--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 12:27:44 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ML2691/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -738.55 -741.99
2 -738.45 -743.25
--------------------------------------
TOTAL -738.49 -742.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.699620 0.070222 0.218391 1.209717 0.662556 1405.43 1453.22 1.000
r(A<->C){all} 0.167493 0.020951 0.000424 0.462585 0.124939 190.69 228.26 1.003
r(A<->G){all} 0.163548 0.019990 0.000054 0.462380 0.122722 167.59 189.47 1.001
r(A<->T){all} 0.168043 0.020112 0.000135 0.458560 0.130684 189.76 257.06 1.000
r(C<->G){all} 0.177677 0.021336 0.000038 0.467690 0.144266 163.54 257.34 1.000
r(C<->T){all} 0.164997 0.020843 0.000072 0.457211 0.120740 172.70 212.10 1.002
r(G<->T){all} 0.158243 0.018373 0.000009 0.427983 0.122321 279.50 300.89 1.000
pi(A){all} 0.212969 0.000309 0.180432 0.248976 0.212752 1142.23 1261.24 1.000
pi(C){all} 0.307320 0.000396 0.268487 0.344905 0.307275 1235.89 1316.62 1.002
pi(G){all} 0.293507 0.000401 0.255125 0.333940 0.293696 1180.96 1307.25 1.000
pi(T){all} 0.186204 0.000277 0.154793 0.218666 0.185417 1234.84 1367.92 1.002
alpha{1,2} 0.422802 0.240335 0.000231 1.392820 0.252505 1322.11 1347.68 1.000
alpha{3} 0.456241 0.235051 0.000220 1.392285 0.305538 1109.92 1141.21 1.000
pinvar{all} 0.996958 0.000013 0.990220 1.000000 0.998158 1152.70 1326.85 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -720.494723
Model 2: PositiveSelection -720.494728
Model 0: one-ratio -720.494733
Model 7: beta -720.494709
Model 8: beta&w>1 -720.494692
Model 0 vs 1 1.9999999949504854E-5
Model 2 vs 1 9.999999974752427E-6
Model 8 vs 7 3.399999991415825E-5
>C1
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C2
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C3
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C4
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C5
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=180
C1 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C2 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C3 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C4 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C5 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
**************************************************
C1 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C2 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C3 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C4 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C5 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
**************************************************
C1 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C2 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C3 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C4 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C5 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
**************************************************
C1 LGLESSEREVKWLNELIAAERALLGRVEQT
C2 LGLESSEREVKWLNELIAAERALLGRVEQT
C3 LGLESSEREVKWLNELIAAERALLGRVEQT
C4 LGLESSEREVKWLNELIAAERALLGRVEQT
C5 LGLESSEREVKWLNELIAAERALLGRVEQT
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3600]--->[3600]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.422 Mb, Max= 30.641 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C2 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C3 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C4 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C5 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
**************************************************
C1 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C2 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C3 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C4 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C5 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
**************************************************
C1 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C2 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C3 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C4 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C5 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
**************************************************
C1 LGLESSEREVKWLNELIAAERALLGRVEQT
C2 LGLESSEREVKWLNELIAAERALLGRVEQT
C3 LGLESSEREVKWLNELIAAERALLGRVEQT
C4 LGLESSEREVKWLNELIAAERALLGRVEQT
C5 LGLESSEREVKWLNELIAAERALLGRVEQT
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
C2 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
C3 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
C4 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
C5 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
**************************************************
C1 CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
C2 CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
C3 CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
C4 CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
C5 CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
**************************************************
C1 TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
C2 TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
C3 TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
C4 TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
C5 TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
**************************************************
C1 CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
C2 CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
C3 CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
C4 CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
C5 CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
**************************************************
C1 GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
C2 GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
C3 GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
C4 GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
C5 GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
**************************************************
C1 TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
C2 TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
C3 TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
C4 TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
C5 TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
**************************************************
C1 TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
C2 TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
C3 TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
C4 TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
C5 TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
**************************************************
C1 AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
C2 AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
C3 AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
C4 AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
C5 AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
**************************************************
C1 TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
C2 TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
C3 TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
C4 TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
C5 TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
**************************************************
C1 CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
C2 CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
C3 CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
C4 CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
C5 CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
**************************************************
C1 TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
C2 TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
C3 TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
C4 TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
C5 TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
****************************************
>C1
ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>C2
ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>C3
ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>C4
ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>C5
ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>C1
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C2
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C3
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C4
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C5
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 540 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579782398
Setting output file names to "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1391755667
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9382846395
Seed = 1782651824
Swapseed = 1579782398
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1109.159193 -- -25.624409
Chain 2 -- -1109.159239 -- -25.624409
Chain 3 -- -1109.159193 -- -25.624409
Chain 4 -- -1109.159193 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1109.159193 -- -25.624409
Chain 2 -- -1109.159193 -- -25.624409
Chain 3 -- -1109.159193 -- -25.624409
Chain 4 -- -1109.159193 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1109.159] (-1109.159) (-1109.159) (-1109.159) * [-1109.159] (-1109.159) (-1109.159) (-1109.159)
500 -- (-757.947) (-747.126) [-753.882] (-749.760) * (-745.845) (-753.232) (-745.888) [-753.763] -- 0:00:00
1000 -- (-742.901) (-748.838) (-751.482) [-745.861] * (-746.094) (-760.934) [-744.873] (-750.684) -- 0:00:00
1500 -- (-741.724) [-745.744] (-743.054) (-750.457) * (-745.786) (-749.924) [-743.716] (-742.789) -- 0:00:00
2000 -- [-744.969] (-748.996) (-746.633) (-745.817) * (-743.073) (-746.471) [-747.255] (-745.093) -- 0:00:00
2500 -- (-742.766) [-744.644] (-743.811) (-741.632) * (-743.851) (-743.842) (-746.311) [-741.577] -- 0:00:00
3000 -- [-746.423] (-748.278) (-743.666) (-748.489) * [-744.191] (-749.319) (-747.352) (-746.051) -- 0:00:00
3500 -- (-751.951) (-741.964) [-747.402] (-747.108) * [-746.963] (-743.933) (-747.451) (-743.555) -- 0:00:00
4000 -- (-746.791) (-745.467) (-745.315) [-749.949] * [-744.555] (-752.752) (-747.472) (-745.440) -- 0:00:00
4500 -- [-744.388] (-744.097) (-745.163) (-747.936) * [-743.399] (-747.571) (-741.173) (-739.134) -- 0:00:00
5000 -- [-748.120] (-740.181) (-746.953) (-743.495) * (-747.126) [-740.699] (-746.788) (-748.097) -- 0:00:00
Average standard deviation of split frequencies: 0.137493
5500 -- (-746.461) (-742.851) (-746.743) [-748.800] * (-746.927) (-749.415) (-741.730) [-745.169] -- 0:00:00
6000 -- (-753.034) (-745.891) (-743.806) [-740.975] * (-748.415) [-744.235] (-750.330) (-747.285) -- 0:00:00
6500 -- (-745.293) (-749.899) (-746.657) [-745.145] * (-751.319) [-743.116] (-747.637) (-746.171) -- 0:02:32
7000 -- (-744.839) [-753.400] (-747.202) (-745.703) * (-746.280) (-743.311) (-750.055) [-740.708] -- 0:02:21
7500 -- (-748.972) [-758.186] (-747.618) (-752.105) * (-742.740) (-751.539) (-745.586) [-743.364] -- 0:02:12
8000 -- [-743.130] (-747.397) (-741.504) (-746.583) * (-747.336) (-745.341) (-741.100) [-746.186] -- 0:02:04
8500 -- (-747.200) [-748.549] (-742.513) (-751.492) * (-747.775) (-749.757) (-741.164) [-739.451] -- 0:01:56
9000 -- [-741.511] (-744.907) (-742.297) (-745.440) * (-744.980) [-746.335] (-744.766) (-744.801) -- 0:01:50
9500 -- (-748.884) [-745.040] (-740.305) (-747.995) * (-744.285) (-755.596) [-745.052] (-746.134) -- 0:01:44
10000 -- (-744.215) [-745.222] (-752.276) (-744.310) * (-741.664) (-743.667) (-749.961) [-750.957] -- 0:01:39
Average standard deviation of split frequencies: 0.035355
10500 -- [-751.566] (-751.827) (-741.785) (-747.719) * [-746.199] (-744.793) (-740.839) (-746.800) -- 0:01:34
11000 -- (-748.371) [-747.190] (-744.030) (-749.590) * [-742.834] (-741.719) (-751.135) (-744.677) -- 0:01:29
11500 -- [-746.061] (-746.414) (-742.015) (-751.247) * (-748.379) [-745.104] (-749.753) (-745.509) -- 0:01:25
12000 -- (-750.541) (-741.343) (-747.973) [-751.927] * (-749.957) (-745.267) (-741.064) [-743.247] -- 0:01:22
12500 -- [-746.127] (-749.248) (-746.225) (-742.100) * [-744.802] (-742.091) (-749.048) (-749.913) -- 0:01:19
13000 -- (-737.758) (-745.789) [-742.035] (-744.206) * (-740.669) (-747.785) (-750.541) [-743.906] -- 0:01:15
13500 -- (-742.236) (-747.274) [-746.719] (-747.326) * (-750.495) (-748.386) [-744.358] (-746.092) -- 0:01:13
14000 -- (-743.940) (-745.284) (-758.739) [-742.613] * (-745.477) [-742.233] (-747.883) (-745.194) -- 0:01:10
14500 -- (-741.528) (-742.389) (-741.560) [-742.655] * (-746.496) (-743.401) (-745.126) [-744.762] -- 0:01:07
15000 -- [-737.312] (-749.818) (-751.300) (-747.858) * (-745.754) (-746.007) [-748.597] (-745.906) -- 0:01:05
Average standard deviation of split frequencies: 0.041248
15500 -- (-739.243) (-747.198) (-748.623) [-743.169] * (-741.908) (-748.411) [-744.609] (-756.865) -- 0:01:03
16000 -- (-740.294) (-744.687) [-739.461] (-743.942) * (-755.781) [-742.671] (-743.171) (-746.578) -- 0:01:01
16500 -- [-739.912] (-751.910) (-750.559) (-744.149) * [-747.949] (-757.571) (-744.110) (-749.484) -- 0:00:59
17000 -- (-739.873) (-744.946) (-745.362) [-746.071] * (-740.080) [-749.785] (-747.884) (-752.617) -- 0:00:57
17500 -- (-738.501) (-742.815) [-741.942] (-747.261) * [-750.145] (-746.496) (-749.278) (-748.048) -- 0:00:56
18000 -- [-738.497] (-741.989) (-741.463) (-752.617) * (-752.425) (-742.232) (-747.429) [-746.284] -- 0:00:54
18500 -- [-738.681] (-747.280) (-747.143) (-747.805) * (-753.784) (-739.863) (-750.046) [-739.580] -- 0:00:53
19000 -- [-738.626] (-754.664) (-744.722) (-746.283) * (-744.583) (-751.149) [-740.158] (-755.385) -- 0:00:51
19500 -- (-739.292) (-745.687) [-742.550] (-753.010) * (-749.497) [-743.115] (-746.294) (-743.601) -- 0:00:50
20000 -- [-739.042] (-748.414) (-746.820) (-750.941) * (-745.204) (-749.727) [-747.919] (-742.421) -- 0:00:49
Average standard deviation of split frequencies: 0.036496
20500 -- (-738.717) (-748.766) (-746.180) [-746.395] * (-745.075) [-742.592] (-750.446) (-745.955) -- 0:00:47
21000 -- (-737.132) (-746.067) [-744.088] (-751.278) * (-751.676) [-746.933] (-744.509) (-754.256) -- 0:00:46
21500 -- (-738.072) [-745.786] (-747.307) (-744.614) * [-744.808] (-743.418) (-749.817) (-749.962) -- 0:00:45
22000 -- (-738.874) (-743.085) [-743.538] (-753.929) * (-744.206) (-746.501) (-746.553) [-745.321] -- 0:00:44
22500 -- (-737.050) (-745.378) [-747.632] (-744.456) * (-747.619) (-748.967) [-743.468] (-748.217) -- 0:00:43
23000 -- [-738.250] (-747.695) (-741.612) (-749.735) * (-743.839) (-746.725) [-743.409] (-740.873) -- 0:00:42
23500 -- [-740.052] (-753.290) (-744.946) (-748.421) * [-745.617] (-743.989) (-750.657) (-745.994) -- 0:01:23
24000 -- (-740.991) (-743.389) (-747.333) [-745.612] * (-743.600) (-749.251) (-750.146) [-749.999] -- 0:01:21
24500 -- [-738.973] (-743.286) (-745.253) (-747.552) * (-741.454) [-745.398] (-747.259) (-747.188) -- 0:01:19
