-1453.317) -- 0:00:06
Average standard deviation of split frequencies: 0.007070
895500 -- (-1448.822) [-1448.143] (-1447.642) (-1449.802) * (-1446.831) (-1447.120) [-1449.494] (-1448.366) -- 0:00:06
896000 -- (-1450.677) (-1450.130) (-1446.830) [-1447.608] * (-1447.869) (-1446.338) [-1449.458] (-1446.180) -- 0:00:06
896500 -- (-1450.525) (-1446.455) (-1447.639) [-1447.642] * (-1446.387) (-1454.212) (-1449.040) [-1445.278] -- 0:00:06
897000 -- [-1445.343] (-1453.176) (-1445.781) (-1445.740) * (-1451.227) [-1450.332] (-1447.041) (-1449.336) -- 0:00:06
897500 -- [-1447.451] (-1449.452) (-1445.903) (-1450.100) * (-1448.358) (-1445.938) (-1446.431) [-1445.972] -- 0:00:06
898000 -- (-1447.646) (-1447.329) (-1447.120) [-1446.257] * (-1449.651) [-1450.491] (-1445.682) (-1446.934) -- 0:00:06
898500 -- (-1447.646) (-1446.778) (-1448.970) [-1447.149] * (-1446.912) (-1449.005) [-1449.751] (-1448.312) -- 0:00:06
899000 -- [-1445.948] (-1446.697) (-1445.815) (-1452.954) * (-1447.029) (-1446.210) (-1445.521) [-1445.860] -- 0:00:06
899500 -- [-1446.467] (-1450.045) (-1448.584) (-1450.786) * [-1446.962] (-1446.558) (-1446.044) (-1448.315) -- 0:00:06
900000 -- [-1446.759] (-1447.704) (-1447.325) (-1449.699) * (-1452.310) (-1448.177) (-1448.482) [-1450.393] -- 0:00:06
Average standard deviation of split frequencies: 0.006804
900500 -- [-1449.093] (-1448.442) (-1447.437) (-1447.521) * (-1450.957) (-1447.109) [-1447.603] (-1451.619) -- 0:00:06
901000 -- (-1449.772) (-1450.237) [-1446.343] (-1447.114) * [-1449.558] (-1450.017) (-1448.026) (-1449.409) -- 0:00:06
901500 -- (-1447.244) (-1448.547) (-1448.754) [-1449.206] * (-1452.973) (-1449.472) (-1450.800) [-1445.259] -- 0:00:06
902000 -- [-1447.192] (-1446.850) (-1447.548) (-1448.539) * (-1447.552) (-1451.008) (-1448.165) [-1447.867] -- 0:00:06
902500 -- [-1446.109] (-1448.930) (-1445.823) (-1447.063) * (-1445.985) (-1454.016) (-1446.386) [-1445.658] -- 0:00:06
903000 -- (-1446.841) [-1450.081] (-1446.748) (-1450.316) * (-1446.958) (-1448.035) [-1445.875] (-1447.419) -- 0:00:06
903500 -- [-1447.462] (-1446.993) (-1447.585) (-1448.365) * (-1447.344) [-1450.191] (-1450.472) (-1446.798) -- 0:00:06
904000 -- (-1450.793) (-1448.950) (-1448.543) [-1446.824] * (-1448.379) (-1450.188) [-1447.888] (-1446.646) -- 0:00:06
904500 -- [-1446.948] (-1451.299) (-1446.531) (-1446.135) * [-1446.827] (-1452.590) (-1446.751) (-1446.714) -- 0:00:06
905000 -- (-1451.294) (-1448.837) [-1449.693] (-1446.180) * (-1446.031) (-1449.227) [-1448.235] (-1446.764) -- 0:00:06
Average standard deviation of split frequencies: 0.006439
905500 -- (-1451.056) (-1446.221) (-1447.669) [-1446.197] * (-1447.171) (-1447.312) (-1449.068) [-1450.927] -- 0:00:06
906000 -- (-1445.553) [-1451.276] (-1450.086) (-1448.127) * (-1449.044) (-1450.153) [-1448.386] (-1457.361) -- 0:00:06
906500 -- (-1448.039) (-1446.684) (-1447.686) [-1446.967] * (-1451.510) (-1446.654) [-1447.277] (-1450.533) -- 0:00:05
907000 -- (-1448.940) (-1447.870) [-1448.928] (-1445.853) * (-1445.671) (-1448.183) [-1449.170] (-1450.146) -- 0:00:05
907500 -- (-1450.641) (-1447.523) [-1447.522] (-1445.522) * (-1445.579) (-1447.673) [-1446.514] (-1449.151) -- 0:00:05
908000 -- [-1448.654] (-1450.340) (-1446.469) (-1446.363) * [-1446.042] (-1447.020) (-1450.371) (-1446.290) -- 0:00:05
908500 -- (-1448.202) (-1448.802) [-1446.518] (-1450.055) * [-1447.759] (-1447.850) (-1448.035) (-1446.532) -- 0:00:05
909000 -- (-1446.590) (-1450.250) (-1445.616) [-1447.830] * (-1447.497) (-1448.836) (-1446.043) [-1451.870] -- 0:00:05
909500 -- (-1446.193) (-1449.381) (-1446.766) [-1446.925] * (-1446.251) (-1445.825) [-1446.002] (-1446.149) -- 0:00:05
910000 -- (-1449.609) (-1449.235) (-1446.453) [-1452.720] * (-1445.418) [-1447.332] (-1449.917) (-1448.127) -- 0:00:05
Average standard deviation of split frequencies: 0.006697
910500 -- (-1445.547) (-1450.914) [-1449.144] (-1451.087) * (-1445.942) (-1447.195) (-1451.274) [-1446.548] -- 0:00:05
911000 -- (-1447.224) (-1452.293) [-1446.609] (-1446.754) * (-1445.398) (-1447.215) [-1449.108] (-1446.420) -- 0:00:05
911500 -- (-1447.226) (-1451.087) [-1449.082] (-1448.288) * (-1445.868) (-1450.378) [-1447.599] (-1446.099) -- 0:00:05
912000 -- [-1446.779] (-1449.517) (-1450.264) (-1447.589) * (-1445.962) (-1447.556) (-1445.641) [-1447.318] -- 0:00:05
912500 -- (-1446.651) (-1446.670) [-1447.076] (-1448.589) * (-1451.655) [-1446.819] (-1447.558) (-1445.577) -- 0:00:05
913000 -- (-1446.567) (-1448.923) (-1450.564) [-1449.161] * (-1449.056) [-1446.859] (-1445.341) (-1447.316) -- 0:00:05
913500 -- (-1445.664) (-1449.876) [-1446.885] (-1447.237) * (-1448.086) [-1449.158] (-1447.282) (-1445.566) -- 0:00:05
914000 -- (-1449.432) (-1447.297) (-1446.309) [-1450.023] * (-1454.362) (-1454.022) (-1447.944) [-1445.948] -- 0:00:05
914500 -- (-1453.149) (-1447.874) [-1449.337] (-1446.807) * (-1451.608) [-1447.036] (-1447.078) (-1446.829) -- 0:00:05
915000 -- [-1448.065] (-1448.057) (-1448.746) (-1450.206) * (-1450.613) (-1447.173) (-1448.713) [-1446.183] -- 0:00:05
Average standard deviation of split frequencies: 0.006883
915500 -- (-1446.466) [-1447.928] (-1448.275) (-1446.809) * (-1451.956) (-1446.265) [-1448.034] (-1448.593) -- 0:00:05
916000 -- (-1447.233) [-1445.885] (-1446.823) (-1450.580) * (-1447.754) (-1449.422) [-1447.015] (-1447.003) -- 0:00:05
916500 -- (-1449.334) (-1445.884) [-1449.158] (-1448.720) * (-1447.193) (-1447.419) (-1445.639) [-1446.526] -- 0:00:05
917000 -- [-1446.419] (-1447.914) (-1449.620) (-1451.704) * (-1447.193) [-1447.690] (-1448.588) (-1446.864) -- 0:00:05
917500 -- (-1448.633) [-1448.096] (-1449.442) (-1449.381) * (-1448.208) (-1448.430) [-1448.149] (-1445.985) -- 0:00:05
918000 -- (-1447.583) (-1448.094) [-1449.312] (-1452.748) * (-1447.112) (-1446.703) (-1447.400) [-1447.086] -- 0:00:05
918500 -- (-1448.958) (-1448.109) [-1447.323] (-1451.151) * (-1447.187) (-1446.218) (-1446.525) [-1445.597] -- 0:00:05
919000 -- (-1447.295) (-1445.215) (-1448.077) [-1445.731] * [-1447.785] (-1447.972) (-1450.395) (-1445.729) -- 0:00:05
919500 -- [-1447.991] (-1446.633) (-1446.798) (-1446.134) * [-1447.410] (-1445.522) (-1449.696) (-1449.292) -- 0:00:05
920000 -- (-1445.722) (-1451.099) [-1446.310] (-1446.119) * (-1446.484) (-1449.121) [-1446.191] (-1452.710) -- 0:00:05
Average standard deviation of split frequencies: 0.006976
920500 -- (-1445.886) (-1447.494) [-1448.672] (-1452.656) * (-1446.742) (-1449.651) (-1446.014) [-1446.703] -- 0:00:05
921000 -- (-1451.832) (-1446.955) (-1446.819) [-1446.850] * (-1447.304) (-1450.817) [-1448.075] (-1446.153) -- 0:00:05
921500 -- (-1450.350) [-1445.778] (-1447.895) (-1448.650) * (-1447.387) (-1447.035) [-1449.384] (-1447.505) -- 0:00:05
922000 -- (-1447.815) (-1446.019) (-1448.473) [-1450.577] * (-1446.957) [-1447.207] (-1451.149) (-1448.186) -- 0:00:04
922500 -- (-1447.026) (-1447.475) (-1447.306) [-1449.841] * [-1445.888] (-1447.878) (-1447.977) (-1446.624) -- 0:00:04
923000 -- (-1449.477) (-1446.994) [-1448.214] (-1452.604) * (-1449.371) (-1446.607) (-1454.550) [-1446.991] -- 0:00:04
923500 -- [-1448.972] (-1447.441) (-1450.675) (-1451.502) * [-1446.597] (-1445.708) (-1446.030) (-1448.530) -- 0:00:04
924000 -- [-1450.735] (-1446.273) (-1446.738) (-1446.099) * (-1446.404) (-1446.257) [-1446.351] (-1447.983) -- 0:00:04