25000 -- [-737.765] (-748.146) (-745.068) (-750.693) * (-737.892) (-742.257) (-745.618) [-743.852] -- 0:01:18
Average standard deviation of split frequencies: 0.032636
25500 -- (-742.242) (-745.425) (-746.618) [-742.700] * (-737.969) [-742.942] (-746.718) (-742.602) -- 0:01:16
26000 -- (-738.107) (-743.190) [-742.738] (-739.626) * [-741.106] (-745.294) (-744.920) (-751.602) -- 0:01:14
26500 -- (-737.292) (-747.399) [-749.192] (-738.899) * (-740.033) (-745.580) (-745.593) [-744.589] -- 0:01:13
27000 -- (-741.369) [-740.715] (-747.453) (-739.177) * (-741.851) [-744.495] (-742.317) (-743.574) -- 0:01:12
27500 -- (-740.162) [-741.869] (-743.128) (-740.785) * (-739.697) (-742.783) [-746.642] (-745.177) -- 0:01:10
28000 -- (-740.903) (-747.128) (-741.428) [-741.156] * [-741.361] (-741.112) (-743.791) (-745.118) -- 0:01:09
28500 -- (-738.855) (-743.520) [-739.792] (-742.861) * (-738.110) (-758.361) (-743.710) [-739.791] -- 0:01:08
29000 -- [-738.464] (-740.105) (-739.674) (-738.740) * (-744.122) [-748.132] (-746.536) (-746.237) -- 0:01:06
29500 -- (-738.758) (-738.298) [-739.984] (-738.762) * [-741.686] (-750.173) (-748.864) (-747.010) -- 0:01:05
30000 -- (-742.047) [-738.377] (-739.209) (-737.330) * (-739.967) (-749.237) [-742.727] (-754.196) -- 0:01:04
Average standard deviation of split frequencies: 0.052264
30500 -- (-738.489) (-738.579) [-741.218] (-741.777) * [-737.201] (-748.577) (-744.824) (-749.164) -- 0:01:03
31000 -- [-739.019] (-737.536) (-739.539) (-743.730) * (-738.308) (-747.326) [-743.554] (-740.684) -- 0:01:02
31500 -- (-740.409) (-739.302) (-739.425) [-740.683] * [-738.610] (-752.841) (-740.322) (-737.979) -- 0:01:01
32000 -- (-739.085) [-738.111] (-739.630) (-741.728) * (-738.519) (-744.452) (-739.202) [-739.048] -- 0:01:00
32500 -- (-739.015) (-740.861) (-741.511) [-741.938] * (-737.818) (-742.946) [-739.075] (-739.516) -- 0:00:59
33000 -- [-738.745] (-741.128) (-739.012) (-743.049) * [-737.975] (-745.879) (-737.268) (-737.195) -- 0:00:58
33500 -- (-740.713) (-739.244) [-737.402] (-747.953) * (-737.623) (-747.352) (-740.100) [-740.645] -- 0:00:57
34000 -- (-737.723) [-738.380] (-737.806) (-749.522) * (-740.154) (-753.470) [-739.076] (-743.932) -- 0:00:56
34500 -- (-737.770) (-738.349) (-737.676) [-738.197] * (-739.994) (-748.613) (-739.856) [-738.682] -- 0:00:55
35000 -- (-739.566) (-743.398) (-741.878) [-740.572] * (-738.009) [-748.080] (-738.072) (-741.780) -- 0:00:55
Average standard deviation of split frequencies: 0.039284
35500 -- (-738.239) (-742.312) [-741.559] (-739.881) * [-737.372] (-748.198) (-737.250) (-741.224) -- 0:00:54
36000 -- (-741.167) (-743.673) (-743.314) [-738.537] * (-737.232) (-745.182) (-741.669) [-738.720] -- 0:00:53
36500 -- [-738.121] (-738.973) (-739.497) (-743.459) * (-738.415) [-743.135] (-741.799) (-738.564) -- 0:00:52
37000 -- (-738.078) (-740.135) [-738.161] (-741.258) * (-738.455) [-743.757] (-738.745) (-746.179) -- 0:00:52
37500 -- (-738.210) (-739.367) (-737.537) [-740.202] * (-739.497) [-743.154] (-738.123) (-741.520) -- 0:00:51
38000 -- (-741.368) (-739.053) (-737.436) [-740.092] * (-739.155) (-750.610) [-738.951] (-739.037) -- 0:00:50
38500 -- (-739.464) (-739.614) [-739.495] (-741.245) * (-738.109) (-754.392) (-740.892) [-740.381] -- 0:00:49
39000 -- (-741.599) (-737.510) [-737.948] (-740.332) * [-739.645] (-746.740) (-738.049) (-741.311) -- 0:00:49
39500 -- (-742.010) [-739.196] (-739.127) (-737.811) * [-736.988] (-746.170) (-739.672) (-738.305) -- 0:00:48
40000 -- (-744.439) [-738.134] (-738.373) (-738.740) * (-739.159) (-746.889) [-739.171] (-738.323) -- 0:00:48
Average standard deviation of split frequencies: 0.051004
40500 -- (-743.021) [-739.893] (-740.603) (-739.273) * [-739.605] (-746.468) (-738.011) (-740.601) -- 0:00:47
41000 -- (-737.368) (-740.581) [-742.518] (-738.180) * (-741.550) (-744.660) (-739.050) [-739.227] -- 0:01:10
41500 -- (-737.492) (-738.197) [-745.074] (-738.046) * (-742.300) (-745.309) (-739.072) [-737.878] -- 0:01:09
42000 -- (-740.416) (-738.480) [-742.592] (-739.506) * (-740.064) [-749.081] (-739.352) (-737.506) -- 0:01:08
42500 -- (-738.307) [-739.528] (-745.219) (-739.293) * (-742.067) [-744.824] (-740.600) (-739.462) -- 0:01:07
43000 -- (-743.399) (-741.667) (-743.735) [-737.894] * (-739.664) [-743.381] (-743.124) (-739.749) -- 0:01:06
43500 -- (-742.118) (-741.331) [-745.248] (-738.186) * (-738.769) (-742.067) [-741.753] (-740.044) -- 0:01:05
44000 -- (-739.741) [-740.234] (-738.591) (-740.683) * (-737.507) (-745.281) (-740.497) [-738.317] -- 0:01:05
44500 -- (-741.126) (-738.327) [-740.899] (-739.136) * [-739.683] (-749.271) (-737.005) (-739.830) -- 0:01:04
45000 -- (-741.003) (-738.510) [-738.967] (-739.897) * (-738.247) (-746.356) (-737.292) [-738.083] -- 0:01:03
Average standard deviation of split frequencies: 0.047140
45500 -- (-745.234) (-741.855) (-738.678) [-741.169] * (-739.346) [-744.922] (-738.618) (-738.109) -- 0:01:02
46000 -- (-737.363) (-740.379) [-740.150] (-744.668) * (-741.578) (-748.304) (-739.768) [-737.522] -- 0:01:02
46500 -- (-738.034) [-739.942] (-742.331) (-738.639) * (-740.607) (-744.956) [-737.290] (-740.326) -- 0:01:01
47000 -- (-740.296) (-741.548) [-737.882] (-738.691) * (-738.201) (-742.758) [-738.582] (-737.923) -- 0:01:00
47500 -- (-739.356) (-741.847) [-741.266] (-739.068) * [-737.774] (-745.242) (-738.016) (-740.621) -- 0:01:00
48000 -- [-741.727] (-739.778) (-738.799) (-742.825) * (-738.390) (-744.439) (-739.682) [-738.869] -- 0:00:59
48500 -- (-742.063) (-739.518) (-740.195) [-741.903] * [-738.058] (-749.258) (-737.923) (-738.369) -- 0:00:58
49000 -- (-738.887) [-738.437] (-739.275) (-740.018) * (-739.834) [-743.496] (-737.663) (-738.052) -- 0:00:58
49500 -- [-738.904] (-737.517) (-738.662) (-739.124) * (-738.354) (-744.973) [-737.696] (-738.347) -- 0:00:57
50000 -- (-740.239) [-738.768] (-741.214) (-739.377) * (-737.854) (-747.730) (-737.263) [-737.663] -- 0:00:57
Average standard deviation of split frequencies: 0.040938
50500 -- (-737.963) (-737.732) [-739.497] (-739.003) * (-739.207) [-743.796] (-741.268) (-738.808) -- 0:00:56
51000 -- (-737.704) [-738.439] (-739.718) (-738.899) * (-739.797) (-745.272) [-741.117] (-738.519) -- 0:00:55
51500 -- (-739.656) (-740.593) [-738.850] (-739.153) * (-740.576) (-746.803) (-738.524) [-738.822] -- 0:00:55
52000 -- (-739.265) [-741.045] (-737.667) (-737.817) * (-739.794) (-743.513) (-737.539) [-740.373] -- 0:00:54
52500 -- (-738.342) (-740.851) [-741.470] (-737.318) * (-737.659) (-744.667) [-738.616] (-740.591) -- 0:00:54
53000 -- (-738.088) [-742.261] (-740.435) (-742.708) * [-737.464] (-751.510) (-740.997) (-738.977) -- 0:00:53
53500 -- (-737.434) [-741.499] (-739.660) (-738.513) * (-741.952) [-747.050] (-737.773) (-738.637) -- 0:00:53
54000 -- (-737.858) (-740.782) (-739.230) [-738.978] * (-737.174) (-740.039) [-739.195] (-737.855) -- 0:00:52
54500 -- (-738.473) (-738.966) [-738.393] (-737.674) * (-737.344) [-744.846] (-746.781) (-740.213) -- 0:00:52
55000 -- (-739.001) [-739.178] (-738.946) (-737.064) * (-737.518) (-742.559) [-741.742] (-740.610) -- 0:00:51
Average standard deviation of split frequencies: 0.045457
55500 -- [-740.049] (-742.620) (-739.143) (-737.488) * [-738.303] (-745.747) (-740.031) (-738.622) -- 0:00:51
56000 -- (-740.966) [-739.823] (-738.565) (-738.751) * (-740.849) (-741.450) [-737.299] (-737.113) -- 0:00:50
56500 -- (-738.471) [-737.135] (-739.039) (-741.104) * (-740.721) [-747.053] (-738.074) (-738.623) -- 0:00:50
57000 -- [-740.117] (-741.686) (-739.396) (-739.390) * (-740.692) (-743.977) (-741.183) [-738.665] -- 0:00:49
57500 -- (-739.138) (-737.715) [-739.260] (-737.709) * (-739.629) [-747.963] (-747.638) (-738.343) -- 0:00:49
58000 -- [-740.229] (-739.405) (-744.736) (-739.262) * (-739.100) (-745.974) [-740.582] (-738.031) -- 0:01:04
58500 -- (-739.379) (-740.453) (-742.335) [-740.862] * (-739.233) (-746.014) (-737.668) [-738.398] -- 0:01:04
59000 -- (-740.075) [-739.270] (-742.790) (-742.733) * (-740.126) (-747.861) [-737.664] (-740.245) -- 0:01:03
59500 -- (-739.379) (-738.188) (-737.623) [-741.060] * (-739.478) [-741.785] (-742.271) (-740.651) -- 0:01:03
60000 -- (-738.752) [-739.017] (-737.371) (-739.304) * (-739.254) (-747.762) [-737.823] (-739.407) -- 0:01:02
Average standard deviation of split frequencies: 0.045068
60500 -- (-738.703) [-739.547] (-739.792) (-740.061) * [-739.188] (-746.360) (-737.368) (-739.310) -- 0:01:02
61000 -- (-739.211) (-739.748) (-741.699) [-738.986] * (-738.584) (-745.416) [-739.619] (-737.737) -- 0:01:01
61500 -- [-740.674] (-740.919) (-740.625) (-737.986) * [-738.348] (-746.623) (-738.914) (-743.608) -- 0:01:01
62000 -- (-741.631) (-742.138) [-739.537] (-738.439) * [-739.405] (-749.732) (-742.025) (-745.221) -- 0:01:00
62500 -- (-739.810) (-739.593) [-740.161] (-738.534) * (-737.373) [-742.544] (-739.198) (-738.847) -- 0:01:00
63000 -- [-739.116] (-737.874) (-741.808) (-738.999) * (-736.814) (-742.823) (-739.027) [-740.899] -- 0:00:59
63500 -- (-738.949) (-739.705) [-739.151] (-738.981) * (-740.949) (-743.407) (-740.186) [-740.447] -- 0:00:58
64000 -- [-739.115] (-738.855) (-736.974) (-742.116) * (-739.660) [-746.871] (-737.742) (-738.161) -- 0:00:58
64500 -- (-737.606) (-739.031) (-739.583) [-737.494] * (-740.112) [-745.209] (-737.624) (-740.312) -- 0:00:58
65000 -- (-736.979) [-738.223] (-738.589) (-741.987) * (-737.845) (-748.980) [-737.716] (-739.272) -- 0:00:57
Average standard deviation of split frequencies: 0.034284
65500 -- [-740.159] (-738.227) (-740.825) (-740.178) * (-738.498) (-749.346) (-742.543) [-739.256] -- 0:00:57
66000 -- (-737.691) (-738.232) [-740.403] (-738.140) * [-739.358] (-751.390) (-739.708) (-739.726) -- 0:00:56
66500 -- (-737.539) [-739.422] (-744.413) (-739.425) * [-738.214] (-758.336) (-740.717) (-739.836) -- 0:00:56
67000 -- (-742.240) (-738.791) (-738.956) [-739.878] * (-737.795) (-743.082) [-738.415] (-737.422) -- 0:00:55
67500 -- [-742.136] (-738.776) (-738.067) (-737.783) * [-737.512] (-749.383) (-740.034) (-737.401) -- 0:00:55
68000 -- [-739.699] (-737.898) (-738.898) (-737.684) * (-744.840) [-752.167] (-744.120) (-737.524) -- 0:00:54
68500 -- (-740.638) [-739.534] (-737.895) (-739.700) * [-740.904] (-739.409) (-739.078) (-742.659) -- 0:00:54
69000 -- (-743.833) (-740.506) [-741.166] (-740.073) * [-738.438] (-739.341) (-742.240) (-743.248) -- 0:00:53
69500 -- [-737.587] (-738.485) (-739.546) (-737.645) * (-739.379) [-740.553] (-740.720) (-745.611) -- 0:00:53
70000 -- (-739.268) (-739.900) [-738.298] (-737.049) * (-738.361) (-740.687) (-739.422) [-741.675] -- 0:00:53
Average standard deviation of split frequencies: 0.025349
70500 -- [-739.416] (-737.785) (-738.442) (-737.465) * [-737.903] (-737.917) (-738.139) (-738.371) -- 0:00:52
71000 -- (-739.421) (-738.050) (-737.796) [-738.804] * (-737.470) (-738.068) (-737.450) [-739.823] -- 0:00:52
71500 -- [-738.058] (-737.720) (-739.642) (-739.283) * [-737.987] (-739.345) (-739.872) (-737.137) -- 0:00:51
72000 -- (-739.323) (-740.587) (-738.141) [-742.263] * (-738.183) (-737.984) [-739.284] (-738.372) -- 0:00:51
72500 -- (-739.469) (-739.515) (-737.500) [-742.706] * [-739.295] (-737.351) (-737.446) (-741.410) -- 0:00:51
73000 -- (-739.556) (-738.499) [-736.992] (-737.762) * (-740.672) [-737.607] (-742.509) (-737.959) -- 0:00:50
73500 -- (-738.455) (-740.403) (-737.865) [-737.422] * (-740.282) (-737.065) (-740.440) [-738.498] -- 0:00:50
74000 -- (-739.142) (-737.916) (-739.172) [-740.146] * (-740.538) (-739.206) [-738.151] (-738.471) -- 0:00:50
74500 -- (-738.623) (-738.796) (-738.920) [-741.258] * (-738.315) (-740.179) [-737.538] (-738.635) -- 0:00:49
75000 -- (-742.213) (-739.823) [-739.978] (-739.322) * (-737.889) (-742.667) [-739.414] (-738.635) -- 0:00:49
Average standard deviation of split frequencies: 0.026051
75500 -- (-738.254) (-741.237) (-739.058) [-742.701] * [-739.074] (-738.094) (-738.524) (-738.284) -- 0:00:48
76000 -- (-744.948) (-741.422) [-739.145] (-737.939) * (-740.344) [-738.666] (-739.413) (-739.332) -- 0:01:00
76500 -- (-737.816) (-739.539) [-737.343] (-737.835) * (-738.568) (-737.845) (-738.227) [-737.992] -- 0:01:00
77000 -- (-739.274) (-737.971) (-740.209) [-738.011] * (-738.015) (-740.678) [-738.824] (-737.870) -- 0:00:59
77500 -- [-739.024] (-739.035) (-737.490) (-740.017) * [-737.891] (-741.536) (-741.935) (-737.580) -- 0:00:59
78000 -- (-738.575) [-737.832] (-739.034) (-737.158) * (-738.952) (-739.740) (-741.266) [-737.417] -- 0:00:59
78500 -- (-739.839) (-739.759) [-738.901] (-740.170) * [-737.498] (-740.763) (-742.767) (-740.123) -- 0:00:58
79000 -- (-742.064) [-739.613] (-738.040) (-749.750) * (-737.565) (-744.568) (-742.340) [-741.358] -- 0:00:58
79500 -- (-744.724) (-738.067) (-737.643) [-739.308] * (-738.795) [-745.336] (-742.006) (-740.173) -- 0:00:57
80000 -- [-740.686] (-742.353) (-738.283) (-740.413) * (-739.417) [-743.322] (-742.491) (-740.786) -- 0:00:57
Average standard deviation of split frequencies: 0.024544
80500 -- [-739.485] (-738.210) (-738.067) (-737.995) * (-738.260) [-737.530] (-741.721) (-739.173) -- 0:00:57
81000 -- (-738.671) (-739.658) (-741.597) [-741.446] * [-740.297] (-739.117) (-738.432) (-740.017) -- 0:00:56
81500 -- (-738.881) [-739.582] (-737.906) (-742.097) * [-738.605] (-738.573) (-738.768) (-738.564) -- 0:00:56
82000 -- (-740.680) [-738.024] (-739.097) (-740.954) * (-738.334) [-738.475] (-740.314) (-740.796) -- 0:00:55
82500 -- (-740.173) [-740.479] (-738.146) (-740.796) * (-742.300) (-738.612) (-737.947) [-741.434] -- 0:00:55
83000 -- (-738.496) (-740.386) (-739.830) [-738.073] * (-737.359) [-738.368] (-737.976) (-739.495) -- 0:00:55
83500 -- (-740.839) (-741.410) [-739.316] (-741.394) * (-740.846) [-739.014] (-737.889) (-740.552) -- 0:00:54
84000 -- (-742.351) (-740.821) (-738.409) [-742.257] * [-737.900] (-740.134) (-738.687) (-741.235) -- 0:00:54
84500 -- (-738.681) (-740.119) (-741.759) [-744.421] * [-740.359] (-738.465) (-739.341) (-741.599) -- 0:00:54
85000 -- [-739.836] (-741.172) (-743.399) (-739.348) * (-737.836) (-737.277) [-738.023] (-745.402) -- 0:00:53
Average standard deviation of split frequencies: 0.024118
85500 -- [-739.490] (-740.714) (-742.657) (-738.367) * (-737.826) (-738.890) [-739.231] (-743.473) -- 0:00:53
86000 -- (-738.169) (-740.895) (-741.730) [-737.901] * (-738.610) (-738.382) (-740.202) [-739.258] -- 0:00:53
86500 -- (-739.484) (-740.905) [-743.072] (-738.400) * (-737.967) [-738.987] (-742.479) (-741.901) -- 0:00:52
87000 -- (-740.437) (-741.415) [-737.728] (-739.472) * (-737.615) [-739.497] (-741.508) (-739.035) -- 0:00:52
87500 -- [-738.156] (-744.700) (-739.178) (-739.177) * (-740.036) (-740.747) (-740.228) [-740.903] -- 0:00:52
88000 -- (-738.290) (-741.088) (-743.321) [-738.155] * (-739.426) [-738.208] (-739.319) (-742.460) -- 0:00:51
88500 -- [-739.513] (-741.094) (-740.879) (-738.145) * (-739.237) [-738.312] (-739.144) (-740.084) -- 0:00:51
89000 -- (-737.847) (-739.483) [-738.658] (-738.302) * [-740.357] (-737.212) (-747.143) (-737.082) -- 0:00:51
89500 -- (-738.720) [-738.454] (-738.549) (-737.439) * (-739.932) (-738.431) (-743.395) [-739.923] -- 0:00:50
90000 -- (-741.683) [-739.705] (-737.932) (-747.017) * (-739.880) (-739.089) [-739.995] (-741.680) -- 0:00:50
Average standard deviation of split frequencies: 0.022877
90500 -- (-737.606) [-738.749] (-740.938) (-743.152) * [-741.791] (-738.017) (-742.090) (-737.986) -- 0:00:50
91000 -- (-737.730) (-739.793) (-737.631) [-743.024] * (-739.569) [-738.575] (-739.706) (-741.803) -- 0:00:49
91500 -- (-737.520) (-737.948) [-737.234] (-745.588) * (-738.200) [-738.646] (-737.877) (-739.907) -- 0:00:49
92000 -- (-737.004) (-737.285) [-737.285] (-739.981) * (-738.457) (-737.983) [-738.362] (-737.726) -- 0:00:49
92500 -- (-740.187) (-739.109) (-737.903) [-738.514] * (-740.266) (-739.060) (-741.370) [-737.015] -- 0:00:49
93000 -- [-739.546] (-737.772) (-738.493) (-744.643) * [-742.435] (-740.943) (-738.320) (-737.341) -- 0:00:48
93500 -- (-738.225) [-742.609] (-738.089) (-741.987) * (-738.828) [-740.244] (-738.290) (-738.122) -- 0:00:48
94000 -- (-738.005) (-740.863) (-737.207) [-738.969] * (-737.244) (-741.739) [-737.549] (-737.423) -- 0:00:48
94500 -- (-737.460) (-738.879) (-737.987) [-737.804] * (-745.733) [-740.916] (-737.142) (-737.631) -- 0:00:57
95000 -- (-739.751) (-739.375) (-738.002) [-740.153] * (-738.349) [-740.720] (-737.500) (-739.231) -- 0:00:57
Average standard deviation of split frequencies: 0.023570
95500 -- (-741.323) [-739.148] (-744.669) (-741.228) * (-737.203) [-739.678] (-737.154) (-743.133) -- 0:00:56
96000 -- (-740.424) (-738.279) (-739.763) [-738.973] * (-742.471) (-739.968) (-738.033) [-738.611] -- 0:00:56
96500 -- [-738.723] (-740.363) (-738.940) (-740.625) * (-737.656) (-738.995) [-738.402] (-739.180) -- 0:00:56
97000 -- (-741.687) [-737.558] (-739.607) (-740.810) * [-737.483] (-739.951) (-740.997) (-738.371) -- 0:00:55
97500 -- (-738.066) [-739.965] (-739.702) (-740.249) * [-737.246] (-739.167) (-739.438) (-737.497) -- 0:00:55
98000 -- (-738.104) [-739.273] (-738.247) (-740.732) * (-740.097) [-742.530] (-744.267) (-738.159) -- 0:00:55
98500 -- (-738.355) (-739.120) [-740.486] (-740.149) * (-738.687) [-738.607] (-742.105) (-738.006) -- 0:00:54
99000 -- (-739.373) [-741.572] (-739.476) (-739.755) * [-742.390] (-738.305) (-739.337) (-738.561) -- 0:00:54
99500 -- (-739.932) [-737.560] (-740.565) (-739.874) * (-738.683) (-737.926) [-740.720] (-740.465) -- 0:00:54
100000 -- (-739.663) (-744.041) [-737.332] (-739.846) * (-740.439) [-738.245] (-739.209) (-740.143) -- 0:00:54
Average standard deviation of split frequencies: 0.027160
100500 -- [-739.031] (-742.509) (-736.967) (-738.619) * [-740.351] (-739.479) (-739.166) (-742.355) -- 0:00:53
101000 -- (-737.973) (-738.564) [-739.191] (-739.088) * (-741.868) (-737.347) [-741.389] (-740.364) -- 0:00:53
101500 -- (-741.928) (-744.821) [-740.123] (-740.132) * (-739.118) (-739.855) (-737.709) [-738.744] -- 0:00:53
102000 -- (-738.955) (-738.311) (-741.547) [-737.385] * [-738.882] (-738.955) (-742.950) (-740.227) -- 0:00:52
102500 -- (-737.598) (-738.426) (-740.348) [-737.544] * [-738.871] (-738.415) (-740.248) (-743.242) -- 0:00:52
103000 -- [-737.948] (-743.832) (-743.594) (-746.853) * [-738.006] (-739.264) (-741.166) (-739.015) -- 0:00:52
103500 -- (-738.351) [-737.961] (-738.550) (-737.806) * [-738.886] (-738.540) (-740.036) (-738.911) -- 0:00:51
104000 -- (-738.791) [-738.156] (-738.703) (-737.624) * (-736.926) (-737.461) [-740.212] (-737.628) -- 0:00:51
104500 -- [-737.580] (-739.151) (-738.234) (-739.526) * (-739.123) (-739.137) [-738.239] (-737.776) -- 0:00:51
105000 -- (-741.485) (-738.868) [-738.004] (-738.049) * [-737.864] (-737.096) (-739.609) (-737.503) -- 0:00:51
Average standard deviation of split frequencies: 0.024015
105500 -- (-739.916) (-738.631) (-741.302) [-737.907] * (-741.203) (-743.295) (-739.904) [-739.375] -- 0:00:50
106000 -- [-738.952] (-742.578) (-737.562) (-738.445) * (-738.705) [-737.688] (-743.526) (-739.015) -- 0:00:50
106500 -- (-740.844) (-743.650) (-737.759) [-740.652] * (-739.266) [-738.157] (-738.385) (-738.258) -- 0:00:50
107000 -- (-747.138) [-740.433] (-741.297) (-741.545) * (-739.057) (-738.389) (-740.860) [-739.274] -- 0:00:50
107500 -- (-740.789) (-738.906) (-741.281) [-737.419] * (-741.527) (-742.208) [-740.859] (-738.316) -- 0:00:49
108000 -- (-740.505) (-738.780) [-738.999] (-737.320) * (-738.596) (-739.320) [-740.384] (-737.088) -- 0:00:49
108500 -- [-739.275] (-740.570) (-739.476) (-737.105) * (-737.943) [-739.495] (-739.200) (-738.633) -- 0:00:49
109000 -- (-739.018) (-740.135) [-740.104] (-737.122) * (-739.191) (-739.683) [-739.545] (-737.552) -- 0:00:49
109500 -- (-737.674) (-741.370) [-738.300] (-737.945) * (-737.848) [-741.300] (-742.074) (-742.043) -- 0:00:48
110000 -- (-739.235) (-742.162) (-739.210) [-736.974] * (-740.216) (-740.103) [-739.167] (-737.564) -- 0:00:48
Average standard deviation of split frequencies: 0.025558
110500 -- (-738.240) (-741.282) [-738.233] (-743.840) * (-738.273) [-743.298] (-738.063) (-737.598) -- 0:00:48
111000 -- [-736.974] (-739.501) (-737.258) (-739.596) * (-738.336) (-740.946) (-737.747) [-738.035] -- 0:00:48
111500 -- (-738.112) [-738.291] (-740.902) (-738.545) * (-737.270) (-741.020) [-740.963] (-741.308) -- 0:00:47
112000 -- (-739.945) [-739.627] (-740.873) (-737.281) * (-738.739) (-738.358) [-738.677] (-739.783) -- 0:00:47
112500 -- (-738.781) (-741.250) (-739.337) [-738.315] * (-742.622) [-738.837] (-737.474) (-740.722) -- 0:00:47
113000 -- (-738.885) (-740.503) (-740.656) [-738.250] * (-738.989) (-743.016) (-739.411) [-739.688] -- 0:00:54
113500 -- [-739.549] (-739.574) (-739.436) (-738.266) * (-745.119) [-741.941] (-739.659) (-737.185) -- 0:00:54
114000 -- (-739.843) [-743.028] (-740.830) (-738.330) * (-743.054) [-741.137] (-739.221) (-739.169) -- 0:00:54
114500 -- [-739.423] (-738.660) (-740.301) (-739.377) * (-740.022) (-740.499) (-746.076) [-738.661] -- 0:00:54
115000 -- (-738.866) (-740.818) (-742.679) [-738.711] * (-738.600) (-740.886) [-738.594] (-737.763) -- 0:00:53
Average standard deviation of split frequencies: 0.026009
115500 -- (-738.536) [-740.173] (-740.420) (-739.967) * (-739.133) (-737.306) (-740.999) [-740.901] -- 0:00:53
116000 -- (-739.400) (-741.571) (-741.945) [-738.106] * [-737.315] (-739.464) (-744.693) (-742.377) -- 0:00:53
116500 -- (-740.293) (-737.640) (-740.441) [-737.962] * (-739.680) (-740.920) [-738.500] (-739.687) -- 0:00:53
117000 -- (-738.325) (-737.650) [-738.424] (-737.435) * [-740.155] (-739.046) (-739.424) (-737.149) -- 0:00:52
117500 -- (-738.908) (-741.522) [-737.900] (-742.527) * (-740.174) (-740.428) [-743.535] (-737.234) -- 0:00:52
118000 -- (-739.494) (-741.922) [-737.883] (-739.202) * (-740.595) (-737.801) (-742.696) [-738.012] -- 0:00:52
118500 -- (-737.049) (-738.387) [-740.982] (-736.916) * [-737.711] (-739.316) (-742.440) (-739.137) -- 0:00:52
119000 -- (-737.182) (-737.742) (-740.256) [-737.190] * (-737.840) (-742.642) [-741.420] (-739.249) -- 0:00:51
119500 -- (-737.706) (-739.405) [-740.190] (-739.492) * (-737.970) (-739.698) (-738.933) [-737.261] -- 0:00:51
120000 -- [-739.291] (-739.337) (-740.636) (-738.240) * (-741.047) (-738.575) [-738.641] (-738.780) -- 0:00:51
Average standard deviation of split frequencies: 0.028909
120500 -- (-739.771) [-740.617] (-740.595) (-738.511) * (-744.651) [-738.934] (-739.751) (-738.778) -- 0:00:51
121000 -- (-737.425) [-740.355] (-741.492) (-738.604) * (-741.109) [-742.067] (-739.191) (-737.972) -- 0:00:50
121500 -- (-737.427) (-737.855) [-744.357] (-739.447) * (-738.981) [-740.008] (-738.531) (-738.971) -- 0:00:50
122000 -- (-737.617) (-738.307) [-739.406] (-741.316) * (-740.045) (-741.886) [-737.169] (-738.605) -- 0:00:50
122500 -- (-742.677) (-737.447) [-739.321] (-737.859) * (-745.845) (-737.104) [-737.409] (-738.603) -- 0:00:50
123000 -- (-739.194) (-736.858) [-737.156] (-737.406) * (-740.043) [-739.212] (-737.295) (-739.398) -- 0:00:49
123500 -- (-739.344) (-738.425) (-739.073) [-737.308] * (-739.554) (-737.934) [-740.150] (-739.567) -- 0:00:49
124000 -- [-741.352] (-739.464) (-743.998) (-739.502) * (-738.564) (-737.352) [-738.787] (-738.649) -- 0:00:49
124500 -- (-738.969) (-737.771) (-741.235) [-738.158] * (-739.280) [-737.254] (-739.552) (-740.138) -- 0:00:49
125000 -- (-744.034) [-738.114] (-744.927) (-741.339) * [-738.963] (-737.379) (-737.571) (-737.657) -- 0:00:49
Average standard deviation of split frequencies: 0.026189
125500 -- (-739.105) [-741.658] (-739.109) (-744.601) * (-742.037) (-737.923) [-738.491] (-739.089) -- 0:00:48
126000 -- (-742.061) (-739.130) [-739.042] (-738.560) * [-739.255] (-740.352) (-738.385) (-737.373) -- 0:00:48
126500 -- (-740.123) [-739.594] (-739.696) (-740.520) * (-744.350) (-745.671) [-738.329] (-738.741) -- 0:00:48
127000 -- (-740.452) [-737.920] (-737.660) (-740.840) * [-739.458] (-744.848) (-739.994) (-739.957) -- 0:00:48
127500 -- (-741.012) (-737.851) (-737.602) [-740.904] * (-738.060) (-740.488) (-740.368) [-737.911] -- 0:00:47
128000 -- [-739.143] (-737.908) (-739.872) (-740.545) * (-740.054) [-740.568] (-738.824) (-744.148) -- 0:00:47
128500 -- (-738.937) (-738.411) (-740.052) [-741.518] * (-739.910) (-739.611) [-737.949] (-743.309) -- 0:00:47
129000 -- (-738.503) (-740.153) [-739.291] (-740.882) * (-741.744) (-738.383) (-738.869) [-740.680] -- 0:00:47
129500 -- [-738.545] (-739.348) (-739.632) (-740.002) * (-740.231) [-737.724] (-739.499) (-739.176) -- 0:00:47
130000 -- (-741.396) (-738.340) [-738.896] (-737.796) * [-740.816] (-737.639) (-738.852) (-737.517) -- 0:00:46
Average standard deviation of split frequencies: 0.024532
130500 -- (-741.418) [-741.715] (-738.199) (-739.672) * [-741.384] (-738.665) (-739.107) (-745.176) -- 0:00:46
131000 -- (-738.429) [-738.761] (-748.818) (-737.534) * (-739.460) (-739.652) (-737.923) [-738.950] -- 0:00:46
131500 -- [-736.982] (-740.270) (-746.542) (-738.834) * (-738.268) (-739.386) [-737.362] (-741.026) -- 0:00:52
132000 -- (-737.976) [-738.405] (-741.843) (-738.871) * (-737.444) [-737.986] (-742.952) (-739.678) -- 0:00:52
132500 -- (-739.630) (-738.366) (-740.222) [-737.965] * [-737.297] (-740.234) (-739.028) (-739.813) -- 0:00:52
133000 -- (-738.721) (-739.863) (-738.292) [-738.263] * (-737.906) (-740.502) (-738.323) [-739.404] -- 0:00:52
133500 -- (-738.384) (-737.761) [-740.028] (-738.248) * (-740.584) (-742.099) [-739.014] (-739.868) -- 0:00:51
134000 -- (-738.934) (-737.633) [-739.425] (-738.794) * [-738.169] (-737.283) (-738.455) (-740.095) -- 0:00:51
134500 -- (-741.097) (-737.832) [-741.192] (-738.643) * (-738.790) (-739.372) [-740.333] (-741.880) -- 0:00:51
135000 -- (-738.538) (-738.280) (-742.285) [-738.637] * [-737.895] (-739.143) (-738.071) (-743.504) -- 0:00:51
Average standard deviation of split frequencies: 0.022877
135500 -- [-739.521] (-737.960) (-742.416) (-739.398) * [-741.656] (-739.705) (-738.963) (-740.916) -- 0:00:51
136000 -- [-738.730] (-738.511) (-740.271) (-740.117) * (-742.135) (-739.118) [-740.095] (-738.262) -- 0:00:50
136500 -- (-738.352) [-737.718] (-742.471) (-739.993) * (-739.470) (-737.790) [-740.965] (-737.220) -- 0:00:50
137000 -- (-738.129) (-737.860) (-739.954) [-737.265] * (-738.142) (-739.975) [-740.531] (-738.914) -- 0:00:50
137500 -- (-742.496) (-741.312) (-742.575) [-737.621] * (-740.430) (-739.552) [-737.993] (-737.677) -- 0:00:50
138000 -- [-741.598] (-740.864) (-737.270) (-737.195) * (-739.562) [-738.660] (-738.935) (-742.425) -- 0:00:49
138500 -- [-737.997] (-739.538) (-740.700) (-738.856) * [-739.344] (-737.713) (-739.496) (-742.806) -- 0:00:49
139000 -- (-739.642) [-740.285] (-742.967) (-738.952) * [-738.217] (-738.720) (-739.101) (-740.315) -- 0:00:49
139500 -- (-738.586) (-738.384) (-740.547) [-739.625] * (-742.066) (-738.612) (-737.491) [-742.049] -- 0:00:49
140000 -- (-738.495) (-741.303) [-739.997] (-742.059) * [-739.601] (-740.567) (-739.180) (-739.769) -- 0:00:49
Average standard deviation of split frequencies: 0.020778
140500 -- (-738.274) [-737.684] (-738.600) (-742.310) * (-745.205) (-739.203) [-737.633] (-739.384) -- 0:00:48
141000 -- (-741.493) [-737.696] (-737.441) (-740.563) * (-737.162) (-746.532) (-738.388) [-738.836] -- 0:00:48
141500 -- (-738.845) [-739.406] (-738.305) (-740.098) * (-737.132) (-743.418) [-740.798] (-739.029) -- 0:00:48
142000 -- (-737.674) [-738.640] (-738.403) (-737.973) * (-739.754) (-740.160) [-739.564] (-738.863) -- 0:00:48
142500 -- (-738.427) [-737.229] (-741.940) (-741.563) * [-737.843] (-738.197) (-739.968) (-738.718) -- 0:00:48
143000 -- (-737.986) (-741.032) [-738.071] (-739.925) * (-740.012) (-741.152) (-738.889) [-738.608] -- 0:00:47
143500 -- (-738.212) (-739.791) (-739.870) [-738.135] * (-738.983) (-737.958) (-741.450) [-738.445] -- 0:00:47
144000 -- (-738.407) [-741.353] (-740.874) (-740.282) * (-737.530) [-737.713] (-740.089) (-737.960) -- 0:00:47
144500 -- [-738.410] (-746.751) (-739.131) (-737.384) * (-746.281) (-741.230) (-738.724) [-738.289] -- 0:00:47
145000 -- (-737.598) (-739.907) [-737.841] (-737.090) * (-739.779) (-738.834) [-741.050] (-737.546) -- 0:00:47
Average standard deviation of split frequencies: 0.023247
145500 -- (-737.470) [-738.530] (-738.512) (-739.895) * (-736.947) (-737.564) (-743.145) [-737.138] -- 0:00:46
146000 -- [-738.580] (-740.188) (-739.647) (-738.212) * (-740.161) [-736.994] (-741.238) (-737.142) -- 0:00:46
146500 -- [-739.797] (-737.668) (-738.956) (-737.702) * (-737.840) [-737.990] (-740.389) (-742.387) -- 0:00:46
147000 -- [-739.121] (-740.024) (-740.582) (-738.048) * [-738.653] (-739.961) (-743.705) (-739.239) -- 0:00:46
147500 -- [-739.750] (-743.248) (-740.298) (-738.735) * [-738.516] (-738.526) (-739.113) (-741.439) -- 0:00:46
148000 -- (-741.169) [-738.024] (-737.433) (-738.176) * (-741.858) (-740.979) (-738.770) [-741.515] -- 0:00:46
148500 -- (-737.904) [-738.290] (-737.884) (-742.594) * [-738.987] (-739.044) (-739.016) (-737.923) -- 0:00:45
149000 -- (-745.237) (-741.881) [-737.583] (-738.349) * (-741.492) [-738.363] (-738.264) (-737.526) -- 0:00:45
149500 -- (-743.861) (-738.701) [-737.377] (-737.578) * (-741.652) (-737.422) [-737.826] (-741.804) -- 0:00:45
150000 -- (-742.916) (-738.499) [-739.316] (-740.661) * (-737.948) [-740.249] (-740.081) (-741.868) -- 0:00:51
Average standard deviation of split frequencies: 0.023153
150500 -- (-740.487) [-738.185] (-738.638) (-737.800) * [-737.483] (-737.123) (-738.528) (-741.377) -- 0:00:50
151000 -- (-740.058) [-740.473] (-737.801) (-737.273) * (-737.993) [-737.113] (-740.092) (-742.136) -- 0:00:50
151500 -- (-740.426) [-739.831] (-737.231) (-741.818) * [-738.963] (-737.530) (-737.878) (-740.907) -- 0:00:50
152000 -- (-739.096) (-737.199) [-738.302] (-738.898) * (-740.299) (-737.741) (-740.292) [-739.396] -- 0:00:50
152500 -- (-741.186) [-739.300] (-737.576) (-742.612) * [-739.813] (-737.696) (-738.104) (-737.820) -- 0:00:50
153000 -- (-739.003) (-741.569) (-744.176) [-741.047] * (-740.222) (-738.660) [-737.534] (-738.527) -- 0:00:49
153500 -- (-742.336) (-741.206) [-738.374] (-738.043) * (-741.241) [-738.241] (-737.944) (-737.918) -- 0:00:49
154000 -- (-738.970) (-742.699) (-739.203) [-738.280] * [-739.912] (-740.947) (-739.908) (-738.676) -- 0:00:49
154500 -- (-738.576) (-738.407) [-737.388] (-740.816) * (-738.887) (-740.922) (-740.779) [-738.045] -- 0:00:49
155000 -- [-738.853] (-737.972) (-739.137) (-739.672) * [-741.054] (-740.692) (-738.484) (-737.737) -- 0:00:49