924500 -- (-1450.797) [-1447.300] (-1447.086) (-1446.053) * (-1448.717) (-1449.702) (-1446.689) [-1446.397] -- 0:00:04
925000 -- (-1447.704) (-1449.058) (-1448.195) [-1445.749] * (-1447.983) [-1451.213] (-1447.707) (-1450.413) -- 0:00:04
Average standard deviation of split frequencies: 0.006491
925500 -- (-1446.656) [-1447.224] (-1446.488) (-1446.177) * (-1446.873) [-1451.198] (-1448.050) (-1449.527) -- 0:00:04
926000 -- (-1445.277) [-1447.180] (-1447.845) (-1447.102) * (-1448.840) [-1447.595] (-1449.290) (-1451.366) -- 0:00:04
926500 -- [-1446.368] (-1447.885) (-1445.430) (-1450.815) * (-1445.517) [-1446.256] (-1447.911) (-1449.041) -- 0:00:04
927000 -- (-1446.427) (-1449.506) (-1446.389) [-1446.342] * [-1448.574] (-1450.195) (-1445.860) (-1450.497) -- 0:00:04
927500 -- [-1447.826] (-1449.293) (-1446.165) (-1450.384) * (-1445.463) [-1449.618] (-1449.594) (-1448.272) -- 0:00:04
928000 -- (-1445.572) [-1449.317] (-1448.581) (-1448.249) * (-1447.996) [-1447.180] (-1447.114) (-1447.320) -- 0:00:04
928500 -- (-1447.168) [-1448.626] (-1452.554) (-1446.907) * [-1446.894] (-1448.861) (-1446.204) (-1448.483) -- 0:00:04
929000 -- (-1446.071) [-1445.817] (-1452.948) (-1448.168) * (-1447.325) (-1448.172) (-1446.502) [-1446.656] -- 0:00:04
929500 -- (-1446.209) [-1446.823] (-1447.594) (-1449.285) * (-1446.630) (-1447.964) [-1446.134] (-1448.706) -- 0:00:04
930000 -- (-1449.604) [-1446.995] (-1446.819) (-1448.594) * [-1452.088] (-1446.880) (-1448.127) (-1447.403) -- 0:00:04
Average standard deviation of split frequencies: 0.006990
930500 -- (-1445.917) (-1445.561) [-1447.491] (-1448.415) * [-1446.675] (-1452.165) (-1448.225) (-1446.447) -- 0:00:04
931000 -- (-1445.706) (-1446.890) (-1448.571) [-1446.445] * [-1446.723] (-1454.849) (-1445.848) (-1452.508) -- 0:00:04
931500 -- (-1445.700) [-1447.851] (-1449.142) (-1449.152) * [-1446.085] (-1446.703) (-1446.146) (-1446.918) -- 0:00:04
932000 -- (-1447.555) (-1448.105) (-1448.427) [-1450.482] * [-1446.362] (-1448.644) (-1447.492) (-1450.064) -- 0:00:04
932500 -- (-1448.718) [-1446.599] (-1447.771) (-1449.784) * (-1445.646) (-1449.285) [-1445.814] (-1449.844) -- 0:00:04
933000 -- [-1454.545] (-1448.308) (-1447.703) (-1452.789) * (-1448.423) (-1449.172) [-1448.027] (-1452.522) -- 0:00:04
933500 -- (-1448.309) (-1447.278) (-1446.316) [-1451.196] * [-1446.616] (-1446.286) (-1448.099) (-1449.822) -- 0:00:04
934000 -- (-1448.980) (-1446.248) (-1449.410) [-1447.520] * [-1448.592] (-1449.215) (-1448.132) (-1449.991) -- 0:00:04
934500 -- [-1448.722] (-1446.564) (-1449.201) (-1447.634) * (-1448.332) (-1452.193) [-1445.253] (-1447.769) -- 0:00:04
935000 -- (-1449.402) (-1447.903) [-1446.108] (-1446.692) * [-1447.472] (-1446.432) (-1445.713) (-1447.008) -- 0:00:04
Average standard deviation of split frequencies: 0.007051
935500 -- (-1445.621) (-1446.619) (-1446.604) [-1449.932] * (-1447.356) (-1447.443) [-1446.431] (-1448.145) -- 0:00:04
936000 -- (-1445.900) [-1447.042] (-1458.679) (-1445.913) * [-1445.373] (-1450.038) (-1447.269) (-1446.175) -- 0:00:04
936500 -- [-1446.516] (-1453.600) (-1446.266) (-1447.897) * (-1447.466) (-1446.513) [-1447.438] (-1448.076) -- 0:00:04
937000 -- (-1447.262) (-1446.425) [-1447.719] (-1446.680) * (-1447.363) (-1447.931) (-1445.954) [-1447.338] -- 0:00:04
937500 -- (-1446.935) (-1447.257) [-1448.424] (-1446.402) * (-1446.428) [-1454.726] (-1448.473) (-1446.145) -- 0:00:04
938000 -- [-1447.191] (-1446.013) (-1447.622) (-1448.536) * [-1447.802] (-1449.861) (-1447.337) (-1445.988) -- 0:00:03
938500 -- (-1450.967) (-1447.318) [-1449.082] (-1447.480) * (-1447.589) [-1448.305] (-1448.544) (-1446.835) -- 0:00:03
939000 -- (-1451.436) [-1448.379] (-1447.796) (-1451.135) * [-1446.172] (-1446.923) (-1454.132) (-1447.090) -- 0:00:03
939500 -- [-1449.482] (-1446.223) (-1445.889) (-1447.429) * [-1447.736] (-1446.950) (-1446.521) (-1447.287) -- 0:00:03
940000 -- (-1447.430) (-1446.377) (-1446.965) [-1447.140] * (-1446.579) (-1446.374) (-1448.046) [-1447.426] -- 0:00:03
Average standard deviation of split frequencies: 0.006671
940500 -- (-1447.310) (-1446.177) (-1447.318) [-1448.100] * [-1446.980] (-1446.898) (-1446.038) (-1446.807) -- 0:00:03
941000 -- (-1449.882) [-1446.685] (-1445.970) (-1446.310) * [-1448.006] (-1449.287) (-1447.002) (-1446.218) -- 0:00:03
941500 -- [-1447.116] (-1446.833) (-1448.054) (-1448.668) * [-1450.008] (-1447.149) (-1448.496) (-1447.192) -- 0:00:03
942000 -- [-1446.881] (-1445.522) (-1449.124) (-1452.101) * (-1449.940) (-1446.255) (-1451.562) [-1446.627] -- 0:00:03
942500 -- (-1448.861) (-1446.715) [-1448.422] (-1445.382) * (-1447.271) (-1446.504) [-1448.009] (-1448.053) -- 0:00:03
943000 -- [-1448.745] (-1446.709) (-1448.490) (-1447.969) * [-1446.099] (-1446.117) (-1447.054) (-1446.339) -- 0:00:03
943500 -- (-1448.355) (-1447.789) (-1449.856) [-1447.983] * (-1448.811) (-1445.803) (-1449.102) [-1449.274] -- 0:00:03
944000 -- (-1446.684) (-1446.045) (-1448.103) [-1447.136] * (-1446.567) (-1445.852) [-1448.417] (-1450.117) -- 0:00:03
944500 -- (-1446.370) [-1448.406] (-1447.305) (-1445.256) * (-1449.012) (-1450.092) (-1445.731) [-1445.714] -- 0:00:03
945000 -- (-1445.839) (-1447.562) (-1446.119) [-1445.434] * (-1449.156) (-1445.660) (-1446.721) [-1446.244] -- 0:00:03
Average standard deviation of split frequencies: 0.006603
945500 -- (-1446.050) (-1447.147) [-1446.437] (-1446.013) * [-1446.107] (-1446.738) (-1447.641) (-1449.172) -- 0:00:03
946000 -- (-1449.681) [-1448.019] (-1447.909) (-1446.836) * (-1448.173) (-1445.474) [-1446.431] (-1448.752) -- 0:00:03
946500 -- (-1447.443) [-1448.037] (-1447.208) (-1447.468) * (-1445.386) [-1446.048] (-1448.062) (-1449.478) -- 0:00:03
947000 -- (-1446.455) [-1447.133] (-1450.114) (-1448.679) * (-1446.839) [-1448.897] (-1448.967) (-1448.728) -- 0:00:03
947500 -- [-1447.797] (-1448.499) (-1447.728) (-1447.004) * [-1450.394] (-1445.962) (-1447.462) (-1446.767) -- 0:00:03
948000 -- [-1450.710] (-1449.430) (-1447.454) (-1449.746) * (-1448.225) [-1446.024] (-1447.461) (-1445.483) -- 0:00:03
948500 -- (-1445.852) (-1452.363) [-1445.625] (-1447.839) * [-1448.225] (-1450.012) (-1448.158) (-1450.785) -- 0:00:03
949000 -- (-1448.272) (-1446.674) [-1447.826] (-1449.031) * (-1448.455) (-1449.750) (-1446.127) [-1445.911] -- 0:00:03
949500 -- (-1446.306) (-1446.356) [-1448.205] (-1446.206) * (-1449.328) (-1450.349) (-1446.068) [-1448.869] -- 0:00:03
950000 -- (-1447.575) (-1450.657) [-1448.345] (-1446.299) * (-1448.480) [-1449.039] (-1449.149) (-1446.790) -- 0:00:03
Average standard deviation of split frequencies: 0.006281
950500 -- (-1449.124) (-1448.681) (-1448.179) [-1447.222] * (-1448.197) (-1446.557) [-1447.468] (-1447.512) -- 0:00:03
951000 -- (-1449.184) (-1447.100) (-1447.212) [-1445.612] * (-1449.868) [-1448.033] (-1447.241) (-1451.736) -- 0:00:03
951500 -- (-1448.018) (-1445.522) [-1446.752] (-1447.575) * (-1446.741) (-1448.729) (-1445.161) [-1448.471] -- 0:00:03
952000 -- (-1447.678) (-1446.208) (-1448.062) [-1446.961] * (-1448.531) [-1447.260] (-1448.118) (-1449.204) -- 0:00:03
952500 -- (-1445.699) [-1448.757] (-1446.299) (-1446.600) * (-1446.614) [-1447.877] (-1445.276) (-1447.741) -- 0:00:03
953000 -- (-1446.477) [-1449.939] (-1447.467) (-1445.908) * (-1448.784) (-1449.440) (-1447.185) [-1445.849] -- 0:00:03