Average standard deviation of split frequencies: 0.022361
155500 -- (-739.164) (-737.913) [-740.934] (-740.400) * [-739.280] (-743.092) (-738.739) (-739.963) -- 0:00:48
156000 -- (-737.786) (-739.670) [-737.992] (-740.860) * (-738.883) (-738.403) [-738.488] (-740.226) -- 0:00:48
156500 -- (-739.040) (-740.271) [-741.495] (-739.551) * (-736.955) (-737.240) [-742.758] (-739.443) -- 0:00:48
157000 -- (-738.631) [-737.187] (-742.673) (-737.470) * (-739.020) (-737.159) [-737.516] (-739.094) -- 0:00:48
157500 -- (-737.718) (-739.646) [-737.046] (-738.225) * (-738.071) (-737.875) [-737.452] (-738.905) -- 0:00:48
158000 -- [-738.114] (-738.695) (-738.578) (-737.508) * [-740.331] (-737.466) (-743.704) (-739.581) -- 0:00:47
158500 -- (-738.810) (-737.101) [-738.757] (-738.654) * (-737.223) (-740.187) [-740.135] (-741.038) -- 0:00:47
159000 -- (-738.621) (-740.478) [-740.480] (-741.488) * [-737.426] (-743.776) (-739.576) (-738.947) -- 0:00:47
159500 -- (-739.704) (-742.447) (-739.242) [-739.247] * [-738.189] (-741.234) (-738.116) (-738.546) -- 0:00:47
160000 -- [-738.437] (-741.304) (-738.869) (-739.132) * (-738.983) [-738.533] (-743.496) (-742.640) -- 0:00:47
Average standard deviation of split frequencies: 0.020538
160500 -- [-737.797] (-740.119) (-737.745) (-741.534) * (-737.930) [-738.555] (-741.834) (-737.657) -- 0:00:47
161000 -- [-737.620] (-740.143) (-742.167) (-740.380) * (-741.284) (-739.846) (-744.440) [-737.391] -- 0:00:46
161500 -- (-741.243) [-739.798] (-739.536) (-742.913) * (-738.747) [-738.995] (-743.644) (-737.421) -- 0:00:46
162000 -- (-739.944) (-740.651) [-739.392] (-741.347) * [-738.128] (-738.455) (-739.678) (-737.742) -- 0:00:46
162500 -- [-741.619] (-742.878) (-737.502) (-746.127) * [-740.598] (-738.802) (-742.633) (-737.835) -- 0:00:46
163000 -- (-739.520) [-739.814] (-741.783) (-741.789) * [-737.979] (-742.558) (-745.913) (-737.085) -- 0:00:46
163500 -- [-738.184] (-741.147) (-739.218) (-741.203) * (-738.590) [-739.459] (-744.497) (-738.800) -- 0:00:46
164000 -- (-739.264) (-740.306) (-738.834) [-737.684] * (-738.942) (-739.913) [-740.264] (-738.331) -- 0:00:45
164500 -- (-738.973) (-741.651) (-738.403) [-737.701] * (-740.388) (-745.344) [-738.785] (-741.372) -- 0:00:45
165000 -- (-738.024) [-737.714] (-738.142) (-740.366) * (-740.342) (-738.884) [-737.968] (-738.331) -- 0:00:45
Average standard deviation of split frequencies: 0.019879
165500 -- [-737.206] (-740.351) (-741.334) (-738.405) * (-739.313) (-738.984) (-742.159) [-738.902] -- 0:00:45
166000 -- [-739.383] (-744.389) (-739.110) (-737.982) * (-738.292) (-738.801) [-739.067] (-740.980) -- 0:00:45
166500 -- [-738.074] (-744.276) (-741.114) (-737.291) * (-740.552) (-740.802) [-741.243] (-741.108) -- 0:00:45
167000 -- (-740.187) [-737.819] (-741.895) (-737.542) * (-738.425) (-737.371) (-738.257) [-738.792] -- 0:00:44
167500 -- (-738.983) (-737.662) (-737.921) [-739.482] * (-738.057) [-738.320] (-741.113) (-741.193) -- 0:00:44
168000 -- (-740.840) (-737.541) [-740.082] (-739.682) * (-738.696) (-739.438) (-739.063) [-738.758] -- 0:00:44
168500 -- (-741.900) (-740.442) [-738.459] (-741.039) * (-740.289) (-739.758) (-737.831) [-742.339] -- 0:00:49
169000 -- (-740.292) [-739.185] (-737.992) (-741.623) * (-738.045) (-740.340) [-739.555] (-739.659) -- 0:00:49
169500 -- (-741.597) (-739.475) [-737.700] (-740.913) * (-741.929) (-739.153) (-739.447) [-737.359] -- 0:00:48
170000 -- (-741.166) (-739.151) [-738.818] (-739.583) * (-738.290) [-739.237] (-738.172) (-737.098) -- 0:00:48
Average standard deviation of split frequencies: 0.020440
170500 -- (-738.702) (-739.959) (-741.211) [-739.047] * [-737.823] (-738.167) (-737.045) (-738.939) -- 0:00:48
171000 -- (-739.055) (-739.681) [-739.374] (-742.169) * [-739.905] (-739.290) (-739.129) (-738.512) -- 0:00:48
171500 -- (-739.091) [-739.471] (-738.923) (-737.949) * (-743.735) [-739.974] (-740.886) (-740.315) -- 0:00:48
172000 -- (-742.086) (-739.626) (-740.712) [-740.619] * (-743.507) (-740.589) [-738.545] (-738.798) -- 0:00:48
172500 -- [-738.854] (-742.570) (-739.071) (-740.317) * [-740.985] (-744.343) (-738.830) (-738.240) -- 0:00:47
173000 -- [-742.233] (-738.756) (-739.553) (-739.500) * (-737.739) [-741.863] (-738.400) (-741.238) -- 0:00:47
173500 -- (-741.521) (-741.147) [-737.132] (-739.215) * (-740.872) (-739.250) (-752.696) [-738.770] -- 0:00:47
174000 -- [-739.492] (-741.132) (-736.920) (-738.531) * (-741.486) [-740.811] (-749.851) (-738.934) -- 0:00:47
174500 -- (-737.711) (-738.857) [-738.325] (-737.529) * (-738.354) [-738.856] (-744.193) (-738.484) -- 0:00:47
175000 -- (-740.267) (-739.155) (-738.694) [-737.148] * (-741.379) [-740.605] (-738.078) (-738.346) -- 0:00:47
Average standard deviation of split frequencies: 0.021427
175500 -- [-740.398] (-738.266) (-742.654) (-737.365) * (-739.795) [-738.448] (-740.236) (-740.913) -- 0:00:46
176000 -- (-739.634) [-738.921] (-741.333) (-738.277) * (-740.531) (-737.936) (-738.529) [-739.980] -- 0:00:46
176500 -- [-740.412] (-738.348) (-739.166) (-738.714) * (-740.473) (-738.907) [-739.544] (-740.570) -- 0:00:46
177000 -- (-744.769) (-737.718) (-741.854) [-738.402] * (-739.162) (-741.392) (-738.352) [-739.942] -- 0:00:46
177500 -- [-738.680] (-739.627) (-741.077) (-739.170) * [-737.424] (-741.275) (-738.722) (-737.354) -- 0:00:46
178000 -- (-738.018) (-739.011) (-737.621) [-738.643] * [-737.926] (-741.192) (-740.550) (-741.320) -- 0:00:46
178500 -- (-739.038) (-740.500) [-738.790] (-738.530) * [-739.650] (-741.526) (-739.946) (-740.587) -- 0:00:46
179000 -- (-739.505) (-741.691) [-737.088] (-739.881) * [-738.325] (-740.476) (-739.657) (-742.298) -- 0:00:45
179500 -- (-738.666) [-741.433] (-738.667) (-742.111) * [-738.547] (-738.535) (-737.313) (-737.778) -- 0:00:45
180000 -- (-740.901) (-737.770) [-739.479] (-743.324) * (-741.157) (-739.939) [-739.467] (-738.718) -- 0:00:45
Average standard deviation of split frequencies: 0.019830
180500 -- (-747.148) (-738.376) (-739.365) [-738.042] * (-737.462) (-740.370) (-739.198) [-738.223] -- 0:00:45
181000 -- (-739.848) [-737.720] (-737.951) (-737.204) * (-738.459) (-740.843) (-738.516) [-738.163] -- 0:00:45
181500 -- (-737.731) [-738.523] (-740.563) (-738.861) * (-740.215) (-742.192) [-740.208] (-737.222) -- 0:00:45
182000 -- [-738.294] (-741.154) (-737.517) (-738.639) * [-737.314] (-741.073) (-738.789) (-737.248) -- 0:00:44
182500 -- (-741.109) [-739.398] (-740.536) (-741.302) * (-739.175) [-740.540] (-738.533) (-745.263) -- 0:00:44
183000 -- [-738.793] (-741.154) (-739.921) (-741.287) * [-740.159] (-740.030) (-737.563) (-739.131) -- 0:00:44
183500 -- (-737.252) (-744.036) (-745.231) [-738.344] * (-740.527) [-739.111] (-738.025) (-738.572) -- 0:00:44
184000 -- (-737.705) (-740.653) [-741.262] (-737.377) * (-738.291) (-738.905) [-739.394] (-739.955) -- 0:00:44
184500 -- (-738.850) [-737.733] (-743.931) (-745.119) * (-738.132) [-736.856] (-739.260) (-739.168) -- 0:00:44
185000 -- [-740.294] (-738.158) (-740.233) (-744.732) * (-742.365) (-737.257) (-739.156) [-738.507] -- 0:00:44
Average standard deviation of split frequencies: 0.018755
185500 -- (-741.423) [-738.674] (-737.924) (-738.863) * (-739.886) (-742.302) (-738.935) [-738.272] -- 0:00:43
186000 -- (-744.791) [-737.678] (-739.191) (-737.698) * [-738.391] (-738.899) (-739.119) (-742.526) -- 0:00:43
186500 -- (-737.839) (-741.732) (-740.522) [-737.813] * (-740.456) (-746.933) [-739.577] (-741.325) -- 0:00:43
187000 -- (-737.529) (-740.330) (-742.495) [-737.301] * (-739.290) (-740.627) (-738.873) [-739.503] -- 0:00:47
187500 -- (-737.477) (-738.410) (-741.769) [-737.375] * [-738.636] (-737.544) (-738.425) (-742.368) -- 0:00:47
188000 -- [-738.260] (-738.620) (-739.845) (-742.058) * (-738.466) (-739.086) [-738.090] (-737.731) -- 0:00:47
188500 -- [-741.514] (-739.332) (-739.149) (-742.056) * (-737.408) [-741.531] (-739.088) (-738.232) -- 0:00:47
189000 -- (-741.028) [-743.214] (-742.003) (-742.733) * (-740.896) (-737.598) [-737.845] (-737.582) -- 0:00:47
189500 -- (-742.125) (-737.558) (-742.888) [-737.746] * (-740.772) [-737.887] (-737.810) (-738.604) -- 0:00:47
190000 -- (-738.738) (-737.275) [-745.088] (-742.452) * (-741.414) (-738.305) [-738.988] (-738.150) -- 0:00:46
Average standard deviation of split frequencies: 0.016318
190500 -- (-738.388) [-737.922] (-741.370) (-737.214) * (-739.948) [-737.849] (-742.679) (-737.743) -- 0:00:46
191000 -- (-743.979) (-739.214) (-740.334) [-739.607] * (-741.954) [-740.240] (-737.450) (-743.364) -- 0:00:46
191500 -- (-739.675) [-738.167] (-738.406) (-739.118) * (-740.226) (-741.051) [-737.233] (-740.806) -- 0:00:46
192000 -- [-739.597] (-738.122) (-737.780) (-739.860) * (-739.870) (-737.849) [-739.112] (-738.959) -- 0:00:46
192500 -- [-737.638] (-737.366) (-738.598) (-737.850) * (-741.700) [-739.658] (-739.128) (-737.744) -- 0:00:46
193000 -- (-737.834) [-737.533] (-738.854) (-742.865) * (-738.403) (-740.513) (-739.161) [-738.746] -- 0:00:45
193500 -- (-737.657) (-740.887) (-738.306) [-738.958] * [-741.161] (-742.519) (-738.922) (-738.476) -- 0:00:45
194000 -- (-738.444) (-740.925) (-740.002) [-745.245] * [-741.416] (-741.325) (-737.101) (-737.373) -- 0:00:45
194500 -- [-741.497] (-739.431) (-742.011) (-738.437) * (-739.679) [-739.556] (-744.144) (-738.957) -- 0:00:45
195000 -- (-739.462) (-738.684) (-749.193) [-739.583] * [-739.538] (-740.311) (-741.932) (-738.690) -- 0:00:45
Average standard deviation of split frequencies: 0.019241
195500 -- (-738.608) (-747.463) [-741.427] (-745.078) * (-742.924) [-737.791] (-741.199) (-738.288) -- 0:00:45
196000 -- (-738.821) (-739.812) [-738.094] (-738.502) * (-742.890) [-739.792] (-739.342) (-739.700) -- 0:00:45
196500 -- (-738.717) (-738.170) [-739.045] (-738.506) * (-739.704) (-740.011) (-741.050) [-742.241] -- 0:00:44
197000 -- [-740.234] (-742.983) (-739.424) (-739.385) * (-741.128) (-738.555) [-738.777] (-740.520) -- 0:00:44
197500 -- [-739.984] (-740.370) (-740.617) (-741.547) * (-737.346) [-739.411] (-738.539) (-742.047) -- 0:00:44
198000 -- [-742.379] (-738.140) (-743.889) (-739.593) * (-740.332) (-738.609) [-738.115] (-740.022) -- 0:00:44
198500 -- (-740.988) (-737.723) (-738.260) [-744.079] * [-736.967] (-743.567) (-738.486) (-739.234) -- 0:00:44
199000 -- (-740.291) (-741.444) (-739.239) [-740.976] * [-737.135] (-738.504) (-739.988) (-741.651) -- 0:00:44
199500 -- (-740.404) [-738.386] (-739.401) (-744.130) * (-739.641) (-737.961) [-740.277] (-737.979) -- 0:00:44
200000 -- (-739.500) [-737.371] (-742.656) (-737.468) * [-738.731] (-738.407) (-740.845) (-741.173) -- 0:00:44
Average standard deviation of split frequencies: 0.017854
200500 -- (-741.233) (-739.626) (-745.271) [-739.828] * (-738.677) [-741.695] (-741.047) (-741.973) -- 0:00:43
201000 -- [-740.285] (-744.121) (-739.355) (-738.307) * (-737.789) (-738.735) (-741.608) [-738.648] -- 0:00:43
201500 -- (-743.399) (-739.938) (-740.849) [-738.770] * [-739.230] (-739.313) (-738.602) (-737.266) -- 0:00:43
202000 -- (-739.925) (-737.184) [-738.462] (-739.180) * (-738.935) (-742.103) [-740.796] (-739.317) -- 0:00:43
202500 -- (-737.584) [-737.884] (-738.404) (-739.636) * [-737.660] (-742.680) (-739.113) (-738.840) -- 0:00:43
203000 -- [-737.612] (-737.271) (-737.717) (-739.291) * (-740.303) (-745.610) [-738.812] (-738.730) -- 0:00:43
203500 -- (-738.585) (-737.413) (-740.797) [-744.064] * [-743.340] (-738.750) (-737.404) (-738.151) -- 0:00:43
204000 -- (-739.274) [-739.227] (-738.285) (-741.310) * [-742.380] (-738.821) (-739.813) (-738.990) -- 0:00:42
204500 -- (-739.534) (-741.128) [-738.111] (-739.690) * (-738.760) [-737.739] (-738.821) (-739.304) -- 0:00:42
205000 -- (-737.628) (-739.635) (-743.588) [-737.535] * (-740.555) (-739.686) (-739.680) [-739.207] -- 0:00:42
Average standard deviation of split frequencies: 0.021053
205500 -- [-742.902] (-737.884) (-738.701) (-737.617) * [-737.380] (-741.054) (-743.986) (-741.390) -- 0:00:46
206000 -- (-737.722) (-743.065) [-737.237] (-739.750) * (-738.585) (-740.393) [-741.494] (-738.258) -- 0:00:46
206500 -- (-744.384) (-738.545) [-737.284] (-738.846) * [-738.475] (-739.681) (-739.607) (-740.813) -- 0:00:46
207000 -- (-742.072) (-740.707) [-739.800] (-742.368) * (-739.344) [-741.403] (-738.025) (-741.935) -- 0:00:45
207500 -- (-739.093) (-741.604) [-739.627] (-738.597) * [-737.156] (-738.629) (-740.429) (-739.873) -- 0:00:45
208000 -- (-740.925) (-739.724) (-738.225) [-741.359] * [-737.156] (-737.911) (-738.915) (-741.550) -- 0:00:45
208500 -- (-738.553) (-740.021) (-738.169) [-738.166] * (-738.694) [-738.650] (-738.538) (-737.440) -- 0:00:45
209000 -- [-742.245] (-738.217) (-739.212) (-742.035) * (-737.775) [-737.953] (-745.051) (-738.750) -- 0:00:45
209500 -- (-742.935) [-740.479] (-738.991) (-741.695) * (-738.701) (-739.739) [-739.561] (-737.134) -- 0:00:45
210000 -- (-745.393) (-739.980) (-739.229) [-741.366] * (-738.755) (-739.242) [-737.234] (-743.180) -- 0:00:45
Average standard deviation of split frequencies: 0.022824
210500 -- (-751.838) (-740.979) (-737.805) [-740.163] * (-738.278) (-739.611) [-737.633] (-738.579) -- 0:00:45
211000 -- (-744.482) (-739.990) (-737.947) [-737.640] * (-738.208) (-742.340) [-737.552] (-738.132) -- 0:00:44
211500 -- (-741.716) (-738.648) (-737.645) [-739.532] * (-737.967) [-739.148] (-742.114) (-739.186) -- 0:00:44
212000 -- (-740.351) [-737.714] (-738.466) (-737.943) * (-738.990) (-737.201) (-744.043) [-737.332] -- 0:00:44
212500 -- (-739.110) (-738.721) (-738.134) [-738.572] * (-738.567) (-737.286) [-737.445] (-737.283) -- 0:00:44
213000 -- [-739.131] (-737.134) (-741.251) (-737.496) * (-742.240) [-738.273] (-745.806) (-737.772) -- 0:00:44
213500 -- [-740.173] (-738.431) (-740.192) (-738.238) * (-741.592) (-741.707) (-740.946) [-738.441] -- 0:00:44
214000 -- (-739.559) [-742.289] (-738.959) (-741.331) * (-737.124) [-738.479] (-738.648) (-740.316) -- 0:00:44
214500 -- (-739.446) (-742.510) (-739.296) [-737.949] * (-739.214) [-740.560] (-743.551) (-740.504) -- 0:00:43
215000 -- [-738.135] (-738.411) (-739.000) (-737.123) * (-740.824) (-739.982) (-740.923) [-740.210] -- 0:00:43
Average standard deviation of split frequencies: 0.020078
215500 -- (-738.660) (-740.622) [-741.078] (-739.087) * (-737.719) (-737.675) [-739.999] (-742.233) -- 0:00:43
216000 -- (-739.349) (-741.854) [-738.561] (-746.950) * [-738.129] (-739.127) (-742.827) (-744.780) -- 0:00:43
216500 -- (-738.807) (-738.229) (-738.678) [-740.609] * [-738.352] (-737.836) (-746.107) (-737.415) -- 0:00:43
217000 -- (-738.001) [-738.024] (-738.446) (-738.407) * [-740.123] (-739.608) (-738.565) (-738.777) -- 0:00:43
217500 -- (-740.360) (-739.084) [-740.339] (-738.465) * (-743.945) (-741.701) (-738.619) [-738.090] -- 0:00:43
218000 -- (-745.967) (-743.422) (-742.287) [-739.439] * [-740.253] (-739.636) (-738.844) (-740.231) -- 0:00:43
218500 -- (-744.929) (-737.998) [-741.792] (-738.456) * [-738.904] (-737.924) (-738.724) (-741.529) -- 0:00:42
219000 -- (-738.585) [-737.522] (-738.454) (-737.445) * (-740.143) [-738.106] (-739.331) (-741.083) -- 0:00:42
219500 -- [-740.590] (-739.759) (-739.344) (-739.785) * (-740.028) (-738.358) [-738.420] (-740.822) -- 0:00:42