953500 -- (-1450.384) (-1449.592) (-1450.304) [-1445.598] * (-1447.270) (-1448.343) (-1448.319) [-1446.922] -- 0:00:02
954000 -- (-1445.615) (-1447.171) [-1448.592] (-1446.973) * (-1447.001) (-1449.094) [-1446.955] (-1446.662) -- 0:00:02
954500 -- (-1446.411) [-1447.892] (-1448.214) (-1447.143) * (-1447.088) (-1449.554) (-1446.344) [-1446.389] -- 0:00:02
955000 -- [-1448.631] (-1449.216) (-1449.255) (-1447.688) * (-1447.299) [-1448.614] (-1445.864) (-1447.028) -- 0:00:02
Average standard deviation of split frequencies: 0.006213
955500 -- (-1447.782) [-1447.998] (-1449.905) (-1445.964) * (-1446.239) (-1449.406) (-1449.747) [-1445.817] -- 0:00:02
956000 -- [-1446.209] (-1451.224) (-1447.967) (-1450.056) * (-1448.045) (-1445.672) [-1449.242] (-1445.688) -- 0:00:02
956500 -- (-1447.020) (-1451.784) (-1446.399) [-1450.687] * (-1447.357) (-1447.859) [-1445.927] (-1448.203) -- 0:00:02
957000 -- (-1449.822) [-1445.645] (-1450.366) (-1446.047) * (-1450.609) [-1445.923] (-1445.534) (-1446.534) -- 0:00:02
957500 -- (-1447.000) [-1447.071] (-1445.755) (-1447.135) * (-1452.151) (-1445.674) [-1446.043] (-1445.233) -- 0:00:02
958000 -- (-1447.745) [-1447.067] (-1445.853) (-1446.171) * (-1453.941) (-1445.647) [-1446.219] (-1451.228) -- 0:00:02
958500 -- (-1448.681) (-1448.665) [-1449.463] (-1446.241) * [-1447.553] (-1447.750) (-1445.908) (-1449.646) -- 0:00:02
959000 -- (-1447.092) [-1447.077] (-1445.447) (-1447.737) * (-1447.964) (-1447.683) [-1446.946] (-1448.745) -- 0:00:02
959500 -- (-1450.566) (-1445.542) [-1446.821] (-1447.469) * [-1445.952] (-1448.164) (-1445.656) (-1449.579) -- 0:00:02
960000 -- (-1450.706) (-1445.354) [-1448.159] (-1447.702) * (-1446.083) [-1451.402] (-1449.343) (-1447.347) -- 0:00:02
Average standard deviation of split frequencies: 0.005823
960500 -- (-1448.721) [-1445.875] (-1449.550) (-1449.863) * (-1447.510) [-1449.499] (-1451.433) (-1446.229) -- 0:00:02
961000 -- [-1449.407] (-1446.400) (-1454.213) (-1446.397) * (-1447.162) [-1450.239] (-1448.067) (-1447.109) -- 0:00:02
961500 -- [-1448.164] (-1445.466) (-1448.204) (-1446.477) * (-1447.978) (-1450.254) [-1447.116] (-1450.393) -- 0:00:02
962000 -- (-1451.089) (-1446.574) (-1446.024) [-1450.887] * [-1446.612] (-1449.699) (-1446.132) (-1447.594) -- 0:00:02
962500 -- (-1450.755) (-1447.185) [-1446.367] (-1455.140) * [-1448.014] (-1448.913) (-1447.627) (-1450.084) -- 0:00:02
963000 -- (-1446.661) (-1447.055) (-1449.843) [-1447.792] * (-1445.845) (-1448.899) [-1448.322] (-1451.604) -- 0:00:02
963500 -- (-1446.502) [-1446.889] (-1448.491) (-1449.237) * (-1446.352) [-1446.847] (-1448.936) (-1449.918) -- 0:00:02
964000 -- (-1448.613) (-1450.077) (-1448.119) [-1448.462] * (-1446.440) [-1445.733] (-1449.264) (-1449.197) -- 0:00:02
964500 -- (-1448.564) [-1447.596] (-1445.913) (-1448.029) * (-1449.391) (-1447.089) (-1448.734) [-1448.822] -- 0:00:02
965000 -- [-1448.008] (-1449.201) (-1446.425) (-1451.078) * (-1448.803) (-1447.456) (-1452.394) [-1446.709] -- 0:00:02
Average standard deviation of split frequencies: 0.005661
965500 -- (-1447.824) (-1448.039) (-1448.932) [-1450.938] * (-1448.944) (-1446.328) [-1447.623] (-1452.637) -- 0:00:02
966000 -- (-1448.354) (-1446.322) (-1448.480) [-1451.240] * [-1449.606] (-1445.191) (-1449.287) (-1448.115) -- 0:00:02
966500 -- (-1446.725) [-1450.010] (-1446.711) (-1450.704) * (-1449.407) [-1448.220] (-1447.478) (-1451.677) -- 0:00:02
967000 -- [-1448.222] (-1446.485) (-1446.163) (-1449.455) * (-1449.574) (-1447.972) (-1449.369) [-1445.522] -- 0:00:02
967500 -- (-1447.465) [-1446.299] (-1446.857) (-1451.257) * (-1445.666) (-1447.301) (-1446.704) [-1446.546] -- 0:00:02
968000 -- [-1446.656] (-1446.238) (-1445.368) (-1446.522) * [-1448.476] (-1445.820) (-1447.140) (-1447.084) -- 0:00:02
968500 -- (-1451.480) (-1448.317) (-1446.513) [-1446.909] * (-1448.584) [-1447.171] (-1450.414) (-1446.651) -- 0:00:02
969000 -- (-1450.022) (-1447.611) (-1452.079) [-1446.089] * (-1451.654) [-1447.606] (-1446.073) (-1447.474) -- 0:00:01
969500 -- [-1445.678] (-1445.933) (-1446.504) (-1446.774) * [-1448.812] (-1449.309) (-1450.434) (-1448.151) -- 0:00:01
970000 -- (-1449.605) [-1447.116] (-1447.184) (-1446.262) * (-1449.213) (-1447.209) [-1448.582] (-1450.332) -- 0:00:01
Average standard deviation of split frequencies: 0.006040
970500 -- (-1445.859) [-1447.507] (-1447.086) (-1446.405) * (-1446.210) (-1447.032) [-1447.795] (-1448.274) -- 0:00:01
971000 -- (-1445.852) (-1447.116) (-1448.267) [-1446.606] * (-1446.455) [-1446.790] (-1450.310) (-1447.823) -- 0:00:01
971500 -- (-1446.544) (-1446.880) (-1451.839) [-1446.499] * [-1445.228] (-1447.922) (-1445.409) (-1447.348) -- 0:00:01
972000 -- (-1446.140) (-1453.678) [-1449.905] (-1449.776) * (-1446.303) [-1447.833] (-1449.299) (-1451.321) -- 0:00:01
972500 -- (-1447.338) (-1449.261) (-1447.668) [-1447.805] * (-1450.975) (-1451.285) [-1447.245] (-1451.293) -- 0:00:01
973000 -- (-1455.375) [-1445.861] (-1445.641) (-1451.135) * (-1450.292) (-1451.042) (-1451.007) [-1449.069] -- 0:00:01
973500 -- (-1446.552) (-1447.688) [-1447.654] (-1448.393) * (-1450.314) [-1449.164] (-1447.796) (-1448.337) -- 0:00:01
974000 -- (-1447.506) [-1446.958] (-1454.878) (-1448.856) * (-1446.455) (-1446.911) [-1448.864] (-1447.453) -- 0:00:01
974500 -- (-1446.650) (-1447.831) (-1446.853) [-1449.703] * (-1448.394) [-1446.885] (-1445.626) (-1446.783) -- 0:00:01
975000 -- (-1446.574) (-1445.987) [-1446.421] (-1447.132) * (-1447.174) (-1447.595) (-1445.695) [-1449.282] -- 0:00:01
Average standard deviation of split frequencies: 0.005571
975500 -- (-1452.097) (-1446.445) [-1446.378] (-1445.708) * (-1447.186) (-1446.358) (-1445.467) [-1453.655] -- 0:00:01
976000 -- (-1446.585) (-1446.831) (-1446.384) [-1448.016] * (-1449.367) [-1445.305] (-1448.067) (-1448.088) -- 0:00:01
976500 -- (-1447.898) [-1447.032] (-1447.214) (-1447.601) * (-1446.112) (-1446.237) (-1446.695) [-1449.289] -- 0:00:01
977000 -- (-1455.707) (-1446.380) [-1446.593] (-1450.061) * [-1445.526] (-1446.573) (-1446.500) (-1447.778) -- 0:00:01
977500 -- (-1451.474) (-1446.083) (-1446.746) [-1445.809] * (-1447.298) (-1446.590) [-1445.458] (-1450.795) -- 0:00:01
978000 -- (-1447.323) (-1446.493) (-1447.154) [-1446.304] * (-1446.230) [-1446.457] (-1446.578) (-1447.133) -- 0:00:01
978500 -- (-1449.443) (-1449.676) [-1448.204] (-1447.017) * (-1450.660) [-1446.174] (-1448.164) (-1447.707) -- 0:00:01
979000 -- [-1445.714] (-1448.840) (-1449.546) (-1446.322) * (-1449.454) (-1446.918) [-1447.149] (-1445.155) -- 0:00:01
979500 -- (-1454.676) [-1446.088] (-1451.277) (-1446.812) * [-1448.890] (-1447.301) (-1447.689) (-1448.143) -- 0:00:01
980000 -- (-1455.618) (-1449.125) (-1447.783) [-1445.598] * (-1452.366) (-1448.542) [-1446.016] (-1445.970) -- 0:00:01
Average standard deviation of split frequencies: 0.006025
980500 -- (-1445.970) (-1452.138) [-1450.381] (-1447.973) * (-1445.760) [-1446.862] (-1445.915) (-1446.543) -- 0:00:01
981000 -- (-1445.993) [-1447.790] (-1446.987) (-1446.475) * (-1445.778) [-1451.179] (-1446.992) (-1447.492) -- 0:00:01
981500 -- (-1449.072) (-1447.728) [-1449.540] (-1446.258) * (-1447.687) (-1448.856) (-1447.937) [-1447.699] -- 0:00:01
982000 -- [-1446.371] (-1450.479) (-1445.804) (-1447.606) * (-1447.632) (-1452.388) (-1448.106) [-1449.883] -- 0:00:01