220000 -- (-737.606) [-737.228] (-738.895) (-737.530) * (-739.639) [-737.909] (-738.400) (-740.648) -- 0:00:42
Average standard deviation of split frequencies: 0.019654
220500 -- (-739.960) (-738.461) (-739.687) [-737.355] * [-741.588] (-742.216) (-737.547) (-742.152) -- 0:00:42
221000 -- [-738.645] (-739.193) (-738.721) (-737.480) * (-738.844) [-745.073] (-737.223) (-738.036) -- 0:00:42
221500 -- [-738.724] (-740.069) (-740.436) (-739.065) * (-738.802) (-738.214) [-737.820] (-740.040) -- 0:00:42
222000 -- (-740.891) (-739.342) (-738.201) [-741.032] * [-741.948] (-739.546) (-739.186) (-738.288) -- 0:00:42
222500 -- (-737.856) (-742.429) [-738.556] (-738.181) * (-738.489) (-740.539) (-738.859) [-738.393] -- 0:00:41
223000 -- (-737.767) [-736.961] (-737.722) (-743.059) * (-738.531) (-737.855) (-740.521) [-741.041] -- 0:00:41
223500 -- (-740.297) (-740.625) (-737.343) [-743.563] * [-738.297] (-741.116) (-738.424) (-738.365) -- 0:00:41
224000 -- (-739.861) (-739.733) (-739.878) [-738.452] * [-740.399] (-740.116) (-737.851) (-738.301) -- 0:00:45
224500 -- [-742.816] (-738.142) (-739.942) (-738.529) * (-737.923) (-738.984) (-738.939) [-738.166] -- 0:00:44
225000 -- (-741.980) [-737.043] (-739.259) (-742.080) * (-738.844) (-738.521) [-739.912] (-740.015) -- 0:00:44
Average standard deviation of split frequencies: 0.017104
225500 -- (-740.158) [-737.978] (-744.413) (-738.240) * [-738.923] (-742.611) (-739.675) (-739.313) -- 0:00:44
226000 -- (-739.031) (-737.458) [-739.573] (-737.092) * [-739.586] (-747.837) (-738.879) (-737.330) -- 0:00:44
226500 -- (-743.816) (-737.970) [-740.309] (-740.789) * (-739.780) (-742.106) (-737.487) [-738.268] -- 0:00:44
227000 -- (-740.165) (-738.102) (-740.416) [-737.217] * (-739.264) [-738.176] (-738.207) (-738.165) -- 0:00:44
227500 -- (-740.085) (-738.128) (-741.752) [-738.068] * (-738.702) (-738.211) [-739.537] (-738.341) -- 0:00:44
228000 -- (-738.382) [-737.661] (-740.003) (-737.413) * (-737.581) (-738.195) (-737.906) [-738.924] -- 0:00:44
228500 -- (-747.547) (-739.835) (-740.732) [-738.089] * (-740.054) (-742.359) (-737.365) [-740.608] -- 0:00:43
229000 -- (-741.784) (-737.697) (-742.669) [-738.025] * (-739.578) [-739.314] (-737.696) (-739.557) -- 0:00:43
229500 -- [-740.735] (-737.970) (-740.622) (-744.638) * (-741.781) (-738.480) [-738.818] (-739.277) -- 0:00:43
230000 -- [-742.080] (-739.616) (-738.292) (-738.846) * [-737.479] (-742.491) (-737.078) (-740.170) -- 0:00:43
Average standard deviation of split frequencies: 0.016349
230500 -- (-742.099) (-739.655) (-737.970) [-738.171] * [-741.683] (-737.358) (-741.608) (-737.641) -- 0:00:43
231000 -- (-741.402) (-737.780) (-739.090) [-739.528] * (-741.445) (-737.070) [-737.535] (-739.919) -- 0:00:43
231500 -- (-738.371) [-738.498] (-738.196) (-738.780) * (-741.266) (-738.291) [-739.127] (-738.505) -- 0:00:43
232000 -- [-741.395] (-739.829) (-737.876) (-739.251) * (-739.919) (-740.767) [-741.307] (-737.699) -- 0:00:43
232500 -- (-738.919) (-739.406) (-741.554) [-739.430] * (-741.109) [-742.507] (-738.126) (-738.668) -- 0:00:42
233000 -- (-738.535) (-741.005) (-738.877) [-737.923] * (-738.927) (-741.163) (-739.016) [-739.003] -- 0:00:42
233500 -- (-741.771) (-739.765) [-738.932] (-739.273) * (-739.458) [-738.153] (-740.952) (-739.402) -- 0:00:42
234000 -- (-747.692) [-738.063] (-738.514) (-738.742) * (-742.126) [-739.846] (-739.161) (-742.294) -- 0:00:42
234500 -- (-741.936) (-737.302) (-740.165) [-740.989] * (-741.583) [-738.804] (-737.830) (-745.119) -- 0:00:42
235000 -- [-742.973] (-736.991) (-738.739) (-738.360) * (-739.471) (-740.125) [-738.577] (-745.312) -- 0:00:42
Average standard deviation of split frequencies: 0.015580
235500 -- [-737.709] (-737.757) (-738.820) (-737.336) * (-739.266) (-740.367) [-739.345] (-740.173) -- 0:00:42
236000 -- (-741.123) [-737.323] (-741.106) (-738.441) * [-740.360] (-742.296) (-739.473) (-739.302) -- 0:00:42
236500 -- (-738.977) (-739.853) (-738.660) [-738.011] * [-739.466] (-739.715) (-738.862) (-740.553) -- 0:00:41
237000 -- (-738.188) (-736.982) (-740.647) [-738.971] * (-740.941) (-739.732) [-739.633] (-739.411) -- 0:00:41
237500 -- (-739.112) (-737.110) (-739.460) [-737.430] * (-739.498) (-743.107) (-738.128) [-738.857] -- 0:00:41
238000 -- [-744.433] (-739.261) (-738.484) (-739.810) * (-739.172) (-740.440) (-739.594) [-739.212] -- 0:00:41
238500 -- [-743.406] (-739.114) (-737.649) (-740.601) * (-738.626) (-738.688) (-742.663) [-740.630] -- 0:00:41
239000 -- (-737.217) (-743.030) [-738.106] (-739.886) * (-740.409) [-738.451] (-740.814) (-740.309) -- 0:00:41
239500 -- (-737.246) (-745.597) (-738.982) [-741.616] * (-739.359) (-739.738) [-739.756] (-738.792) -- 0:00:41
240000 -- (-739.990) (-740.182) (-739.815) [-738.942] * (-740.421) (-739.465) (-741.634) [-739.597] -- 0:00:41
Average standard deviation of split frequencies: 0.017629
240500 -- (-738.408) (-740.113) [-739.914] (-738.600) * (-737.689) (-742.055) (-738.024) [-742.148] -- 0:00:41
241000 -- [-739.260] (-737.741) (-740.124) (-739.228) * [-737.568] (-745.023) (-739.715) (-738.762) -- 0:00:40
241500 -- [-740.582] (-737.270) (-741.131) (-741.061) * (-737.809) (-739.722) [-740.268] (-740.807) -- 0:00:40
242000 -- (-740.527) [-737.619] (-743.489) (-739.264) * (-737.412) [-739.804] (-742.746) (-737.203) -- 0:00:40
242500 -- (-737.662) (-741.092) (-737.976) [-740.469] * [-740.577] (-740.840) (-738.566) (-737.813) -- 0:00:43
243000 -- (-743.239) [-738.757] (-737.516) (-740.453) * (-738.314) (-740.692) [-738.907] (-739.515) -- 0:00:43
243500 -- (-739.987) [-739.634] (-746.776) (-740.648) * (-740.608) (-741.806) (-740.725) [-738.256] -- 0:00:43
244000 -- (-740.711) [-739.455] (-739.318) (-738.999) * (-740.607) [-740.199] (-738.797) (-738.679) -- 0:00:43
244500 -- (-741.322) (-739.938) (-739.563) [-738.757] * [-740.976] (-741.625) (-741.431) (-744.710) -- 0:00:43
245000 -- (-740.523) (-740.542) [-738.453] (-738.643) * (-738.385) (-738.705) (-736.939) [-744.995] -- 0:00:43
Average standard deviation of split frequencies: 0.019929
245500 -- (-741.501) [-739.556] (-737.170) (-738.774) * (-739.672) [-739.322] (-737.039) (-743.876) -- 0:00:43
246000 -- (-737.290) (-738.096) (-741.663) [-740.625] * (-738.728) (-741.920) [-737.924] (-742.435) -- 0:00:42
246500 -- [-738.311] (-737.107) (-742.064) (-738.778) * (-740.336) [-738.620] (-740.299) (-737.876) -- 0:00:42
247000 -- (-740.370) (-739.669) [-737.278] (-737.748) * [-739.751] (-738.857) (-739.045) (-737.337) -- 0:00:42
247500 -- (-743.631) (-743.448) [-737.246] (-737.416) * (-740.097) [-740.916] (-738.884) (-737.525) -- 0:00:42
248000 -- [-737.473] (-744.113) (-737.713) (-736.986) * [-740.302] (-740.712) (-739.055) (-738.092) -- 0:00:42
248500 -- (-737.283) [-739.567] (-739.050) (-739.669) * (-738.925) (-737.332) [-737.962] (-740.504) -- 0:00:42
249000 -- (-738.499) [-738.973] (-740.744) (-740.899) * (-739.507) [-737.977] (-741.758) (-737.996) -- 0:00:42
249500 -- [-737.722] (-738.679) (-746.280) (-739.406) * (-739.393) (-737.840) (-742.074) [-739.707] -- 0:00:42
250000 -- (-739.552) [-741.340] (-741.366) (-738.657) * (-739.066) (-738.963) [-741.848] (-737.472) -- 0:00:42
Average standard deviation of split frequencies: 0.019558
250500 -- [-741.020] (-746.482) (-738.009) (-739.888) * [-741.326] (-738.797) (-743.340) (-739.731) -- 0:00:41
251000 -- (-737.143) (-740.970) [-737.107] (-738.409) * [-741.629] (-741.228) (-743.716) (-738.429) -- 0:00:41
251500 -- (-737.487) (-738.656) (-737.679) [-738.665] * (-740.283) [-740.772] (-742.145) (-737.695) -- 0:00:41
252000 -- (-741.869) [-737.974] (-738.092) (-739.800) * (-739.213) (-737.915) (-742.052) [-737.550] -- 0:00:41
252500 -- (-744.899) (-737.859) [-737.529] (-741.287) * (-739.341) (-742.534) [-739.580] (-738.662) -- 0:00:41
253000 -- (-739.713) (-738.249) (-737.384) [-743.310] * (-738.880) [-738.046] (-739.519) (-739.223) -- 0:00:41
253500 -- (-740.125) [-738.108] (-742.837) (-739.799) * (-737.670) (-738.308) (-739.556) [-740.078] -- 0:00:41
254000 -- (-737.781) (-739.864) (-741.311) [-740.906] * (-739.185) (-738.268) (-739.566) [-737.635] -- 0:00:41
254500 -- (-738.538) [-739.149] (-738.244) (-741.926) * [-740.397] (-740.432) (-738.874) (-737.010) -- 0:00:41
255000 -- (-737.752) (-742.681) [-739.663] (-738.329) * [-739.325] (-740.062) (-738.832) (-737.164) -- 0:00:40
Average standard deviation of split frequencies: 0.015836
255500 -- (-737.641) [-738.805] (-739.980) (-738.750) * [-740.133] (-737.930) (-737.178) (-737.083) -- 0:00:40
256000 -- (-739.358) (-739.226) (-740.531) [-744.782] * (-742.326) (-738.991) [-737.537] (-739.277) -- 0:00:40
256500 -- (-737.594) (-736.994) (-741.107) [-737.212] * (-739.359) (-738.463) [-739.207] (-738.357) -- 0:00:40
257000 -- (-737.200) [-736.818] (-740.842) (-738.005) * (-739.668) (-737.392) [-740.081] (-741.227) -- 0:00:40
257500 -- [-740.621] (-737.227) (-738.658) (-744.596) * (-743.577) [-739.748] (-747.437) (-738.350) -- 0:00:40
258000 -- (-740.166) (-740.719) [-740.995] (-744.808) * (-737.414) (-741.088) (-738.099) [-737.737] -- 0:00:40
258500 -- (-740.659) (-740.967) [-740.198] (-744.776) * [-738.055] (-739.174) (-738.673) (-742.974) -- 0:00:40
259000 -- (-738.113) [-738.417] (-738.748) (-739.776) * (-737.550) (-738.064) [-739.524] (-743.979) -- 0:00:40
259500 -- (-741.723) [-740.524] (-738.419) (-745.490) * [-741.153] (-741.305) (-738.425) (-742.204) -- 0:00:39
260000 -- (-741.151) (-739.306) (-739.348) [-738.578] * (-739.604) (-739.643) [-737.362] (-738.775) -- 0:00:39
Average standard deviation of split frequencies: 0.015914
260500 -- (-737.217) [-738.760] (-745.512) (-739.586) * (-739.875) (-737.671) (-738.265) [-737.687] -- 0:00:39
261000 -- (-738.057) [-740.165] (-737.933) (-740.742) * (-740.491) (-742.821) (-740.025) [-738.633] -- 0:00:42
261500 -- [-738.113] (-738.642) (-739.405) (-740.685) * [-741.075] (-738.401) (-737.626) (-740.049) -- 0:00:42
262000 -- (-738.345) (-738.282) [-738.833] (-740.141) * (-740.538) (-739.724) (-738.404) [-737.219] -- 0:00:42
262500 -- (-742.073) (-738.347) [-737.745] (-745.682) * (-737.636) [-738.379] (-745.338) (-737.263) -- 0:00:42
263000 -- (-738.590) (-739.301) (-741.992) [-743.787] * [-737.654] (-738.513) (-743.656) (-738.979) -- 0:00:42
263500 -- (-737.857) [-739.661] (-744.261) (-737.744) * (-737.688) (-740.265) (-742.678) [-747.625] -- 0:00:41
264000 -- (-738.203) (-738.806) [-738.065] (-737.690) * (-737.459) (-743.219) [-742.961] (-739.184) -- 0:00:41
264500 -- (-742.190) (-738.538) (-737.624) [-737.840] * (-738.595) (-738.489) [-737.296] (-738.245) -- 0:00:41
265000 -- (-740.255) (-740.158) (-738.944) [-738.831] * (-741.134) (-738.504) (-737.477) [-741.590] -- 0:00:41
Average standard deviation of split frequencies: 0.016659
265500 -- (-738.695) [-739.394] (-738.824) (-739.787) * (-741.919) (-740.972) (-740.242) [-739.467] -- 0:00:41
266000 -- [-738.159] (-738.826) (-738.402) (-739.548) * (-738.714) [-741.451] (-737.839) (-739.757) -- 0:00:41
266500 -- [-737.485] (-743.582) (-741.131) (-740.891) * [-742.004] (-737.789) (-738.465) (-739.643) -- 0:00:41
267000 -- [-739.360] (-739.505) (-739.189) (-739.094) * [-737.879] (-740.491) (-738.924) (-738.959) -- 0:00:41
267500 -- (-739.313) (-739.490) (-740.233) [-738.366] * [-739.344] (-740.067) (-739.928) (-738.894) -- 0:00:41
268000 -- [-741.436] (-737.804) (-739.885) (-739.169) * (-741.386) (-739.920) (-741.253) [-737.985] -- 0:00:40
268500 -- (-738.356) (-740.177) (-739.914) [-739.512] * (-738.511) (-739.373) [-739.783] (-741.719) -- 0:00:40
269000 -- (-737.536) (-740.200) [-737.960] (-740.372) * (-737.469) [-739.523] (-741.275) (-739.041) -- 0:00:40
269500 -- (-738.551) (-740.637) [-739.278] (-739.458) * [-737.390] (-737.935) (-740.830) (-738.708) -- 0:00:40
270000 -- (-737.184) (-737.157) [-741.530] (-740.390) * (-738.208) [-737.905] (-737.770) (-743.099) -- 0:00:40
Average standard deviation of split frequencies: 0.017416
270500 -- (-739.660) (-740.411) (-740.705) [-739.263] * (-738.123) (-740.341) (-739.454) [-738.500] -- 0:00:40
271000 -- (-740.531) [-740.981] (-739.023) (-742.751) * [-737.100] (-740.617) (-739.990) (-744.563) -- 0:00:40
271500 -- [-739.099] (-743.669) (-743.015) (-738.761) * [-737.527] (-741.947) (-739.610) (-737.334) -- 0:00:40
272000 -- [-739.834] (-738.849) (-738.276) (-742.341) * (-739.620) (-740.739) [-738.569] (-738.672) -- 0:00:40
272500 -- [-737.640] (-740.150) (-739.337) (-737.370) * [-737.082] (-739.911) (-737.968) (-738.021) -- 0:00:40
273000 -- (-737.304) (-739.924) [-740.633] (-738.900) * (-739.020) (-738.186) [-738.616] (-741.343) -- 0:00:39
273500 -- [-741.201] (-740.061) (-740.652) (-738.583) * [-737.438] (-737.950) (-738.220) (-737.825) -- 0:00:39
274000 -- (-738.637) (-739.869) (-741.887) [-739.019] * (-739.274) (-738.997) (-737.622) [-738.679] -- 0:00:39
274500 -- (-740.361) [-741.935] (-740.538) (-739.018) * (-738.426) [-737.918] (-742.450) (-741.142) -- 0:00:39
275000 -- (-737.809) (-738.512) (-740.145) [-738.351] * (-739.996) (-738.611) (-744.669) [-740.624] -- 0:00:39
Average standard deviation of split frequencies: 0.018105
275500 -- (-737.874) [-740.954] (-740.399) (-741.827) * (-742.404) [-738.753] (-739.639) (-740.780) -- 0:00:39
276000 -- (-741.315) [-739.641] (-738.005) (-739.740) * (-741.911) (-738.012) [-741.182] (-738.763) -- 0:00:39
276500 -- (-737.676) (-739.403) (-741.196) [-740.754] * [-739.826] (-738.473) (-739.952) (-737.952) -- 0:00:39
277000 -- (-739.557) [-743.110] (-741.196) (-739.012) * (-741.560) (-738.695) (-739.637) [-737.533] -- 0:00:39
277500 -- (-743.664) [-739.297] (-743.612) (-745.373) * (-740.456) (-738.641) (-738.572) [-738.064] -- 0:00:39
278000 -- (-740.995) [-740.591] (-739.656) (-739.125) * (-742.199) [-738.196] (-742.085) (-740.962) -- 0:00:38
278500 -- (-738.122) (-740.673) [-744.916] (-742.466) * (-740.616) (-737.682) (-738.896) [-743.943] -- 0:00:38
279000 -- (-738.379) (-743.733) [-742.355] (-738.352) * (-738.642) (-742.476) [-739.185] (-737.518) -- 0:00:38
279500 -- (-738.536) (-737.932) (-741.695) [-738.643] * (-738.622) (-737.409) [-738.278] (-740.106) -- 0:00:41
280000 -- (-737.823) (-737.718) (-739.438) [-737.299] * (-738.199) [-737.494] (-740.232) (-737.358) -- 0:00:41
Average standard deviation of split frequencies: 0.018140
280500 -- (-742.406) (-740.322) [-737.371] (-741.648) * (-740.145) (-741.395) [-739.901] (-736.954) -- 0:00:41
281000 -- (-740.144) (-739.367) (-740.750) [-742.766] * [-742.119] (-740.246) (-743.115) (-737.391) -- 0:00:40
281500 -- (-737.152) [-742.218] (-742.465) (-738.899) * (-738.300) (-737.510) [-748.545] (-739.166) -- 0:00:40
282000 -- (-738.492) [-741.883] (-739.709) (-740.670) * (-737.643) [-737.063] (-739.448) (-741.681) -- 0:00:40
282500 -- [-736.986] (-737.368) (-743.066) (-739.124) * (-738.058) (-737.064) (-739.603) [-738.056] -- 0:00:40
283000 -- (-740.349) (-739.078) (-742.057) [-739.286] * (-742.037) (-739.898) (-739.727) [-739.909] -- 0:00:40
283500 -- (-740.531) (-738.551) (-741.288) [-740.507] * (-738.709) (-739.473) (-740.209) [-737.717] -- 0:00:40
284000 -- (-741.307) [-738.709] (-739.331) (-739.647) * [-737.739] (-739.351) (-738.514) (-738.536) -- 0:00:40
284500 -- [-739.684] (-738.525) (-739.839) (-740.265) * (-738.682) (-738.551) (-738.393) [-741.219] -- 0:00:40