982500 -- (-1447.724) (-1451.105) [-1446.526] (-1449.336) * [-1446.553] (-1450.116) (-1448.430) (-1447.653) -- 0:00:01
983000 -- (-1445.941) (-1447.288) [-1445.657] (-1447.805) * (-1447.905) (-1446.953) (-1447.194) [-1447.666] -- 0:00:01
983500 -- (-1445.798) [-1445.628] (-1446.161) (-1452.775) * (-1453.666) (-1447.033) (-1447.754) [-1448.718] -- 0:00:01
984000 -- (-1448.335) [-1446.642] (-1446.609) (-1449.068) * (-1447.846) (-1448.333) (-1447.287) [-1447.165] -- 0:00:01
984500 -- (-1448.131) [-1451.581] (-1448.275) (-1452.366) * (-1446.000) [-1448.027] (-1447.035) (-1445.738) -- 0:00:00
985000 -- (-1446.270) [-1447.750] (-1446.442) (-1449.487) * (-1451.319) [-1446.419] (-1445.941) (-1449.608) -- 0:00:00
Average standard deviation of split frequencies: 0.005801
985500 -- (-1446.681) [-1447.665] (-1446.666) (-1447.841) * (-1453.387) [-1446.524] (-1448.080) (-1449.093) -- 0:00:00
986000 -- [-1445.750] (-1449.853) (-1446.957) (-1454.084) * (-1453.403) [-1447.860] (-1446.286) (-1446.440) -- 0:00:00
986500 -- (-1446.997) [-1446.260] (-1450.056) (-1453.689) * (-1448.466) (-1447.747) (-1449.437) [-1445.944] -- 0:00:00
987000 -- (-1449.526) [-1448.997] (-1445.723) (-1446.784) * (-1448.391) (-1446.028) (-1445.157) [-1449.760] -- 0:00:00
987500 -- (-1447.527) (-1446.817) (-1452.556) [-1446.247] * (-1445.596) [-1446.447] (-1448.263) (-1448.891) -- 0:00:00
988000 -- [-1447.086] (-1445.866) (-1448.624) (-1449.416) * [-1447.713] (-1446.772) (-1449.228) (-1447.870) -- 0:00:00
988500 -- (-1448.184) [-1446.704] (-1447.383) (-1447.592) * [-1447.956] (-1447.429) (-1450.397) (-1447.567) -- 0:00:00
989000 -- (-1446.568) [-1447.052] (-1450.824) (-1446.852) * (-1450.750) [-1445.460] (-1446.230) (-1446.242) -- 0:00:00
989500 -- (-1449.137) (-1446.170) [-1450.252] (-1452.595) * (-1450.818) [-1446.121] (-1449.619) (-1446.499) -- 0:00:00
990000 -- (-1453.146) [-1447.219] (-1449.068) (-1446.029) * (-1447.313) (-1448.603) [-1446.634] (-1445.696) -- 0:00:00
Average standard deviation of split frequencies: 0.005552
990500 -- (-1450.709) (-1447.461) [-1447.615] (-1447.460) * [-1447.926] (-1446.951) (-1449.512) (-1448.060) -- 0:00:00
991000 -- (-1448.486) [-1445.706] (-1446.458) (-1445.922) * (-1449.776) [-1446.958] (-1449.455) (-1446.678) -- 0:00:00
991500 -- (-1448.600) [-1446.750] (-1445.594) (-1446.861) * (-1450.926) (-1449.684) [-1446.852] (-1446.622) -- 0:00:00
992000 -- [-1445.543] (-1447.894) (-1445.957) (-1446.041) * (-1449.859) [-1449.297] (-1446.355) (-1449.122) -- 0:00:00
992500 -- [-1449.676] (-1447.756) (-1449.643) (-1446.039) * [-1446.077] (-1450.198) (-1446.134) (-1448.255) -- 0:00:00
993000 -- (-1447.453) [-1448.741] (-1447.847) (-1446.237) * (-1451.360) (-1447.015) [-1448.478] (-1448.237) -- 0:00:00
993500 -- (-1448.092) (-1452.167) (-1445.927) [-1449.289] * (-1449.212) [-1448.611] (-1447.487) (-1448.646) -- 0:00:00
994000 -- (-1446.764) (-1447.764) (-1449.726) [-1447.551] * (-1446.683) (-1451.156) [-1447.429] (-1450.153) -- 0:00:00
994500 -- (-1446.751) [-1447.529] (-1449.237) (-1447.166) * (-1447.781) [-1447.061] (-1447.673) (-1450.030) -- 0:00:00
995000 -- [-1446.573] (-1448.188) (-1446.603) (-1448.432) * (-1448.585) (-1449.364) [-1446.547] (-1451.519) -- 0:00:00
Average standard deviation of split frequencies: 0.005743
995500 -- (-1449.292) [-1446.656] (-1445.573) (-1448.673) * (-1446.057) (-1447.078) [-1448.271] (-1449.772) -- 0:00:00
996000 -- (-1449.528) [-1447.841] (-1446.651) (-1448.417) * (-1448.986) (-1445.857) (-1449.796) [-1446.623] -- 0:00:00
996500 -- (-1448.404) [-1448.879] (-1449.269) (-1445.799) * (-1461.384) (-1448.140) [-1446.305] (-1446.462) -- 0:00:00
997000 -- (-1452.339) (-1446.783) [-1447.677] (-1445.644) * (-1449.886) (-1446.185) (-1447.452) [-1447.602] -- 0:00:00
997500 -- (-1451.496) (-1449.797) (-1446.914) [-1450.238] * (-1445.694) (-1446.068) (-1447.172) [-1448.421] -- 0:00:00
998000 -- (-1448.517) (-1446.590) (-1447.673) [-1446.077] * (-1448.337) (-1451.706) [-1446.491] (-1445.872) -- 0:00:00
998500 -- (-1450.118) [-1446.648] (-1448.658) (-1448.441) * (-1455.226) (-1447.350) (-1446.517) [-1447.121] -- 0:00:00
999000 -- (-1448.258) (-1446.866) [-1447.479] (-1447.278) * (-1450.277) (-1446.797) [-1449.007] (-1447.230) -- 0:00:00
999500 -- [-1447.494] (-1446.669) (-1448.072) (-1446.515) * (-1446.398) (-1447.991) (-1445.402) [-1448.501] -- 0:00:00
1000000 -- (-1445.790) [-1446.785] (-1447.468) (-1446.526) * (-1446.732) [-1447.016] (-1448.980) (-1448.693) -- 0:00:00
Average standard deviation of split frequencies: 0.005496
Analysis completed in 1 mins 4 seconds
Analysis used 62.65 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1445.00
Likelihood of best state for "cold" chain of run 2 was -1445.00
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
25.5 % ( 30 %) Dirichlet(Pi{all})
27.3 % ( 21 %) Slider(Pi{all})
78.7 % ( 54 %) Multiplier(Alpha{1,2})
78.1 % ( 57 %) Multiplier(Alpha{3})
16.7 % ( 28 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
25.1 % ( 26 %) Dirichlet(Pi{all})
27.1 % ( 32 %) Slider(Pi{all})
78.7 % ( 49 %) Multiplier(Alpha{1,2})
77.7 % ( 49 %) Multiplier(Alpha{3})
16.5 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.3 % ( 21 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.3 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167569 0.82 0.67
3 | 166245 167068 0.83
4 | 166785 165877 166456
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167098 0.82 0.67
3 | 166215 166484 0.84
4 | 166187 166507 167509
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1446.82
| 1 2 |
| 2 1 1 1 2 1 |
| 2 2 2 1 2 1 |
| 1 1 1 21 1 |
| 22 122 212 12 2 211 1 2|
| 2 2 1 2 222 2 1 1 1 2 2 |
| 2 1 2 1 1 2 2 12 2 2 1|
|2 1 1 2 12 2 * 1 2 2 2 |
| * 11 2 21 1 * 2 2 1 *112 |
|1 1 1 1 1 121 2 2 1 |
| 1 2 2 1 11 |
| 2 1 12 22 11 |
| |
| 1 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1448.44
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1446.77 -1451.09
2 -1446.73 -1450.01
--------------------------------------
TOTAL -1446.75 -1450.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899213 0.087078 0.374652 1.477138 0.866113 1501.00 1501.00 1.003
r(A<->C){all} 0.164700 0.017427 0.000001 0.412857 0.134192 169.54 208.65 1.000
r(A<->G){all} 0.172620 0.021062 0.000021 0.455991 0.135891 179.71 182.23 1.006
r(A<->T){all} 0.167407 0.019618 0.000125 0.437982 0.132397 152.04 196.91 1.003
r(C<->G){all} 0.160343 0.019081 0.000013 0.438950 0.123693 102.06 152.72 1.007
r(C<->T){all} 0.172581 0.021753 0.000093 0.479313 0.133334 223.01 238.99 1.001
r(G<->T){all} 0.162349 0.017358 0.000030 0.428979 0.132177 301.52 309.52 1.002
pi(A){all} 0.187703 0.000148 0.164153 0.211451 0.187694 1404.95 1426.42 1.000
pi(C){all} 0.292651 0.000215 0.264262 0.321011 0.292430 1250.79 1309.08 1.001
pi(G){all} 0.317760 0.000203 0.289162 0.344480 0.317485 1259.44 1262.37 1.000
pi(T){all} 0.201885 0.000155 0.177079 0.225388 0.201623 1289.29 1395.14 1.000
alpha{1,2} 0.419714 0.240862 0.000139 1.405847 0.251566 1121.48 1190.66 1.000
alpha{3} 0.462653 0.253491 0.000103 1.443979 0.292625 1321.50 1411.25 1.000
pinvar{all} 0.998578 0.000003 0.995541 1.000000 0.999124 979.98 1164.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .***.*
9 -- ..*.*.
10 -- .*..*.
11 -- .*.***
12 -- ...**.
13 -- .**...
14 -- ...*.*
15 -- .*...*
16 -- .*.*..
17 -- ....**
18 -- .**.**
19 -- ..****
20 -- .****.
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 456 0.151899 0.005653 0.147901 0.155896 2
8 455 0.151566 0.003298 0.149234 0.153897 2
9 449 0.149567 0.000471 0.149234 0.149900 2
10 440 0.146569 0.005653 0.142572 0.150566 2
11 436 0.145237 0.003769 0.142572 0.147901 2
12 431 0.143571 0.007066 0.138574 0.148568 2
13 430 0.143238 0.006595 0.138574 0.147901 2
14 429 0.142905 0.020257 0.128581 0.157229 2
15 425 0.141572 0.000471 0.141239 0.141905 2
16 423 0.140906 0.000471 0.140573 0.141239 2
17 421 0.140240 0.002355 0.138574 0.141905 2
18 419 0.139574 0.001413 0.138574 0.140573 2
19 405 0.134910 0.004240 0.131912 0.137908 2
20 399 0.132911 0.007066 0.127915 0.137908 2
21 397 0.132245 0.013662 0.122585 0.141905 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2659/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099001 0.010111 0.000032 0.303156 0.068174 1.000 2
length{all}[2] 0.099259 0.009889 0.000013 0.296015 0.066786 1.001 2
length{all}[3] 0.100501 0.009835 0.000002 0.301843 0.069984 1.000 2
length{all}[4] 0.103083 0.010509 0.000026 0.312784 0.071042 1.002 2
length{all}[5] 0.099630 0.009816 0.000007 0.294395 0.066475 1.000 2
length{all}[6] 0.099315 0.009914 0.000065 0.296989 0.069337 1.002 2
length{all}[7] 0.103690 0.011041 0.000138 0.309938 0.071931 0.999 2
length{all}[8] 0.103424 0.011761 0.000389 0.316827 0.068710 0.999 2
length{all}[9] 0.098353 0.010799 0.000437 0.299095 0.061262 0.998 2
length{all}[10] 0.099138 0.010033 0.000034 0.299525 0.066203 0.999 2
length{all}[11] 0.101183 0.009685 0.000696 0.318691 0.064741 0.998 2
length{all}[12] 0.097331 0.009534 0.000144 0.310452 0.067184 0.998 2
length{all}[13] 0.101452 0.009355 0.000454 0.279028 0.070901 0.998 2
length{all}[14] 0.094718 0.008146 0.000430 0.261032 0.067825 1.001 2
length{all}[15] 0.097441 0.009527 0.000213 0.281715 0.068197 0.998 2
length{all}[16] 0.100274 0.012754 0.000126 0.305440 0.064770 1.000 2
length{all}[17] 0.097277 0.009026 0.000727 0.281094 0.064581 0.998 2
length{all}[18] 0.098396 0.008595 0.000033 0.300121 0.065929 0.999 2
length{all}[19] 0.099110 0.009090 0.000018 0.282899 0.068349 0.998 2
length{all}[20] 0.100854 0.008721 0.000250 0.283943 0.069568 0.998 2
length{all}[21] 0.102185 0.008940 0.000321 0.278295 0.077013 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005496
Maximum standard deviation of split frequencies = 0.020257
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1062
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 354 / 354 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 354 / 354 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070389 0.100003 0.021697 0.099436 0.099055 0.018498 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1537.166678
Iterating by ming2
Initial: fx= 1537.166678
x= 0.07039 0.10000 0.02170 0.09944 0.09905 0.01850 0.30000 1.30000
1 h-m-p 0.0000 0.0001 850.0438 ++ 1498.939730 m 0.0001 13 | 1/8
2 h-m-p 0.0005 0.0027 65.3264 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 777.1667 ++ 1493.417923 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0064 53.7983 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 693.7264 ++ 1425.566097 m 0.0001 74 | 3/8
6 h-m-p 0.0021 0.0105 35.5119 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 605.3127 ++ 1395.047512 m 0.0001 106 | 4/8
8 h-m-p 0.0026 0.1255 15.7964 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 496.7935 ++ 1394.774280 m 0.0000 138 | 5/8
10 h-m-p 0.0160 8.0000 11.2419 -------------.. | 5/8
11 h-m-p 0.0000 0.0000 351.2923 ++ 1394.571646 m 0.0000 171 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 --C 1394.571646 0 0.0003 184 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 C 1394.571646 0 1.6000 197
Out..
lnL = -1394.571646
198 lfun, 198 eigenQcodon, 1188 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.078998 0.027715 0.034231 0.100057 0.024775 0.035763 0.299934 0.587026 0.571799
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.203921
np = 9
lnL0 = -1499.429083
Iterating by ming2
Initial: fx= 1499.429083
x= 0.07900 0.02771 0.03423 0.10006 0.02478 0.03576 0.29993 0.58703 0.57180
1 h-m-p 0.0000 0.0001 844.4106 ++ 1448.185961 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 253.0760 ++ 1443.090809 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 33884.2157 ++ 1434.625698 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 4229060.4744 ++ 1433.149216 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 10750.8731 ++ 1403.810765 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 35865.7360 ++ 1394.571676 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 1394.571675 m 8.0000 86 | 6/9
8 h-m-p 0.0248 2.4997 0.0471 ------------Y 1394.571675 0 0.0000 113 | 6/9
9 h-m-p 0.0160 8.0000 0.0582 +++++ 1394.571657 m 8.0000 131 | 6/9
10 h-m-p 0.5377 2.6886 0.2146 ++ 1394.571651 m 2.6886 146 | 7/9
11 h-m-p 0.2853 1.4266 0.0507 ++ 1394.571651 m 1.4266 161 | 7/9
12 h-m-p -0.0000 -0.0000 3.1949
h-m-p: -2.56381483e-19 -1.28190741e-18 3.19491305e+00 1394.571651
.. | 7/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 1394.571651 m 8.0000 187 | 7/9
14 h-m-p 0.0171 8.0000 0.0042 ------Y 1394.571651 0 0.0000 207 | 7/9
15 h-m-p 0.0160 8.0000 0.0000 Y 1394.571651 0 0.0040 221 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
17 h-m-p 0.0160 8.0000 0.0000 +++++ 1394.571651 m 8.0000 263 | 7/9
18 h-m-p 0.0160 8.0000 0.0687 +++++ 1394.571647 m 8.0000 280 | 7/9
19 h-m-p 0.5331 8.0000 1.0315 ++ 1394.571634 m 8.0000 294 | 7/9
20 h-m-p 1.6000 8.0000 0.4293 ++ 1394.571633 m 8.0000 306 | 7/9
21 h-m-p 0.2602 8.0000 13.2009 +++ 1394.571630 m 8.0000 321 | 7/9
22 h-m-p 1.6000 8.0000 1.9431 ++ 1394.571630 m 8.0000 333 | 7/9
23 h-m-p 1.6000 8.0000 7.2970 -------C 1394.571630 0 0.0000 352 | 7/9
24 h-m-p 0.9286 8.0000 0.0002 ----------------.. | 8/9
25 h-m-p 0.0160 8.0000 0.0000 -----Y 1394.571630 0 0.0000 397 | 8/9
26 h-m-p 0.0160 8.0000 0.0000 -----Y 1394.571630 0 0.0000 415
Out..