285000 -- (-741.858) (-741.769) [-738.623] (-740.338) * (-738.740) (-738.940) (-741.558) [-739.257] -- 0:00:40
Average standard deviation of split frequencies: 0.017801
285500 -- (-739.036) (-738.924) [-741.227] (-740.539) * (-739.475) (-738.984) [-738.750] (-737.748) -- 0:00:40
286000 -- (-738.637) [-739.522] (-737.521) (-740.954) * (-737.776) (-738.015) [-737.853] (-738.006) -- 0:00:39
286500 -- (-741.379) [-738.487] (-738.193) (-743.362) * (-737.315) (-738.262) [-737.885] (-738.110) -- 0:00:39
287000 -- (-737.780) [-740.155] (-737.864) (-740.185) * (-739.870) [-739.166] (-738.167) (-739.877) -- 0:00:39
287500 -- (-738.998) (-738.107) [-738.473] (-737.548) * (-737.063) (-737.793) [-739.041] (-740.922) -- 0:00:39
288000 -- [-737.578] (-739.815) (-738.258) (-737.557) * [-739.228] (-739.319) (-742.442) (-739.603) -- 0:00:39
288500 -- [-737.732] (-743.702) (-737.870) (-737.683) * (-749.017) (-742.231) [-738.237] (-738.786) -- 0:00:39
289000 -- (-739.173) [-739.266] (-740.271) (-741.045) * (-745.298) (-739.514) (-738.468) [-741.096] -- 0:00:39
289500 -- [-739.428] (-743.431) (-741.197) (-742.059) * (-738.068) (-738.899) [-740.333] (-737.703) -- 0:00:39
290000 -- [-737.373] (-738.279) (-740.919) (-741.003) * (-740.369) [-738.448] (-738.587) (-740.630) -- 0:00:39
Average standard deviation of split frequencies: 0.019786
290500 -- (-740.504) (-736.793) [-739.727] (-740.837) * (-737.644) (-740.579) [-740.024] (-739.374) -- 0:00:39
291000 -- (-739.339) (-737.297) [-739.001] (-739.448) * (-737.920) (-741.130) (-739.945) [-739.402] -- 0:00:38
291500 -- (-739.313) (-740.742) [-737.462] (-738.741) * [-739.050] (-737.447) (-739.415) (-739.623) -- 0:00:38
292000 -- (-737.683) (-740.578) [-741.669] (-738.552) * (-738.299) (-736.888) (-740.236) [-737.419] -- 0:00:38
292500 -- (-740.514) [-739.744] (-741.549) (-737.559) * (-738.891) [-737.107] (-738.652) (-737.273) -- 0:00:38
293000 -- (-742.432) (-738.866) [-738.493] (-737.677) * (-738.848) (-739.955) (-741.161) [-742.148] -- 0:00:38
293500 -- (-740.699) (-737.758) [-740.505] (-737.158) * (-738.770) (-741.956) [-738.231] (-737.909) -- 0:00:38
294000 -- (-739.203) (-738.046) [-737.723] (-738.829) * [-737.899] (-738.699) (-737.798) (-737.766) -- 0:00:38
294500 -- [-744.786] (-742.071) (-739.739) (-737.793) * [-738.731] (-740.424) (-738.029) (-738.775) -- 0:00:38
295000 -- (-740.762) (-740.552) (-737.548) [-737.405] * (-738.951) [-737.923] (-737.499) (-738.782) -- 0:00:38
Average standard deviation of split frequencies: 0.018792
295500 -- [-739.751] (-739.713) (-743.282) (-739.453) * (-737.216) [-737.496] (-737.137) (-737.211) -- 0:00:38
296000 -- (-741.289) (-741.940) (-739.902) [-738.214] * (-738.591) [-738.624] (-739.448) (-737.897) -- 0:00:38
296500 -- (-738.678) (-738.544) [-737.502] (-737.037) * (-742.922) (-740.908) [-741.371] (-746.027) -- 0:00:37
297000 -- (-738.643) (-740.684) [-737.954] (-737.102) * [-740.311] (-739.909) (-741.465) (-744.558) -- 0:00:37
297500 -- (-742.836) (-739.943) (-739.584) [-737.548] * (-737.748) (-738.157) [-739.480] (-738.497) -- 0:00:37
298000 -- (-740.441) (-739.226) (-737.868) [-741.196] * (-737.052) (-740.156) [-739.122] (-741.061) -- 0:00:40
298500 -- (-738.755) (-741.627) [-738.220] (-738.628) * (-738.041) (-741.423) (-740.626) [-740.904] -- 0:00:39
299000 -- (-737.635) [-738.646] (-740.866) (-738.929) * [-739.579] (-740.380) (-738.356) (-740.386) -- 0:00:39
299500 -- (-744.712) (-739.917) [-738.357] (-739.228) * [-739.137] (-740.622) (-737.748) (-739.039) -- 0:00:39
300000 -- [-738.422] (-738.914) (-738.360) (-738.501) * (-739.349) [-737.743] (-737.612) (-737.829) -- 0:00:39
Average standard deviation of split frequencies: 0.017560
300500 -- (-740.067) (-738.666) (-738.299) [-738.768] * (-737.464) [-738.857] (-738.058) (-738.287) -- 0:00:39
301000 -- (-738.796) (-737.985) (-738.386) [-744.931] * (-738.922) (-738.761) [-737.156] (-738.408) -- 0:00:39
301500 -- (-738.297) (-743.623) (-740.456) [-741.001] * (-744.730) (-739.182) [-737.024] (-738.128) -- 0:00:39
302000 -- (-737.534) (-742.376) [-740.774] (-740.548) * [-742.790] (-738.741) (-736.978) (-740.512) -- 0:00:39
302500 -- [-737.267] (-740.167) (-741.545) (-738.828) * [-738.334] (-738.111) (-737.861) (-739.112) -- 0:00:39
303000 -- (-738.541) (-738.751) [-739.590] (-738.956) * (-739.688) [-742.647] (-741.131) (-740.264) -- 0:00:39
303500 -- (-738.942) (-739.244) [-740.901] (-737.578) * [-738.906] (-741.330) (-740.014) (-739.109) -- 0:00:39
304000 -- (-736.797) [-737.951] (-743.761) (-737.195) * [-738.660] (-739.080) (-738.647) (-742.125) -- 0:00:38
304500 -- [-736.795] (-740.621) (-742.067) (-737.858) * (-742.384) [-737.425] (-739.810) (-740.536) -- 0:00:38
305000 -- [-738.653] (-744.678) (-742.337) (-748.900) * (-738.206) (-738.816) [-739.978] (-739.184) -- 0:00:38
Average standard deviation of split frequencies: 0.019719
305500 -- (-738.948) (-740.688) [-739.007] (-741.276) * (-738.922) [-737.924] (-741.508) (-739.894) -- 0:00:38
306000 -- (-742.838) (-740.147) (-738.575) [-742.781] * (-740.398) (-737.386) (-739.782) [-741.328] -- 0:00:38
306500 -- (-742.154) (-737.917) (-738.634) [-741.313] * (-740.365) [-738.272] (-739.308) (-743.354) -- 0:00:38
307000 -- [-738.606] (-741.720) (-740.013) (-737.693) * [-737.498] (-737.592) (-738.492) (-738.887) -- 0:00:38
307500 -- [-739.555] (-738.039) (-738.049) (-737.720) * (-737.411) [-737.212] (-740.834) (-739.549) -- 0:00:38
308000 -- [-738.511] (-738.905) (-738.344) (-738.174) * (-738.515) [-739.653] (-737.853) (-738.840) -- 0:00:38
308500 -- (-737.957) (-741.391) [-741.908] (-738.564) * (-738.453) (-742.182) (-738.016) [-738.841] -- 0:00:38
309000 -- [-740.236] (-740.568) (-738.905) (-738.432) * (-741.878) (-739.348) [-738.206] (-741.338) -- 0:00:38
309500 -- (-739.529) [-738.500] (-741.111) (-738.746) * (-739.903) [-739.840] (-742.019) (-742.589) -- 0:00:37
310000 -- (-738.622) (-740.490) (-740.703) [-739.249] * [-739.329] (-743.196) (-742.515) (-738.394) -- 0:00:37
Average standard deviation of split frequencies: 0.018816
310500 -- (-739.287) (-742.612) (-743.109) [-741.668] * [-740.828] (-739.213) (-737.400) (-738.680) -- 0:00:37
311000 -- (-739.136) (-737.313) (-737.483) [-741.608] * (-741.122) [-740.787] (-739.111) (-741.123) -- 0:00:37
311500 -- (-740.077) (-741.183) [-738.521] (-741.438) * (-740.146) [-737.874] (-738.896) (-738.790) -- 0:00:37
312000 -- [-740.664] (-741.002) (-741.088) (-738.808) * (-738.692) (-737.938) (-737.650) [-739.040] -- 0:00:37
312500 -- (-737.762) [-738.378] (-738.654) (-742.507) * (-738.617) (-739.509) (-739.765) [-740.493] -- 0:00:37
313000 -- (-739.271) [-739.458] (-739.922) (-739.953) * (-741.867) [-739.308] (-737.606) (-738.034) -- 0:00:37
313500 -- (-738.095) [-738.261] (-743.562) (-740.801) * (-738.907) (-739.488) [-737.030] (-740.199) -- 0:00:37
314000 -- (-738.053) [-737.216] (-737.135) (-739.869) * [-738.638] (-737.951) (-737.029) (-737.554) -- 0:00:37
314500 -- (-742.359) (-737.543) [-741.223] (-739.847) * [-737.124] (-740.272) (-738.334) (-738.774) -- 0:00:37
315000 -- [-738.766] (-738.217) (-740.150) (-739.770) * (-739.032) (-739.996) [-739.509] (-740.056) -- 0:00:36
Average standard deviation of split frequencies: 0.019095
315500 -- (-742.164) [-739.889] (-739.309) (-741.660) * (-738.128) (-737.280) (-741.927) [-739.769] -- 0:00:36
316000 -- [-738.266] (-742.914) (-737.418) (-737.646) * (-736.865) [-737.343] (-743.116) (-740.705) -- 0:00:36
316500 -- [-738.986] (-738.838) (-739.521) (-738.534) * (-738.279) (-737.626) (-742.281) [-741.601] -- 0:00:38
317000 -- (-738.162) (-741.179) [-738.475] (-738.301) * (-737.119) [-739.700] (-739.373) (-741.967) -- 0:00:38
317500 -- [-738.913] (-741.278) (-740.623) (-738.838) * (-739.652) (-738.226) [-737.663] (-740.072) -- 0:00:38
318000 -- (-739.794) [-737.617] (-740.392) (-738.121) * (-738.093) (-744.444) [-742.454] (-739.359) -- 0:00:38
318500 -- [-738.352] (-737.262) (-741.632) (-739.201) * (-739.778) (-743.357) [-738.195] (-742.101) -- 0:00:38
319000 -- (-743.750) (-742.572) (-739.452) [-738.726] * (-739.473) [-737.970] (-739.111) (-737.890) -- 0:00:38
319500 -- [-741.764] (-739.097) (-738.010) (-738.954) * (-737.925) (-740.203) (-748.597) [-738.693] -- 0:00:38
320000 -- [-738.220] (-739.546) (-741.958) (-738.909) * (-740.600) [-740.441] (-739.694) (-740.140) -- 0:00:38
Average standard deviation of split frequencies: 0.017935
320500 -- (-738.804) (-738.880) (-739.635) [-743.412] * [-739.542] (-738.549) (-738.740) (-740.334) -- 0:00:38
321000 -- (-739.902) (-741.997) (-745.409) [-737.430] * [-737.716] (-740.307) (-738.000) (-739.754) -- 0:00:38
321500 -- (-741.987) (-737.800) (-746.546) [-742.315] * (-737.735) [-738.680] (-740.845) (-744.243) -- 0:00:37
322000 -- (-741.078) [-739.316] (-745.688) (-740.133) * (-738.798) [-737.172] (-739.111) (-740.944) -- 0:00:37
322500 -- (-738.329) (-739.202) (-741.891) [-738.580] * (-738.216) (-740.913) [-737.950] (-737.856) -- 0:00:37
323000 -- (-737.837) (-739.862) [-742.759] (-741.402) * (-738.214) (-739.805) [-737.565] (-737.536) -- 0:00:37
323500 -- [-736.978] (-740.385) (-738.085) (-738.086) * [-737.204] (-738.945) (-739.125) (-737.049) -- 0:00:37
324000 -- [-738.757] (-737.704) (-739.260) (-740.749) * [-738.906] (-739.514) (-745.241) (-739.562) -- 0:00:37
324500 -- (-737.218) (-737.719) (-740.005) [-742.486] * [-749.730] (-739.679) (-742.099) (-738.170) -- 0:00:37
325000 -- (-741.397) (-737.910) (-743.575) [-743.088] * (-745.179) (-737.906) (-743.899) [-739.837] -- 0:00:37
Average standard deviation of split frequencies: 0.016195
325500 -- (-739.795) (-738.252) [-738.736] (-741.296) * (-743.102) (-741.180) [-738.791] (-742.138) -- 0:00:37
326000 -- (-740.059) (-741.316) [-740.926] (-740.198) * (-738.598) (-743.791) (-738.485) [-738.625] -- 0:00:37
326500 -- (-739.988) (-744.563) (-742.331) [-740.008] * (-737.388) (-742.141) (-742.934) [-738.225] -- 0:00:37
327000 -- (-737.085) (-741.067) (-738.415) [-738.513] * (-737.457) (-738.644) (-738.378) [-737.783] -- 0:00:37
327500 -- (-738.977) (-738.202) [-738.729] (-741.005) * [-739.268] (-739.021) (-737.250) (-738.122) -- 0:00:36
328000 -- (-738.101) (-738.548) (-739.011) [-738.413] * (-738.421) (-740.130) [-740.332] (-741.690) -- 0:00:36
328500 -- (-737.004) [-740.167] (-741.394) (-742.741) * (-738.990) (-738.377) (-738.316) [-737.921] -- 0:00:36
329000 -- (-738.787) [-739.162] (-741.892) (-739.022) * [-737.393] (-740.971) (-737.971) (-739.615) -- 0:00:36
329500 -- [-738.983] (-739.720) (-741.230) (-738.260) * (-737.835) [-738.561] (-738.101) (-739.089) -- 0:00:36
330000 -- (-741.450) (-738.580) [-737.919] (-737.547) * (-737.403) (-738.510) (-738.053) [-737.994] -- 0:00:36
Average standard deviation of split frequencies: 0.015397
330500 -- (-741.298) (-740.250) [-736.953] (-737.548) * (-737.376) (-737.339) [-737.806] (-739.151) -- 0:00:36
331000 -- (-738.530) [-743.249] (-743.129) (-737.302) * (-738.825) [-737.800] (-738.594) (-741.917) -- 0:00:36
331500 -- (-738.513) [-739.241] (-740.677) (-737.329) * (-737.975) (-738.028) (-738.534) [-738.098] -- 0:00:36
332000 -- [-742.259] (-739.499) (-738.633) (-740.699) * (-738.166) [-739.354] (-738.785) (-738.740) -- 0:00:36
332500 -- (-739.139) (-737.803) (-738.488) [-738.282] * [-741.759] (-737.792) (-738.801) (-739.169) -- 0:00:36
333000 -- (-739.200) (-737.915) [-737.997] (-739.775) * [-738.063] (-743.741) (-740.996) (-744.578) -- 0:00:36
333500 -- [-738.984] (-740.520) (-738.633) (-738.233) * (-740.171) [-737.698] (-740.210) (-746.024) -- 0:00:35
334000 -- (-739.941) [-740.302] (-738.808) (-742.257) * [-739.059] (-739.760) (-741.705) (-741.421) -- 0:00:35
334500 -- (-741.085) (-738.422) (-741.892) [-740.124] * [-739.629] (-739.570) (-738.910) (-739.388) -- 0:00:35
335000 -- (-737.656) [-741.158] (-741.088) (-740.291) * (-739.858) (-740.256) (-737.236) [-738.747] -- 0:00:37
Average standard deviation of split frequencies: 0.016555
335500 -- [-739.449] (-742.331) (-739.271) (-739.294) * [-739.096] (-740.373) (-739.868) (-739.759) -- 0:00:37
336000 -- (-743.278) (-737.988) [-738.505] (-740.495) * [-739.320] (-741.096) (-737.555) (-739.071) -- 0:00:37
336500 -- (-737.689) [-737.247] (-738.159) (-739.791) * (-741.251) [-740.793] (-741.536) (-739.483) -- 0:00:37
337000 -- (-737.504) (-737.864) [-739.315] (-740.432) * (-738.800) (-737.941) (-745.038) [-737.944] -- 0:00:37
337500 -- [-738.876] (-737.710) (-740.168) (-737.906) * (-740.914) (-738.519) (-740.605) [-737.592] -- 0:00:37
338000 -- [-741.730] (-740.384) (-739.782) (-738.263) * (-739.641) (-738.622) (-739.141) [-737.568] -- 0:00:37
338500 -- (-742.247) (-739.734) (-740.038) [-739.694] * [-741.131] (-738.342) (-737.450) (-737.159) -- 0:00:37
339000 -- (-739.722) (-742.866) (-739.661) [-738.768] * (-738.387) (-738.070) [-739.174] (-738.678) -- 0:00:37
339500 -- (-737.399) (-742.222) (-740.124) [-738.079] * (-737.310) (-741.167) (-738.543) [-738.590] -- 0:00:36
340000 -- (-737.449) (-738.275) [-738.537] (-740.042) * (-737.745) (-740.980) (-738.577) [-740.224] -- 0:00:36
Average standard deviation of split frequencies: 0.016882
340500 -- (-738.225) [-737.414] (-739.373) (-740.995) * (-737.981) (-738.055) (-738.518) [-738.232] -- 0:00:36
341000 -- (-739.024) [-737.374] (-739.182) (-739.124) * (-742.649) (-738.308) [-739.094] (-737.776) -- 0:00:36
341500 -- [-738.422] (-739.003) (-739.754) (-742.514) * (-743.830) (-739.365) [-738.755] (-737.859) -- 0:00:36
342000 -- [-739.241] (-739.547) (-742.754) (-740.668) * (-739.910) (-738.889) [-738.277] (-739.383) -- 0:00:36
342500 -- (-742.479) (-739.506) (-739.688) [-741.763] * (-741.963) [-738.228] (-738.246) (-740.071) -- 0:00:36
343000 -- (-740.752) [-738.043] (-743.975) (-741.230) * (-738.289) (-741.155) (-740.832) [-737.884] -- 0:00:36
343500 -- (-737.110) (-737.816) [-742.450] (-739.834) * (-738.337) (-739.340) [-741.490] (-741.387) -- 0:00:36
344000 -- (-737.254) (-738.526) (-740.491) [-739.940] * (-738.168) [-740.579] (-739.055) (-740.238) -- 0:00:36
344500 -- (-737.602) (-738.315) (-740.601) [-739.520] * [-737.925] (-740.287) (-737.874) (-740.868) -- 0:00:36
345000 -- [-738.064] (-738.759) (-740.671) (-738.605) * (-738.640) (-742.209) [-739.281] (-744.318) -- 0:00:36
Average standard deviation of split frequencies: 0.016622
345500 -- (-739.920) (-744.519) (-740.059) [-737.781] * (-737.368) (-741.106) [-738.186] (-740.219) -- 0:00:35
346000 -- (-739.001) (-738.462) [-738.505] (-739.937) * [-741.767] (-737.659) (-739.170) (-740.164) -- 0:00:35
346500 -- (-739.396) (-740.277) [-739.020] (-738.464) * [-738.069] (-738.078) (-737.649) (-738.279) -- 0:00:35
347000 -- (-749.289) [-739.863] (-737.259) (-747.869) * (-739.937) (-738.067) (-742.302) [-738.553] -- 0:00:35
347500 -- (-738.891) (-740.547) [-737.482] (-740.038) * (-740.099) [-737.541] (-740.022) (-740.251) -- 0:00:35
348000 -- (-739.890) (-738.873) (-737.880) [-737.702] * [-739.016] (-738.436) (-738.032) (-739.485) -- 0:00:35
348500 -- [-738.475] (-738.409) (-739.869) (-739.805) * (-737.927) [-738.493] (-742.745) (-738.701) -- 0:00:35
349000 -- (-740.160) (-739.001) [-737.288] (-742.295) * (-740.804) [-737.336] (-739.578) (-738.354) -- 0:00:35