lnL = -1394.571630
416 lfun, 1248 eigenQcodon, 4992 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052356 0.014463 0.047439 0.051533 0.074246 0.086948 133.848837 1.342181 0.561327 0.416355 1.492960
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.146475
np = 11
lnL0 = -1505.050379
Iterating by ming2
Initial: fx= 1505.050379
x= 0.05236 0.01446 0.04744 0.05153 0.07425 0.08695 133.84884 1.34218 0.56133 0.41635 1.49296
1 h-m-p 0.0000 0.0000 801.5059 ++ 1476.971710 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0011 243.6939 ++ 1417.428197 m 0.0011 30 | 2/11
3 h-m-p 0.0000 0.0000 18021.1502 ++ 1412.042600 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 1033.0873 ++ 1410.868873 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0000 9574.5212 ++ 1403.339883 m 0.0000 72 | 5/11
6 h-m-p 0.0003 0.0014 10.7032 ----------.. | 5/11
7 h-m-p 0.0000 0.0000 485.6913 ++ 1397.639992 m 0.0000 108 | 6/11
8 h-m-p 0.0160 8.0000 3.2189 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 347.4515 ++ 1394.571647 m 0.0000 147 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 1394.571647 m 8.0000 164 | 7/11
11 h-m-p 0.0160 8.0000 0.0287 +++++ 1394.571643 m 8.0000 185 | 7/11
12 h-m-p 0.1430 8.0000 1.6065 ++Y 1394.571628 0 2.2878 205 | 7/11
13 h-m-p 1.6000 8.0000 0.0604 -------N 1394.571628 0 0.0000 226 | 7/11
14 h-m-p 1.5386 8.0000 0.0000 ++ 1394.571628 m 8.0000 244 | 7/11
15 h-m-p 0.0160 8.0000 0.0053 +++++ 1394.571628 m 8.0000 265 | 7/11
16 h-m-p 0.0160 8.0000 4.1743 -------------.. | 7/11
17 h-m-p 0.0160 8.0000 0.0000 ----Y 1394.571628 0 0.0000 312 | 7/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 1394.571628 m 8.0000 333 | 7/11
19 h-m-p 0.0131 6.5459 0.1650 ------Y 1394.571628 0 0.0000 357 | 7/11
20 h-m-p 0.0160 8.0000 0.0005 ---------C 1394.571628 0 0.0000 384 | 7/11
21 h-m-p 0.0160 8.0000 0.0000 ----------N 1394.571628 0 0.0000 412
Out..
lnL = -1394.571628
413 lfun, 1652 eigenQcodon, 7434 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1394.579331 S = -1394.565991 -0.005108
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:03
did 20 / 58 patterns 0:03
did 30 / 58 patterns 0:03
did 40 / 58 patterns 0:03
did 50 / 58 patterns 0:03
did 58 / 58 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.015724 0.072206 0.050488 0.075934 0.035901 0.066582 133.852578 0.648634 1.704836
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.239658
np = 9
lnL0 = -1501.687854
Iterating by ming2
Initial: fx= 1501.687854
x= 0.01572 0.07221 0.05049 0.07593 0.03590 0.06658 133.85258 0.64863 1.70484
1 h-m-p 0.0000 0.0000 800.2039 ++ 1471.309760 m 0.0000 14 | 1/9
2 h-m-p 0.0010 0.0198 34.1637 -----------.. | 1/9
3 h-m-p 0.0000 0.0001 742.4836 ++ 1437.579672 m 0.0001 47 | 2/9
4 h-m-p 0.0018 0.0309 21.7267 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 678.6866 ++ 1417.341903 m 0.0000 81 | 3/9
6 h-m-p 0.0023 0.0621 10.9053 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 595.9100 ++ 1400.066392 m 0.0000 115 | 4/9
8 h-m-p 0.0065 0.2165 3.6107 ------------.. | 4/9
9 h-m-p 0.0000 0.0000 494.3106 ++ 1395.947728 m 0.0000 149 | 5/9
10 h-m-p 0.0037 1.8418 1.7322 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 350.9848 ++ 1394.571664 m 0.0000 183 | 6/9
12 h-m-p 0.0182 8.0000 0.0000 +++++ 1394.571664 m 8.0000 198 | 6/9
13 h-m-p 0.4443 8.0000 0.0000 +++ 1394.571664 m 8.0000 214 | 6/9
14 h-m-p 0.0160 8.0000 0.0680 +++++ 1394.571663 m 8.0000 232 | 6/9
15 h-m-p 0.7022 8.0000 0.7743 ++ 1394.571661 m 8.0000 247 | 6/9
16 h-m-p 1.6000 8.0000 0.5285 ++ 1394.571661 m 8.0000 262 | 6/9
17 h-m-p 1.3091 8.0000 3.2297 ++ 1394.571661 m 8.0000 277 | 6/9
18 h-m-p 0.1956 0.9782 71.3798 ++ 1394.571661 m 0.9782 289 | 6/9
19 h-m-p 0.0000 0.0000 9.0665
h-m-p: 0.00000000e+00 0.00000000e+00 9.06651436e+00 1394.571661
.. | 6/9
20 h-m-p 0.0160 8.0000 0.0000 ++Y 1394.571661 0 0.2560 312 | 6/9
21 h-m-p 0.0645 8.0000 0.0000 N 1394.571661 0 0.0645 327
Out..
lnL = -1394.571661
328 lfun, 3608 eigenQcodon, 19680 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039398 0.095957 0.040543 0.051682 0.012408 0.109092 133.976677 0.900000 0.752695 1.066131 1.300061
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.182137
np = 11
lnL0 = -1510.715084
Iterating by ming2
Initial: fx= 1510.715084
x= 0.03940 0.09596 0.04054 0.05168 0.01241 0.10909 133.97668 0.90000 0.75269 1.06613 1.30006
1 h-m-p 0.0000 0.0000 781.1881 ++ 1487.349601 m 0.0000 16 | 1/11
2 h-m-p 0.0002 0.0019 174.5370 ++ 1436.011235 m 0.0019 30 | 2/11
3 h-m-p 0.0000 0.0000 19617.2785 ++ 1434.389252 m 0.0000 44 | 3/11
4 h-m-p 0.0001 0.0004 172.9396 ++ 1432.158203 m 0.0004 58 | 4/11
5 h-m-p 0.0001 0.0004 467.3466 ++ 1401.013994 m 0.0004 72 | 5/11
6 h-m-p 0.0004 0.0019 308.8640 ++ 1394.571628 m 0.0019 86 | 6/11
7 h-m-p 1.6000 8.0000 0.0003 ++ 1394.571628 m 8.0000 100 | 6/11
8 h-m-p 0.0183 7.2943 0.1475 -------------.. | 6/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 1394.571628 m 8.0000 152 | 6/11
10 h-m-p 0.0014 0.7167 0.6069 +++++ 1394.571618 m 0.7167 174 | 7/11
11 h-m-p 0.5418 8.0000 0.3126 ++ 1394.571607 m 8.0000 193 | 7/11
12 h-m-p 1.6000 8.0000 0.8167 ++ 1394.571601 m 8.0000 211 | 7/11
13 h-m-p 1.0095 5.0474 1.4875 +
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
+ 1394.571599 m 5.0474 229
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
14 h-m-p 0.0000 0.0000 0.5262
h-m-p: 2.22028978e-17 1.11014489e-16 5.26184645e-01 1394.571599
..
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01451, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01409, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
15 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
C 1394.571599 0 0.0010 259
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01451, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01409, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
16 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
Y 1394.571599 0 0.0000 284
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1394.571599
285 lfun, 3420 eigenQcodon, 18810 P(t)
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1394.564961 S = -1394.563453 -0.000660
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:14
did 20 / 58 patterns 0:14
did 30 / 58 patterns 0:14
did 40 / 58 patterns 0:14
did 50 / 58 patterns 0:15
did 58 / 58 patterns 0:15
QuantileBeta(0.85, 6.01430, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:15
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2659/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 354
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 4 4 4 4 4 4 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 4 4 4 4 4 4 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 4 4 4 4 4 4 | His CAT 2 2 2 2 2 2 | Arg CGT 5 5 5 5 5 5
CTC 6 6 6 6 6 6 | CCC 8 8 8 8 8 8 | CAC 3 3 3 3 3 3 | CGC 1 1 1 1 1 1
CTA 3 3 3 3 3 3 | CCA 4 4 4 4 4 4 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1
CTG 8 8 8 8 8 8 | CCG 9 9 9 9 9 9 | CAG 9 9 9 9 9 9 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 4 4 4 4 4 4 | Asn AAT 7 7 7 7 7 7 | Ser AGT 4 4 4 4 4 4
ATC 13 13 13 13 13 13 | ACC 11 11 11 11 11 11 | AAC 13 13 13 13 13 13 | AGC 8 8 8 8 8 8
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 2 2 2 2 2 2
Met ATG 7 7 7 7 7 7 | ACG 8 8 8 8 8 8 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 7 7 7 7 7 7 | Ala GCT 10 10 10 10 10 10 | Asp GAT 6 6 6 6 6 6 | Gly GGT 16 16 16 16 16 16
GTC 15 15 15 15 15 15 | GCC 12 12 12 12 12 12 | GAC 9 9 9 9 9 9 | GGC 20 20 20 20 20 20
GTA 6 6 6 6 6 6 | GCA 3 3 3 3 3 3 | Glu GAA 3 3 3 3 3 3 | GGA 7 7 7 7 7 7
GTG 16 16 16 16 16 16 | GCG 16 16 16 16 16 16 | GAG 4 4 4 4 4 4 | GGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909015_1_2844_MLBR_RS13540