349500 -- (-742.049) [-741.272] (-739.383) (-737.689) * (-741.438) [-737.640] (-739.052) (-738.428) -- 0:00:35
350000 -- (-742.732) [-737.701] (-737.487) (-737.926) * (-740.346) [-737.556] (-738.607) (-737.827) -- 0:00:35
Average standard deviation of split frequencies: 0.018014
350500 -- [-737.455] (-737.623) (-739.882) (-737.903) * (-742.176) [-737.615] (-739.000) (-738.465) -- 0:00:35
351000 -- [-739.940] (-739.975) (-738.527) (-743.424) * (-738.221) [-737.243] (-738.340) (-739.084) -- 0:00:35
351500 -- (-737.892) (-741.897) (-740.449) [-737.383] * [-739.315] (-737.266) (-739.558) (-740.789) -- 0:00:35
352000 -- [-738.022] (-743.897) (-741.357) (-740.542) * (-739.454) (-737.374) [-738.949] (-738.327) -- 0:00:34
352500 -- (-738.275) (-738.747) [-738.663] (-740.590) * [-737.737] (-738.701) (-737.877) (-738.748) -- 0:00:34
353000 -- (-739.019) (-739.842) (-739.284) [-740.397] * (-740.399) [-738.478] (-741.506) (-738.901) -- 0:00:34
353500 -- (-738.662) (-741.758) (-741.993) [-739.323] * [-739.808] (-739.970) (-741.939) (-737.687) -- 0:00:36
354000 -- (-738.186) (-743.715) (-742.117) [-739.359] * (-745.489) [-737.971] (-739.853) (-737.693) -- 0:00:36
354500 -- (-742.664) (-738.102) (-739.923) [-738.436] * [-737.738] (-738.162) (-738.116) (-738.804) -- 0:00:36
355000 -- (-739.405) [-739.009] (-742.573) (-740.190) * (-738.104) (-741.379) [-737.514] (-739.907) -- 0:00:36
Average standard deviation of split frequencies: 0.016685
355500 -- (-740.296) (-741.073) [-739.953] (-739.433) * (-738.103) (-738.299) [-740.292] (-739.851) -- 0:00:36
356000 -- (-738.426) (-741.758) (-741.934) [-737.739] * (-738.861) (-745.528) (-739.765) [-738.096] -- 0:00:36
356500 -- [-739.671] (-739.461) (-742.184) (-739.415) * (-740.233) [-738.960] (-738.222) (-743.897) -- 0:00:36
357000 -- (-737.764) (-738.352) (-740.951) [-742.380] * (-742.261) [-739.574] (-738.958) (-738.328) -- 0:00:36
357500 -- (-739.487) (-742.405) [-738.705] (-740.796) * [-739.152] (-743.043) (-738.860) (-737.027) -- 0:00:35
358000 -- [-739.129] (-741.187) (-740.524) (-737.077) * (-738.661) [-737.016] (-740.140) (-739.427) -- 0:00:35
358500 -- (-741.204) (-739.912) (-738.570) [-740.233] * (-739.300) [-737.057] (-739.271) (-739.251) -- 0:00:35
359000 -- (-740.506) [-738.621] (-738.079) (-738.571) * [-739.166] (-739.034) (-737.482) (-738.001) -- 0:00:35
359500 -- (-743.583) [-738.504] (-737.307) (-739.532) * (-741.512) (-739.519) (-737.776) [-737.792] -- 0:00:35
360000 -- (-740.436) [-739.549] (-743.453) (-739.292) * (-740.276) (-739.730) [-739.847] (-737.113) -- 0:00:35
Average standard deviation of split frequencies: 0.015946
360500 -- (-740.254) (-737.647) (-738.967) [-739.562] * [-737.748] (-739.968) (-742.672) (-742.827) -- 0:00:35
361000 -- [-739.768] (-737.599) (-738.051) (-742.037) * (-740.664) (-739.256) [-740.010] (-741.526) -- 0:00:35
361500 -- (-751.366) (-742.560) [-737.656] (-737.871) * (-737.896) [-738.164] (-737.537) (-738.275) -- 0:00:35
362000 -- [-744.958] (-738.831) (-746.857) (-737.800) * [-738.900] (-740.616) (-737.752) (-737.402) -- 0:00:35
362500 -- (-739.139) (-738.373) (-741.253) [-741.495] * (-745.796) (-739.729) [-738.100] (-741.607) -- 0:00:35
363000 -- (-742.942) (-738.114) (-740.054) [-738.919] * (-738.305) [-738.171] (-741.425) (-738.899) -- 0:00:35
363500 -- (-737.571) [-738.581] (-745.399) (-737.696) * (-738.175) (-738.755) (-741.247) [-737.607] -- 0:00:35
364000 -- (-737.824) (-738.741) (-741.375) [-738.715] * [-739.017] (-742.702) (-739.667) (-738.902) -- 0:00:34
364500 -- [-738.870] (-738.086) (-737.691) (-739.049) * [-737.591] (-739.067) (-741.198) (-742.861) -- 0:00:34
365000 -- (-738.993) (-740.816) [-736.984] (-739.332) * [-737.543] (-739.927) (-739.656) (-743.060) -- 0:00:34
Average standard deviation of split frequencies: 0.015198
365500 -- (-737.999) (-740.605) [-737.811] (-737.751) * (-744.182) (-738.279) [-738.273] (-746.022) -- 0:00:34
366000 -- [-737.505] (-740.580) (-738.243) (-741.903) * (-739.150) (-738.573) (-741.124) [-741.220] -- 0:00:34
366500 -- (-739.950) (-742.946) [-740.653] (-742.374) * [-738.230] (-737.835) (-742.170) (-739.199) -- 0:00:34
367000 -- [-739.516] (-740.928) (-738.967) (-740.249) * (-738.525) (-738.855) [-740.417] (-739.323) -- 0:00:34
367500 -- (-738.148) (-738.859) [-739.693] (-737.745) * [-739.310] (-739.600) (-737.220) (-741.508) -- 0:00:34
368000 -- (-739.409) (-739.340) (-738.583) [-738.656] * (-739.483) [-737.653] (-741.438) (-740.452) -- 0:00:34
368500 -- (-739.123) (-739.056) [-738.637] (-738.659) * (-737.330) [-737.786] (-738.826) (-739.159) -- 0:00:34
369000 -- (-738.208) [-739.459] (-739.672) (-738.734) * (-739.016) (-738.633) [-739.934] (-739.297) -- 0:00:34
369500 -- (-737.415) [-738.857] (-741.713) (-738.272) * (-740.637) (-740.586) (-738.819) [-738.162] -- 0:00:34
370000 -- (-739.418) (-742.983) [-741.730] (-737.345) * (-739.586) [-740.596] (-740.412) (-738.127) -- 0:00:34
Average standard deviation of split frequencies: 0.014753
370500 -- (-741.059) (-743.246) [-740.323] (-747.707) * (-739.272) (-737.580) (-740.299) [-737.343] -- 0:00:33
371000 -- (-738.162) [-738.439] (-743.818) (-744.400) * [-738.248] (-737.341) (-739.494) (-738.309) -- 0:00:33
371500 -- (-737.531) (-739.420) [-737.973] (-737.339) * (-738.181) (-737.203) [-739.869] (-744.407) -- 0:00:33
372000 -- (-737.484) [-739.538] (-740.081) (-741.026) * (-739.159) [-738.045] (-738.302) (-738.228) -- 0:00:33
372500 -- (-737.600) (-738.582) (-739.248) [-740.455] * (-738.409) (-740.077) [-739.532] (-738.202) -- 0:00:35
373000 -- (-737.487) [-740.405] (-739.802) (-740.370) * [-741.046] (-742.572) (-741.176) (-739.041) -- 0:00:35
373500 -- (-737.639) [-739.356] (-743.658) (-740.980) * (-739.640) (-737.168) (-740.284) [-739.483] -- 0:00:35
374000 -- [-738.231] (-739.992) (-743.783) (-743.589) * (-741.594) [-737.809] (-737.934) (-738.741) -- 0:00:35
374500 -- (-739.193) (-740.610) [-738.351] (-738.208) * (-737.679) (-741.621) (-738.446) [-738.366] -- 0:00:35
375000 -- (-737.965) [-741.168] (-738.651) (-742.218) * (-738.693) (-741.152) [-737.266] (-739.317) -- 0:00:35
Average standard deviation of split frequencies: 0.015546
375500 -- [-739.396] (-737.686) (-740.941) (-740.184) * [-738.639] (-742.953) (-738.297) (-738.575) -- 0:00:34
376000 -- [-743.702] (-738.663) (-739.567) (-742.948) * (-743.639) [-741.353] (-740.605) (-739.336) -- 0:00:34
376500 -- (-741.182) (-739.731) [-737.942] (-741.043) * (-737.321) [-739.339] (-742.641) (-747.736) -- 0:00:34
377000 -- (-738.058) (-744.757) (-737.671) [-741.010] * [-738.913] (-741.790) (-738.616) (-742.131) -- 0:00:34
377500 -- (-739.967) (-740.483) (-737.830) [-739.324] * [-738.046] (-737.678) (-737.430) (-740.983) -- 0:00:34
378000 -- [-741.560] (-744.734) (-739.601) (-737.487) * (-738.169) (-737.038) (-741.427) [-738.051] -- 0:00:34
378500 -- (-738.656) (-737.484) [-738.292] (-739.202) * [-742.464] (-742.144) (-738.504) (-738.649) -- 0:00:34
379000 -- (-742.497) (-737.335) [-737.593] (-740.312) * (-742.198) (-741.023) [-739.427] (-741.438) -- 0:00:34
379500 -- (-739.088) [-737.808] (-741.377) (-743.664) * (-739.187) [-738.838] (-741.480) (-737.398) -- 0:00:34
380000 -- (-738.264) (-737.321) [-740.451] (-741.687) * (-738.487) [-742.265] (-741.279) (-736.890) -- 0:00:34
Average standard deviation of split frequencies: 0.014613
380500 -- (-739.282) (-737.251) (-741.932) [-743.018] * [-739.094] (-737.844) (-741.279) (-740.088) -- 0:00:34
381000 -- (-738.328) (-737.096) (-737.497) [-738.830] * (-737.281) (-745.053) (-742.010) [-741.037] -- 0:00:34
381500 -- (-739.549) (-739.073) [-741.117] (-739.698) * (-737.871) (-741.303) (-741.365) [-737.968] -- 0:00:34
382000 -- [-739.145] (-737.361) (-738.596) (-743.268) * (-737.774) (-738.747) (-740.910) [-738.445] -- 0:00:33
382500 -- (-739.940) [-737.674] (-738.938) (-741.554) * (-738.585) (-738.022) (-740.104) [-738.718] -- 0:00:33
383000 -- (-738.985) (-743.573) (-740.216) [-743.613] * (-738.392) [-739.609] (-738.583) (-738.265) -- 0:00:33
383500 -- [-739.203] (-739.349) (-741.136) (-739.151) * (-739.659) (-738.787) (-738.991) [-744.116] -- 0:00:33
384000 -- (-737.859) (-740.949) (-739.827) [-738.891] * (-738.717) [-738.025] (-739.052) (-741.079) -- 0:00:33
384500 -- (-738.882) [-738.125] (-742.187) (-737.719) * [-739.429] (-740.064) (-737.890) (-741.226) -- 0:00:33
385000 -- [-740.521] (-737.507) (-738.960) (-738.087) * (-745.392) (-738.575) (-738.091) [-739.797] -- 0:00:33
Average standard deviation of split frequencies: 0.014411
385500 -- (-741.204) (-737.208) (-737.883) [-737.723] * (-739.497) [-737.295] (-738.091) (-740.316) -- 0:00:33
386000 -- (-741.370) (-742.188) (-737.917) [-739.137] * (-739.985) (-737.802) [-740.197] (-739.105) -- 0:00:33
386500 -- (-738.226) (-741.715) [-737.367] (-740.191) * (-737.571) (-740.789) [-739.725] (-739.777) -- 0:00:33
387000 -- (-737.781) [-740.091] (-738.172) (-740.798) * [-738.910] (-739.707) (-741.172) (-737.578) -- 0:00:33
387500 -- (-739.972) (-740.056) (-737.149) [-738.552] * (-738.011) [-741.863] (-745.542) (-739.314) -- 0:00:33
388000 -- (-739.991) (-738.948) [-739.791] (-739.348) * (-737.845) (-739.544) (-738.748) [-739.672] -- 0:00:33
388500 -- (-737.232) (-745.051) (-740.113) [-740.517] * [-739.540] (-737.304) (-738.457) (-741.370) -- 0:00:33
389000 -- (-743.682) (-738.584) [-740.002] (-740.741) * (-744.972) (-744.363) (-738.980) [-738.003] -- 0:00:32
389500 -- (-740.228) (-738.133) (-737.994) [-740.228] * (-737.393) (-738.077) [-743.189] (-741.228) -- 0:00:32
390000 -- (-739.217) (-737.660) (-738.348) [-741.720] * (-739.099) [-737.583] (-737.910) (-739.567) -- 0:00:32
Average standard deviation of split frequencies: 0.014480
390500 -- (-741.092) (-738.485) (-739.494) [-741.251] * [-738.273] (-737.896) (-736.919) (-740.148) -- 0:00:32
391000 -- (-737.036) (-737.751) [-738.187] (-739.120) * (-737.255) (-739.136) (-741.892) [-738.288] -- 0:00:34
391500 -- (-737.424) (-743.518) [-738.255] (-742.787) * (-739.561) (-737.479) [-739.179] (-738.477) -- 0:00:34
392000 -- (-737.302) [-737.977] (-738.691) (-739.213) * (-739.532) [-737.257] (-737.227) (-737.292) -- 0:00:34
392500 -- (-739.787) (-743.317) (-739.512) [-737.188] * [-738.433] (-738.443) (-739.188) (-739.721) -- 0:00:34
393000 -- (-740.963) (-737.837) (-737.467) [-738.994] * (-738.139) (-737.484) (-745.190) [-739.332] -- 0:00:33
393500 -- (-740.774) (-738.499) [-737.949] (-744.662) * (-741.125) [-744.596] (-743.151) (-737.255) -- 0:00:33
394000 -- (-740.129) (-738.101) (-740.097) [-740.892] * (-737.879) (-738.917) (-737.899) [-737.535] -- 0:00:33
394500 -- (-738.780) (-739.024) [-741.421] (-738.958) * (-738.833) (-741.702) [-740.520] (-739.514) -- 0:00:33
395000 -- (-740.994) [-737.338] (-739.691) (-741.643) * [-737.787] (-738.178) (-738.533) (-738.503) -- 0:00:33
Average standard deviation of split frequencies: 0.014047
395500 -- (-740.785) (-738.019) (-738.228) [-738.199] * (-738.010) (-737.472) (-739.776) [-738.682] -- 0:00:33
396000 -- (-738.951) (-738.990) (-740.888) [-738.757] * (-739.450) (-737.334) (-744.694) [-738.348] -- 0:00:33
396500 -- (-738.455) (-739.605) (-745.323) [-737.569] * [-738.461] (-739.155) (-741.271) (-739.483) -- 0:00:33
397000 -- (-741.733) (-737.222) (-740.041) [-739.352] * (-741.073) (-738.333) (-737.957) [-737.727] -- 0:00:33
397500 -- (-738.890) (-737.962) [-742.030] (-741.818) * [-737.840] (-741.848) (-739.970) (-740.673) -- 0:00:33
398000 -- (-740.765) (-741.458) [-739.219] (-740.470) * [-737.647] (-743.836) (-740.567) (-747.362) -- 0:00:33
398500 -- [-738.902] (-738.675) (-738.692) (-741.364) * (-740.133) (-736.899) [-740.536] (-740.604) -- 0:00:33
399000 -- (-743.229) (-739.144) [-738.608] (-737.299) * [-742.327] (-743.498) (-742.171) (-737.024) -- 0:00:33
399500 -- [-740.000] (-740.106) (-739.312) (-739.403) * (-741.453) (-738.508) [-739.283] (-737.315) -- 0:00:33
400000 -- (-743.062) (-738.550) [-742.484] (-739.134) * (-739.869) [-737.478] (-738.676) (-738.814) -- 0:00:33
Average standard deviation of split frequencies: 0.014589
400500 -- (-738.235) [-739.001] (-738.654) (-740.641) * (-742.314) (-737.883) (-743.992) [-739.546] -- 0:00:32
401000 -- (-738.484) (-742.658) [-740.830] (-743.456) * [-738.158] (-737.561) (-743.238) (-740.173) -- 0:00:32
401500 -- (-737.389) (-744.397) [-738.880] (-739.452) * (-737.781) [-739.893] (-740.366) (-737.992) -- 0:00:32
402000 -- (-739.405) [-740.380] (-738.271) (-738.359) * (-738.276) (-742.820) (-738.543) [-739.413] -- 0:00:32
402500 -- (-738.057) (-740.046) [-739.312] (-740.275) * [-739.213] (-743.610) (-738.869) (-738.439) -- 0:00:32
403000 -- (-740.494) (-740.512) [-737.785] (-741.397) * [-738.138] (-737.602) (-739.784) (-738.663) -- 0:00:32
403500 -- (-739.382) [-739.891] (-740.967) (-738.526) * (-741.932) (-737.707) (-740.299) [-740.748] -- 0:00:32
404000 -- (-739.405) [-742.999] (-740.061) (-737.706) * (-739.128) [-737.837] (-739.144) (-738.069) -- 0:00:32
404500 -- [-740.132] (-740.286) (-737.939) (-737.776) * [-742.377] (-738.371) (-737.968) (-737.972) -- 0:00:32
405000 -- (-738.590) [-740.124] (-738.340) (-736.989) * [-738.549] (-739.082) (-737.750) (-738.577) -- 0:00:32
Average standard deviation of split frequencies: 0.014165
405500 -- [-737.659] (-738.789) (-738.541) (-740.617) * (-738.751) (-738.464) [-739.829] (-738.011) -- 0:00:32
406000 -- [-737.660] (-738.971) (-739.034) (-738.219) * (-740.777) (-740.110) (-741.043) [-736.862] -- 0:00:32
406500 -- (-738.401) (-741.226) [-738.391] (-737.984) * [-740.167] (-738.574) (-738.576) (-739.533) -- 0:00:32
407000 -- [-738.961] (-738.373) (-739.374) (-738.902) * [-739.279] (-737.915) (-742.152) (-737.408) -- 0:00:32
407500 -- [-739.975] (-740.622) (-738.343) (-738.594) * (-738.835) (-740.644) (-737.955) [-739.754] -- 0:00:31
408000 -- (-738.470) (-742.598) (-739.108) [-738.124] * (-740.105) (-743.932) [-737.108] (-737.189) -- 0:00:31
408500 -- (-738.139) (-742.677) (-740.995) [-737.182] * (-741.797) [-741.133] (-742.471) (-737.509) -- 0:00:31
409000 -- (-739.263) (-743.122) [-739.774] (-737.465) * (-737.118) (-737.956) [-739.186] (-738.985) -- 0:00:31
409500 -- [-738.897] (-743.460) (-738.896) (-737.557) * (-739.116) (-742.571) [-738.387] (-740.140) -- 0:00:33
410000 -- (-739.981) [-740.058] (-742.685) (-737.487) * (-737.995) (-744.973) (-738.077) [-739.824] -- 0:00:33
Average standard deviation of split frequencies: 0.012856
410500 -- (-745.592) (-738.965) [-738.147] (-740.799) * [-737.505] (-738.459) (-737.630) (-740.369) -- 0:00:33
411000 -- [-740.143] (-738.010) (-747.573) (-742.258) * [-742.085] (-737.874) (-738.869) (-740.915) -- 0:00:32
411500 -- (-739.044) (-738.790) [-739.056] (-742.756) * (-741.545) (-746.532) (-739.002) [-738.631] -- 0:00:32
412000 -- (-738.831) (-739.462) (-738.199) [-742.635] * (-740.273) (-741.451) (-739.299) [-739.304] -- 0:00:32
412500 -- (-742.479) (-742.599) [-739.976] (-743.800) * (-740.368) (-740.426) (-747.466) [-737.883] -- 0:00:32
413000 -- (-740.616) (-738.957) [-737.970] (-739.454) * [-737.545] (-739.664) (-741.445) (-741.053) -- 0:00:32
413500 -- (-742.633) [-743.152] (-739.848) (-744.990) * [-739.220] (-738.259) (-737.716) (-742.232) -- 0:00:32
414000 -- [-745.792] (-740.758) (-741.399) (-743.100) * [-739.006] (-742.454) (-737.705) (-739.060) -- 0:00:32