position 1: T:0.09887 C:0.20904 A:0.24576 G:0.44633
position 2: T:0.28814 C:0.29944 A:0.18927 G:0.22316
position 3: T:0.21751 C:0.37006 A:0.12712 G:0.28531
Average T:0.20151 C:0.29284 A:0.18738 G:0.31827
#2: NC_002677_1_NP_302696_1_1568_ML2659
position 1: T:0.09887 C:0.20904 A:0.24576 G:0.44633
position 2: T:0.28814 C:0.29944 A:0.18927 G:0.22316
position 3: T:0.21751 C:0.37006 A:0.12712 G:0.28531
Average T:0.20151 C:0.29284 A:0.18738 G:0.31827
#3: NZ_LVXE01000015_1_WP_010909015_1_555_A3216_RS06275
position 1: T:0.09887 C:0.20904 A:0.24576 G:0.44633
position 2: T:0.28814 C:0.29944 A:0.18927 G:0.22316
position 3: T:0.21751 C:0.37006 A:0.12712 G:0.28531
Average T:0.20151 C:0.29284 A:0.18738 G:0.31827
#4: NZ_LYPH01000020_1_WP_010909015_1_752_A8144_RS03565
position 1: T:0.09887 C:0.20904 A:0.24576 G:0.44633
position 2: T:0.28814 C:0.29944 A:0.18927 G:0.22316
position 3: T:0.21751 C:0.37006 A:0.12712 G:0.28531
Average T:0.20151 C:0.29284 A:0.18738 G:0.31827
#5: NZ_CP029543_1_WP_010909015_1_2877_DIJ64_RS14640
position 1: T:0.09887 C:0.20904 A:0.24576 G:0.44633
position 2: T:0.28814 C:0.29944 A:0.18927 G:0.22316
position 3: T:0.21751 C:0.37006 A:0.12712 G:0.28531
Average T:0.20151 C:0.29284 A:0.18738 G:0.31827
#6: NZ_AP014567_1_WP_010909015_1_2945_JK2ML_RS14980
position 1: T:0.09887 C:0.20904 A:0.24576 G:0.44633
position 2: T:0.28814 C:0.29944 A:0.18927 G:0.22316
position 3: T:0.21751 C:0.37006 A:0.12712 G:0.28531
Average T:0.20151 C:0.29284 A:0.18738 G:0.31827
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 18 | Tyr Y TAT 6 | Cys C TGT 0
TTC 24 | TCC 24 | TAC 24 | TGC 0
Leu L TTA 24 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 24 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 24 | His H CAT 12 | Arg R CGT 30
CTC 36 | CCC 48 | CAC 18 | CGC 6
CTA 18 | CCA 24 | Gln Q CAA 18 | CGA 6
CTG 48 | CCG 54 | CAG 54 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 24 | Asn N AAT 42 | Ser S AGT 24
ATC 78 | ACC 66 | AAC 78 | AGC 48
ATA 6 | ACA 12 | Lys K AAA 12 | Arg R AGA 12
Met M ATG 42 | ACG 48 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 42 | Ala A GCT 60 | Asp D GAT 36 | Gly G GGT 96
GTC 90 | GCC 72 | GAC 54 | GGC 120
GTA 36 | GCA 18 | Glu E GAA 18 | GGA 42
GTG 96 | GCG 96 | GAG 24 | GGG 48
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09887 C:0.20904 A:0.24576 G:0.44633
position 2: T:0.28814 C:0.29944 A:0.18927 G:0.22316
position 3: T:0.21751 C:0.37006 A:0.12712 G:0.28531
Average T:0.20151 C:0.29284 A:0.18738 G:0.31827
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1394.571646 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299934 1.300061
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909015_1_2844_MLBR_RS13540: 0.000004, NC_002677_1_NP_302696_1_1568_ML2659: 0.000004, NZ_LVXE01000015_1_WP_010909015_1_555_A3216_RS06275: 0.000004, NZ_LYPH01000020_1_WP_010909015_1_752_A8144_RS03565: 0.000004, NZ_CP029543_1_WP_010909015_1_2877_DIJ64_RS14640: 0.000004, NZ_AP014567_1_WP_010909015_1_2945_JK2ML_RS14980: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29993
omega (dN/dS) = 1.30006
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 766.8 295.2 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 766.8 295.2 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 766.8 295.2 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 766.8 295.2 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 766.8 295.2 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 766.8 295.2 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1394.571630 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 133.848837 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909015_1_2844_MLBR_RS13540: 0.000004, NC_002677_1_NP_302696_1_1568_ML2659: 0.000004, NZ_LVXE01000015_1_WP_010909015_1_555_A3216_RS06275: 0.000004, NZ_LYPH01000020_1_WP_010909015_1_752_A8144_RS03565: 0.000004, NZ_CP029543_1_WP_010909015_1_2877_DIJ64_RS14640: 0.000004, NZ_AP014567_1_WP_010909015_1_2945_JK2ML_RS14980: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 133.84884
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 731.1 330.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 731.1 330.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 731.1 330.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 731.1 330.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 731.1 330.9 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 731.1 330.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1394.571628 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 133.852578 0.011461 0.891223 0.000001 1.960033
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909015_1_2844_MLBR_RS13540: 0.000004, NC_002677_1_NP_302696_1_1568_ML2659: 0.000004, NZ_LVXE01000015_1_WP_010909015_1_555_A3216_RS06275: 0.000004, NZ_LYPH01000020_1_WP_010909015_1_752_A8144_RS03565: 0.000004, NZ_CP029543_1_WP_010909015_1_2877_DIJ64_RS14640: 0.000004, NZ_AP014567_1_WP_010909015_1_2945_JK2ML_RS14980: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 133.85258
MLEs of dN/dS (w) for site classes (K=3)
p: 0.01146 0.89122 0.09732
w: 0.00000 1.00000 1.96003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 731.1 330.9 1.0820 0.0000 0.0000 0.0 0.0
7..2 0.000 731.1 330.9 1.0820 0.0000 0.0000 0.0 0.0
7..3 0.000 731.1 330.9 1.0820 0.0000 0.0000 0.0 0.0
7..4 0.000 731.1 330.9 1.0820 0.0000 0.0000 0.0 0.0
7..5 0.000 731.1 330.9 1.0820 0.0000 0.0000 0.0 0.0
7..6 0.000 731.1 330.9 1.0820 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909015_1_2844_MLBR_RS13540)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909015_1_2844_MLBR_RS13540)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1394.571661 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 133.976677 44.270498 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909015_1_2844_MLBR_RS13540: 0.000004, NC_002677_1_NP_302696_1_1568_ML2659: 0.000004, NZ_LVXE01000015_1_WP_010909015_1_555_A3216_RS06275: 0.000004, NZ_LYPH01000020_1_WP_010909015_1_752_A8144_RS03565: 0.000004, NZ_CP029543_1_WP_010909015_1_2877_DIJ64_RS14640: 0.000004, NZ_AP014567_1_WP_010909015_1_2945_JK2ML_RS14980: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 133.97668
Parameters in M7 (beta):
p = 44.27050 q = 99.00000
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.24725 0.26910 0.28248 0.29336 0.30327 0.31298 0.32313 0.33456 0.34904 0.37379
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 731.1 330.9 0.3089 0.0000 0.0000 0.0 0.0
7..2 0.000 731.1 330.9 0.3089 0.0000 0.0000 0.0 0.0
7..3 0.000 731.1 330.9 0.3089 0.0000 0.0000 0.0 0.0
7..4 0.000 731.1 330.9 0.3089 0.0000 0.0000 0.0 0.0
7..5 0.000 731.1 330.9 0.3089 0.0000 0.0000 0.0 0.0
7..6 0.000 731.1 330.9 0.3089 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1394.571599 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 133.980080 0.000010 6.014301 0.005000 17.334538
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909015_1_2844_MLBR_RS13540: 0.000004, NC_002677_1_NP_302696_1_1568_ML2659: 0.000004, NZ_LVXE01000015_1_WP_010909015_1_555_A3216_RS06275: 0.000004, NZ_LYPH01000020_1_WP_010909015_1_752_A8144_RS03565: 0.000004, NZ_CP029543_1_WP_010909015_1_2877_DIJ64_RS14640: 0.000004, NZ_AP014567_1_WP_010909015_1_2945_JK2ML_RS14980: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 133.98008
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 6.01430 q = 0.00500
(p1 = 0.99999) w = 17.33454
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 17.33454
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 731.1 330.9 17.3344 0.0000 0.0000 0.0 0.0
7..2 0.000 731.1 330.9 17.3344 0.0000 0.0000 0.0 0.0
7..3 0.000 731.1 330.9 17.3344 0.0000 0.0000 0.0 0.0
7..4 0.000 731.1 330.9 17.3344 0.0000 0.0000 0.0 0.0
7..5 0.000 731.1 330.9 17.3344 0.0000 0.0000 0.0 0.0
7..6 0.000 731.1 330.9 17.3344 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909015_1_2844_MLBR_RS13540)
Pr(w>1) post mean +- SE for w
1 M 1.000** 17.334
2 S 1.000** 17.334
3 R 1.000** 17.334
4 Q 1.000** 17.334
5 P 1.000** 17.334
6 H 1.000** 17.334
7 R 1.000** 17.334
8 S 1.000** 17.334
9 L 1.000** 17.334
10 W 1.000** 17.334
11 R 1.000** 17.334
12 S 1.000** 17.334
13 W 1.000** 17.334
14 L 1.000** 17.334
15 V 1.000** 17.334
16 S 1.000** 17.334
17 T 1.000** 17.334
18 L 1.000** 17.334
19 A 1.000** 17.334
20 A 1.000** 17.334
21 L 1.000** 17.334
22 G 1.000** 17.334
23 L 1.000** 17.334
24 S 1.000** 17.334
25 L 1.000** 17.334
26 A 1.000** 17.334
27 V 1.000** 17.334
28 V 1.000** 17.334
29 P 1.000** 17.334
30 G 1.000** 17.334
31 S 1.000** 17.334
32 A 1.000** 17.334
33 T 1.000** 17.334
34 P 1.000** 17.334
35 S 1.000** 17.334
36 G 1.000** 17.334
37 P 1.000** 17.334
38 S 1.000** 17.334
39 T 1.000** 17.334
40 L 1.000** 17.334
41 A 1.000** 17.334
42 L 1.000** 17.334
43 D 1.000** 17.334
44 R 1.000** 17.334
45 F 1.000** 17.334
46 S 1.000** 17.334
47 N 1.000** 17.334
48 R 1.000** 17.334
49 P 1.000** 17.334
50 P 1.000** 17.334
51 L 1.000** 17.334
52 P 1.000** 17.334
53 L 1.000** 17.334
54 N 1.000** 17.334
55 P 1.000** 17.334
56 A 1.000** 17.334
57 A 1.000** 17.334
58 M 1.000** 17.334
59 V 1.000** 17.334
60 A 1.000** 17.334
61 P 1.000** 17.334
62 Q 1.000** 17.334
63 V 1.000** 17.334
64 V 1.000** 17.334
65 N 1.000** 17.334
66 I 1.000** 17.334
67 S 1.000** 17.334
68 T 1.000** 17.334
69 R 1.000** 17.334
70 L 1.000** 17.334
71 G 1.000** 17.334
72 Y 1.000** 17.334
73 N 1.000** 17.334
74 S 1.000** 17.334
75 A 1.000** 17.334
76 V 1.000** 17.334
77 G 1.000** 17.334
78 A 1.000** 17.334
79 G 1.000** 17.334
80 T 1.000** 17.334
81 G 1.000** 17.334
82 I 1.000** 17.334
83 V 1.000** 17.334
84 I 1.000** 17.334
85 D 1.000** 17.334
86 S 1.000** 17.334
87 S 1.000** 17.334
88 G 1.000** 17.334
89 V 1.000** 17.334
90 V 1.000** 17.334
91 L 1.000** 17.334
92 T 1.000** 17.334
93 N 1.000** 17.334
94 N 1.000** 17.334
95 H 1.000** 17.334
96 V 1.000** 17.334
97 I 1.000** 17.334
98 S 1.000** 17.334
99 G 1.000** 17.334
100 A 1.000** 17.334
101 T 1.000** 17.334
102 D 1.000** 17.334
103 I 1.000** 17.334
104 S 1.000** 17.334
105 A 1.000** 17.334
106 F 1.000** 17.334
107 D 1.000** 17.334
108 V 1.000** 17.334
109 G 1.000** 17.334
110 N 1.000** 17.334
111 G 1.000** 17.334
112 K 1.000** 17.334
113 T 1.000** 17.334
114 Y 1.000** 17.334
115 G 1.000** 17.334
116 V 1.000** 17.334
117 D 1.000** 17.334
118 V 1.000** 17.334
119 V 1.000** 17.334
120 G 1.000** 17.334
121 Y 1.000** 17.334
122 D 1.000** 17.334
123 R 1.000** 17.334
124 T 1.000** 17.334
125 Q 1.000** 17.334
126 D 1.000** 17.334
127 V 1.000** 17.334
128 A 1.000** 17.334
129 V 1.000** 17.334
130 L 1.000** 17.334
131 Q 1.000** 17.334
132 L 1.000** 17.334
133 R 1.000** 17.334
134 G 1.000** 17.334
135 A 1.000** 17.334
136 S 1.000** 17.334
137 N 1.000** 17.334
138 L 1.000** 17.334
139 P 1.000** 17.334
140 T 1.000** 17.334
141 A 1.000** 17.334
142 V 1.000** 17.334
143 I 1.000** 17.334
144 G 1.000** 17.334
145 G 1.000** 17.334
146 D 1.000** 17.334
147 V 1.000** 17.334
148 A 1.000** 17.334
149 I 1.000** 17.334
150 G 1.000** 17.334
151 E 1.000** 17.334
152 P 1.000** 17.334
153 I 1.000** 17.334
154 V 1.000** 17.334
155 A 1.000** 17.334
156 L 1.000** 17.334
157 G 1.000** 17.334
158 N 1.000** 17.334
159 T 1.000** 17.334
160 G 1.000** 17.334
161 G 1.000** 17.334
162 Q 1.000** 17.334
163 G 1.000** 17.334
164 G 1.000** 17.334
165 L 1.000** 17.334
166 P 1.000** 17.334
167 S 1.000** 17.334
168 V 1.000** 17.334
169 L 1.000** 17.334
170 P 1.000** 17.334
171 G 1.000** 17.334
172 R 1.000** 17.334
173 V 1.000** 17.334
174 V 1.000** 17.334
175 A 1.000** 17.334
176 L 1.000** 17.334
177 N 1.000** 17.334
178 Q 1.000** 17.334
179 T 1.000** 17.334
180 V 1.000** 17.334
181 Q 1.000** 17.334
182 A 1.000** 17.334
183 S 1.000** 17.334
184 E 1.000** 17.334
185 P 1.000** 17.334
186 L 1.000** 17.334
187 T 1.000** 17.334
188 G 1.000** 17.334
189 A 1.000** 17.334
190 Q 1.000** 17.334
191 E 1.000** 17.334
192 T 1.000** 17.334
193 L 1.000** 17.334
194 S 1.000** 17.334
195 G 1.000** 17.334
196 L 1.000** 17.334
197 I 1.000** 17.334
198 Q 1.000** 17.334
199 V 1.000** 17.334
200 D 1.000** 17.334
201 A 1.000** 17.334
202 P 1.000** 17.334
203 I 1.000** 17.334
204 K 1.000** 17.334
205 P 1.000** 17.334
206 G 1.000** 17.334
207 D 1.000** 17.334
208 S 1.000** 17.334
209 G 1.000** 17.334
210 G 1.000** 17.334
211 P 1.000** 17.334
212 V 1.000** 17.334
213 V 1.000** 17.334
214 N 1.000** 17.334
215 S 1.000** 17.334
216 R 1.000** 17.334
217 G 1.000** 17.334
218 Q 1.000** 17.334
219 V 1.000** 17.334
220 V 1.000** 17.334
221 G 1.000** 17.334
222 M 1.000** 17.334
223 N 1.000** 17.334
224 T 1.000** 17.334
225 A 1.000** 17.334
226 A 1.000** 17.334
227 T 1.000** 17.334
228 D 1.000** 17.334
229 N 1.000** 17.334
230 Y 1.000** 17.334
231 K 1.000** 17.334
232 M 1.000** 17.334
233 L 1.000** 17.334
234 G 1.000** 17.334
235 G 1.000** 17.334
236 Q 1.000** 17.334
237 G 1.000** 17.334
238 F 1.000** 17.334
239 A 1.000** 17.334
240 I 1.000** 17.334
241 P 1.000** 17.334
242 I 1.000** 17.334
243 G 1.000** 17.334
244 Q 1.000** 17.334
245 A 1.000** 17.334
246 M 1.000** 17.334
247 E 1.000** 17.334
248 V 1.000** 17.334
249 V 1.000** 17.334
250 G 1.000** 17.334
251 A 1.000** 17.334
252 I 1.000** 17.334
253 R 1.000** 17.334
254 S 1.000** 17.334
255 G 1.000** 17.334
256 A 1.000** 17.334
257 G 1.000** 17.334
258 S 1.000** 17.334
259 N 1.000** 17.334
260 T 1.000** 17.334
261 V 1.000** 17.334
262 H 1.000** 17.334
263 I 1.000** 17.334
264 G 1.000** 17.334
265 P 1.000** 17.334
266 T 1.000** 17.334
267 A 1.000** 17.334
268 F 1.000** 17.334
269 F 1.000** 17.334
270 G 1.000** 17.334
271 L 1.000** 17.334
272 G 1.000** 17.334
273 V 1.000** 17.334
274 L 1.000** 17.334
275 D 1.000** 17.334
276 N 1.000** 17.334
277 N 1.000** 17.334
278 G 1.000** 17.334
279 N 1.000** 17.334
280 G 1.000** 17.334
281 A 1.000** 17.334
282 R 1.000** 17.334
283 V 1.000** 17.334
284 A 1.000** 17.334
285 R 1.000** 17.334
286 V 1.000** 17.334
287 V 1.000** 17.334
288 A 1.000** 17.334
289 T 1.000** 17.334
290 G 1.000** 17.334
291 P 1.000** 17.334
292 A 1.000** 17.334
293 A 1.000** 17.334
294 M 1.000** 17.334
295 A 1.000** 17.334
296 G 1.000** 17.334
297 I 1.000** 17.334
298 S 1.000** 17.334
299 V 1.000** 17.334
300 G 1.000** 17.334
301 D 1.000** 17.334
302 I 1.000** 17.334
303 I 1.000** 17.334
304 T 1.000** 17.334
305 S 1.000** 17.334
306 V 1.000** 17.334
307 D 1.000** 17.334
308 G 1.000** 17.334
309 V 1.000** 17.334
310 P 1.000** 17.334
311 I 1.000** 17.334
312 S 1.000** 17.334
313 E 1.000** 17.334
314 A 1.000** 17.334
315 T 1.000** 17.334
316 A 1.000** 17.334
317 M 1.000** 17.334
318 T 1.000** 17.334
319 N 1.000** 17.334
320 V 1.000** 17.334
321 L 1.000** 17.334
322 V 1.000** 17.334
323 P 1.000** 17.334
324 H 1.000** 17.334
325 H 1.000** 17.334
326 P 1.000** 17.334
327 G 1.000** 17.334
328 E 1.000** 17.334
329 T 1.000** 17.334
330 V 1.000** 17.334
331 A 1.000** 17.334
332 V 1.000** 17.334
333 N 1.000** 17.334
334 Y 1.000** 17.334
335 R 1.000** 17.334
336 S 1.000** 17.334
337 A 1.000** 17.334
338 G 1.000** 17.334
339 G 1.000** 17.334
340 G 1.000** 17.334
341 D 1.000** 17.334
342 L 1.000** 17.334
343 T 1.000** 17.334
344 A 1.000** 17.334
345 N 1.000** 17.334
346 V 1.000** 17.334
347 T 1.000** 17.334
348 L 1.000** 17.334
349 A 1.000** 17.334
350 E 1.000** 17.334
351 G 1.000** 17.334
352 P 1.000** 17.334
353 P 1.000** 17.334
354 A 1.000** 17.334
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909015_1_2844_MLBR_RS13540)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:15