414500 -- [-743.026] (-743.543) (-737.334) (-739.963) * (-740.899) (-738.816) [-737.339] (-738.012) -- 0:00:32
415000 -- [-737.227] (-737.938) (-746.913) (-739.071) * [-738.861] (-740.161) (-740.878) (-738.240) -- 0:00:32
Average standard deviation of split frequencies: 0.013598
415500 -- (-738.009) [-738.992] (-743.585) (-743.113) * (-741.432) (-742.687) [-738.617] (-740.804) -- 0:00:32
416000 -- (-739.290) (-739.667) [-738.505] (-738.563) * (-737.164) [-739.793] (-740.638) (-738.716) -- 0:00:32
416500 -- (-740.787) (-739.557) (-743.037) [-739.753] * (-738.744) (-743.082) [-737.566] (-738.304) -- 0:00:32
417000 -- (-740.573) [-739.512] (-739.090) (-739.488) * [-737.864] (-743.526) (-739.865) (-742.203) -- 0:00:32
417500 -- (-738.624) [-739.874] (-739.353) (-737.679) * [-740.137] (-741.059) (-740.214) (-739.200) -- 0:00:32
418000 -- [-739.124] (-737.169) (-738.693) (-738.442) * [-740.166] (-740.134) (-738.220) (-740.438) -- 0:00:32
418500 -- [-738.653] (-740.147) (-738.855) (-739.558) * [-737.481] (-738.342) (-739.107) (-739.667) -- 0:00:31
419000 -- (-739.699) (-740.103) (-738.116) [-738.468] * (-740.383) (-738.826) (-741.855) [-737.542] -- 0:00:31
419500 -- (-739.376) [-737.132] (-741.727) (-738.709) * (-739.125) (-740.072) (-738.993) [-743.070] -- 0:00:31
420000 -- [-738.494] (-738.788) (-742.221) (-740.685) * (-743.174) (-738.542) (-740.849) [-739.664] -- 0:00:31
Average standard deviation of split frequencies: 0.012327
420500 -- [-739.476] (-738.980) (-740.052) (-739.335) * [-740.293] (-741.180) (-738.799) (-739.791) -- 0:00:31
421000 -- (-738.110) [-738.433] (-738.845) (-739.921) * (-738.004) (-742.498) (-740.455) [-737.831] -- 0:00:31
421500 -- (-739.503) [-743.790] (-737.808) (-739.504) * (-740.504) [-741.655] (-740.382) (-739.481) -- 0:00:31
422000 -- [-739.316] (-738.126) (-737.004) (-737.105) * (-740.963) (-739.592) (-739.459) [-740.225] -- 0:00:31
422500 -- [-737.323] (-737.333) (-738.289) (-743.879) * (-740.018) [-739.645] (-737.979) (-737.226) -- 0:00:31
423000 -- (-741.339) [-739.048] (-737.576) (-741.761) * (-742.823) [-738.182] (-739.259) (-738.882) -- 0:00:31
423500 -- [-738.782] (-740.165) (-738.770) (-739.641) * (-738.151) [-738.526] (-737.772) (-741.223) -- 0:00:31
424000 -- (-738.929) (-738.431) (-739.548) [-738.547] * (-738.610) [-737.582] (-740.422) (-741.338) -- 0:00:31
424500 -- (-741.428) (-738.171) [-738.844] (-742.104) * (-738.272) (-738.155) (-739.238) [-739.337] -- 0:00:31
425000 -- (-738.294) [-738.978] (-740.099) (-743.303) * (-741.813) (-737.417) (-737.850) [-739.298] -- 0:00:31
Average standard deviation of split frequencies: 0.012394
425500 -- (-743.579) (-740.319) [-738.066] (-738.277) * (-739.896) (-738.548) [-738.285] (-740.405) -- 0:00:31
426000 -- [-738.467] (-738.593) (-739.267) (-739.940) * [-737.769] (-739.366) (-737.984) (-739.768) -- 0:00:30
426500 -- (-737.928) (-740.165) (-740.626) [-740.958] * (-740.492) (-738.542) [-739.040] (-740.969) -- 0:00:30
427000 -- (-740.915) (-739.029) [-739.298] (-738.205) * (-739.074) [-743.520] (-740.227) (-738.677) -- 0:00:30
427500 -- (-742.421) [-738.147] (-738.067) (-738.851) * (-738.051) [-741.832] (-740.230) (-740.375) -- 0:00:30
428000 -- [-737.323] (-738.065) (-737.823) (-741.622) * [-738.437] (-743.461) (-741.100) (-742.193) -- 0:00:32
428500 -- [-739.478] (-739.108) (-737.757) (-740.178) * [-739.040] (-739.422) (-741.997) (-737.622) -- 0:00:32
429000 -- (-738.110) (-739.155) [-737.206] (-743.143) * [-737.598] (-750.133) (-742.950) (-741.852) -- 0:00:31
429500 -- [-740.097] (-742.841) (-738.006) (-746.585) * (-739.072) (-740.101) [-748.769] (-740.836) -- 0:00:31
430000 -- (-742.779) (-738.336) (-737.664) [-741.116] * (-740.689) (-738.811) (-737.943) [-738.453] -- 0:00:31
Average standard deviation of split frequencies: 0.012259
430500 -- [-738.738] (-737.774) (-741.253) (-747.527) * (-739.248) [-739.974] (-739.308) (-738.149) -- 0:00:31
431000 -- [-741.560] (-737.833) (-739.295) (-743.041) * (-741.343) (-740.690) [-739.547] (-742.019) -- 0:00:31
431500 -- (-737.877) [-740.926] (-738.620) (-739.871) * (-747.086) (-737.624) [-739.472] (-741.281) -- 0:00:31
432000 -- (-739.732) (-740.249) (-739.121) [-740.203] * (-744.119) [-737.623] (-739.314) (-741.048) -- 0:00:31
432500 -- [-737.046] (-739.717) (-743.554) (-738.479) * (-740.667) [-737.814] (-741.606) (-740.890) -- 0:00:31
433000 -- (-739.544) [-739.279] (-737.522) (-737.198) * [-738.377] (-739.138) (-739.333) (-739.075) -- 0:00:31
433500 -- (-737.838) (-740.302) [-738.747] (-736.989) * (-740.055) (-738.573) (-739.309) [-738.745] -- 0:00:31
434000 -- (-741.340) (-737.746) [-739.283] (-739.860) * [-738.321] (-740.453) (-738.597) (-742.906) -- 0:00:31
434500 -- (-739.774) (-739.652) (-743.209) [-737.121] * (-737.725) (-738.700) [-737.811] (-738.189) -- 0:00:31
435000 -- (-738.465) (-743.815) [-744.150] (-737.648) * [-737.963] (-740.044) (-740.614) (-738.528) -- 0:00:31
Average standard deviation of split frequencies: 0.012758
435500 -- [-743.222] (-746.864) (-741.050) (-739.319) * (-738.773) [-737.530] (-739.730) (-739.509) -- 0:00:31
436000 -- (-738.204) (-739.463) (-738.678) [-740.145] * (-738.194) (-743.479) [-740.305] (-737.284) -- 0:00:31
436500 -- (-738.926) [-738.625] (-740.261) (-739.332) * [-740.204] (-738.840) (-741.073) (-738.652) -- 0:00:30
437000 -- (-742.878) (-738.610) (-739.220) [-738.917] * (-739.563) (-738.460) [-739.573] (-744.093) -- 0:00:30
437500 -- [-741.314] (-740.145) (-741.998) (-738.281) * (-742.806) [-738.173] (-742.707) (-737.944) -- 0:00:30
438000 -- (-737.928) (-739.972) [-737.844] (-738.767) * (-739.993) (-742.598) [-742.942] (-739.505) -- 0:00:30
438500 -- (-737.649) (-739.711) [-738.017] (-739.171) * (-738.684) (-739.530) [-738.641] (-737.113) -- 0:00:30
439000 -- (-739.049) (-742.033) [-738.091] (-738.301) * [-738.197] (-742.273) (-739.464) (-737.270) -- 0:00:30
439500 -- (-739.808) [-738.812] (-741.012) (-739.979) * (-738.362) (-742.458) [-738.246] (-738.556) -- 0:00:30
440000 -- (-740.393) (-738.426) (-738.280) [-739.071] * [-737.482] (-739.947) (-738.963) (-743.686) -- 0:00:30
Average standard deviation of split frequencies: 0.013265
440500 -- (-738.460) (-737.822) (-741.908) [-738.286] * (-737.127) (-739.398) [-738.364] (-743.905) -- 0:00:30
441000 -- (-738.821) (-738.348) [-739.489] (-737.117) * (-740.772) (-739.436) [-737.756] (-740.920) -- 0:00:30
441500 -- [-740.651] (-740.979) (-738.942) (-737.118) * (-740.684) [-737.951] (-741.636) (-738.843) -- 0:00:30
442000 -- [-740.193] (-740.942) (-739.865) (-738.129) * (-742.387) (-738.381) (-741.550) [-740.595] -- 0:00:30
442500 -- (-738.562) (-741.265) (-738.582) [-739.222] * [-738.965] (-741.339) (-737.650) (-743.442) -- 0:00:30
443000 -- [-738.014] (-738.741) (-740.687) (-739.794) * [-738.003] (-740.851) (-739.498) (-740.898) -- 0:00:30
443500 -- (-739.884) (-739.094) (-738.280) [-740.763] * (-738.848) [-739.337] (-737.628) (-743.827) -- 0:00:30
444000 -- [-739.775] (-738.980) (-738.508) (-739.228) * (-737.523) (-738.283) (-737.459) [-739.360] -- 0:00:30
444500 -- (-743.668) [-739.761] (-738.378) (-739.701) * (-739.901) (-737.874) (-739.882) [-739.394] -- 0:00:29
445000 -- [-740.201] (-738.729) (-738.626) (-742.390) * [-738.166] (-739.249) (-741.822) (-742.257) -- 0:00:29
Average standard deviation of split frequencies: 0.012472
445500 -- [-738.688] (-738.993) (-745.159) (-739.722) * (-739.511) (-740.223) [-740.199] (-741.544) -- 0:00:29
446000 -- [-739.133] (-738.658) (-747.862) (-739.744) * (-738.427) (-738.015) [-739.734] (-737.262) -- 0:00:29
446500 -- (-739.716) [-737.855] (-738.523) (-742.170) * [-737.519] (-743.030) (-740.556) (-737.632) -- 0:00:30
447000 -- (-738.866) (-740.761) [-738.544] (-741.539) * [-738.788] (-741.874) (-740.082) (-739.653) -- 0:00:30
447500 -- (-739.363) (-738.902) (-739.993) [-740.854] * (-739.494) (-743.859) (-738.751) [-739.797] -- 0:00:30
448000 -- (-741.209) [-738.918] (-741.154) (-741.219) * [-737.071] (-737.171) (-739.772) (-739.103) -- 0:00:30
448500 -- (-738.508) [-737.201] (-739.677) (-741.580) * (-737.843) (-737.837) (-737.616) [-737.029] -- 0:00:30
449000 -- [-740.061] (-738.268) (-740.103) (-741.026) * [-737.862] (-738.308) (-739.028) (-740.521) -- 0:00:30
449500 -- (-742.260) [-738.164] (-737.750) (-737.382) * (-737.725) [-737.110] (-740.204) (-742.559) -- 0:00:30
450000 -- (-740.342) (-739.965) (-739.093) [-741.008] * [-740.543] (-739.417) (-749.283) (-738.391) -- 0:00:30
Average standard deviation of split frequencies: 0.013807
450500 -- (-739.643) (-743.078) (-737.225) [-737.091] * (-742.389) (-739.507) [-740.802] (-738.588) -- 0:00:30
451000 -- (-737.515) (-739.045) (-739.653) [-738.331] * [-741.340] (-740.806) (-737.730) (-739.322) -- 0:00:30
451500 -- (-737.284) (-738.637) [-738.424] (-744.692) * (-737.232) [-737.950] (-740.893) (-738.250) -- 0:00:30
452000 -- (-739.437) (-742.067) (-737.331) [-737.815] * (-738.533) [-737.206] (-739.603) (-741.110) -- 0:00:30
452500 -- (-739.271) (-743.968) [-740.653] (-740.963) * (-740.121) (-737.530) [-739.818] (-738.053) -- 0:00:30
453000 -- [-737.529] (-739.966) (-739.075) (-740.970) * (-740.385) (-738.033) [-740.360] (-737.873) -- 0:00:30
453500 -- [-740.336] (-738.266) (-740.830) (-740.956) * (-738.280) (-741.959) [-739.417] (-739.694) -- 0:00:30
454000 -- [-738.024] (-737.723) (-738.512) (-741.472) * [-738.280] (-739.456) (-739.454) (-738.786) -- 0:00:30
454500 -- (-739.859) (-741.925) [-738.454] (-737.841) * (-740.690) (-743.722) [-739.272] (-737.973) -- 0:00:30
455000 -- (-742.168) [-738.011] (-741.143) (-738.592) * (-741.353) (-742.140) [-737.227] (-738.394) -- 0:00:29
Average standard deviation of split frequencies: 0.014886
455500 -- [-742.280] (-740.599) (-741.230) (-737.979) * (-740.834) (-741.886) (-743.144) [-739.786] -- 0:00:29
456000 -- (-742.357) [-739.096] (-740.298) (-737.216) * (-739.149) (-741.561) [-737.340] (-737.870) -- 0:00:29
456500 -- (-737.605) (-741.852) [-742.399] (-738.359) * (-741.765) [-739.704] (-738.740) (-738.240) -- 0:00:29
457000 -- [-739.666] (-742.281) (-740.595) (-745.991) * [-740.514] (-738.743) (-737.538) (-743.108) -- 0:00:29
457500 -- (-737.730) (-738.832) (-742.833) [-738.747] * (-740.924) [-738.516] (-737.723) (-741.364) -- 0:00:29
458000 -- [-737.762] (-740.925) (-739.059) (-738.829) * (-740.280) [-737.640] (-738.368) (-740.885) -- 0:00:29
458500 -- [-742.565] (-743.398) (-738.301) (-739.207) * (-742.507) (-738.409) (-738.276) [-739.618] -- 0:00:29
459000 -- (-747.827) (-740.232) [-739.321] (-741.724) * (-741.188) [-737.927] (-740.494) (-738.803) -- 0:00:29
459500 -- (-740.089) [-741.258] (-738.030) (-739.532) * [-737.605] (-737.900) (-740.090) (-738.361) -- 0:00:29
460000 -- [-737.017] (-742.302) (-738.109) (-741.959) * [-738.725] (-737.519) (-742.753) (-738.106) -- 0:00:29
Average standard deviation of split frequencies: 0.016168
460500 -- (-737.185) (-739.401) [-740.879] (-738.761) * [-739.778] (-737.579) (-740.168) (-740.404) -- 0:00:29
461000 -- (-738.167) (-737.771) (-740.162) [-737.909] * (-738.593) (-739.694) [-739.099] (-737.411) -- 0:00:29
461500 -- [-740.244] (-737.610) (-741.500) (-739.204) * (-737.408) [-742.337] (-742.813) (-737.331) -- 0:00:29
462000 -- (-743.126) (-744.955) (-741.335) [-742.317] * [-738.898] (-739.250) (-740.177) (-737.939) -- 0:00:29
462500 -- (-741.540) [-738.835] (-739.857) (-741.739) * (-737.984) (-740.004) (-739.650) [-738.208] -- 0:00:29
463000 -- (-738.510) [-739.034] (-739.243) (-737.573) * (-737.740) (-740.755) [-739.125] (-743.055) -- 0:00:28
463500 -- (-738.116) (-738.810) [-737.399] (-742.519) * (-738.163) (-743.309) [-738.710] (-742.010) -- 0:00:28
464000 -- [-739.345] (-737.038) (-742.740) (-738.103) * (-738.308) (-739.727) (-740.271) [-738.786] -- 0:00:28
464500 -- (-737.917) (-737.474) [-738.327] (-741.827) * (-738.743) (-738.151) [-738.122] (-739.734) -- 0:00:28
465000 -- (-739.732) [-737.853] (-741.912) (-742.155) * (-737.221) [-740.436] (-737.830) (-740.086) -- 0:00:28
Average standard deviation of split frequencies: 0.017602
465500 -- (-739.085) [-740.124] (-740.577) (-740.014) * (-738.643) [-742.649] (-738.123) (-738.761) -- 0:00:29
466000 -- (-740.811) (-738.994) (-739.258) [-738.229] * (-738.296) (-738.321) [-738.600] (-737.975) -- 0:00:29
466500 -- [-738.748] (-739.992) (-740.026) (-740.664) * [-741.929] (-738.992) (-739.077) (-742.924) -- 0:00:29
467000 -- [-738.917] (-740.162) (-738.606) (-739.474) * (-739.133) [-740.483] (-739.301) (-738.514) -- 0:00:29
467500 -- (-737.958) [-738.374] (-737.040) (-737.553) * (-738.801) (-738.910) (-740.196) [-740.461] -- 0:00:29
468000 -- (-737.048) [-739.424] (-740.115) (-739.191) * (-738.646) (-737.539) (-740.735) [-740.017] -- 0:00:29
468500 -- (-737.025) [-739.461] (-739.308) (-739.730) * [-738.552] (-742.147) (-739.922) (-737.559) -- 0:00:29
469000 -- (-739.749) (-737.926) (-738.059) [-737.889] * (-742.565) [-737.269] (-737.225) (-739.368) -- 0:00:29
469500 -- (-738.717) [-737.811] (-738.450) (-737.859) * (-740.654) (-739.841) [-738.614] (-740.816) -- 0:00:29
470000 -- (-741.514) (-736.886) [-738.462] (-738.545) * (-740.109) [-741.458] (-738.619) (-739.135) -- 0:00:29
Average standard deviation of split frequencies: 0.016225
470500 -- (-737.439) (-738.253) (-739.500) [-738.933] * [-742.182] (-742.367) (-738.223) (-737.503) -- 0:00:29
471000 -- (-738.638) (-741.802) [-738.825] (-738.879) * (-737.768) (-745.413) [-739.810] (-742.165) -- 0:00:29
471500 -- (-739.366) (-748.855) (-737.224) [-739.936] * [-739.254] (-741.764) (-737.475) (-737.534) -- 0:00:29
472000 -- (-737.830) (-743.187) [-740.029] (-740.848) * [-739.385] (-741.262) (-738.772) (-741.860) -- 0:00:29
472500 -- (-737.864) [-738.179] (-742.265) (-737.044) * (-737.653) (-737.915) [-738.065] (-737.606) -- 0:00:29
473000 -- (-740.671) (-738.411) (-739.880) [-737.391] * (-737.980) (-739.314) (-740.722) [-741.992] -- 0:00:28
473500 -- [-737.640] (-741.984) (-739.008) (-738.196) * (-739.174) [-738.126] (-738.532) (-738.577) -- 0:00:28
474000 -- (-746.532) (-738.870) (-737.933) [-738.357] * (-740.363) (-739.735) (-739.246) [-739.215] -- 0:00:28
474500 -- [-738.286] (-737.551) (-741.268) (-738.978) * (-742.940) (-738.392) (-741.594) [-739.417] -- 0:00:28
475000 -- (-738.177) (-740.299) [-738.843] (-740.771) * (-742.076) (-740.172) (-738.970) [-738.950] -- 0:00:28
Average standard deviation of split frequencies: 0.016242
475500 -- (-738.435) (-736.993) (-738.630) [-741.403] * (-739.762) (-741.609) (-738.070) [-737.647] -- 0:00:28
476000 -- (-739.226) (-737.027) [-744.306] (-740.220) * (-739.690) [-739.986] (-739.150) (-740.994) -- 0:00:28
476500 -- (-741.628) (-737.590) [-738.972] (-738.426) * (-738.669) (-742.033) [-741.551] (-739.246) -- 0:00:28
477000 -- (-739.744) [-738.095] (-738.140) (-739.109) * (-740.171) (-740.326) (-743.220) [-738.008] -- 0:00:28
477500 -- [-739.263] (-741.849) (-738.133) (-739.359) * [-737.994] (-741.529) (-739.694) (-738.336) -- 0:00:28
478000 -- (-739.084) [-744.125] (-740.303) (-738.408) * (-742.205) (-741.608) (-740.820) [-737.273] -- 0:00:28
478500 -- (-740.557) (-740.569) (-740.727) [-744.027] * (-738.294) (-742.883) (-739.715) [-738.043] -- 0:00:28
479000 -- (-740.354) [-740.218] (-737.885) (-741.442) * (-737.208) (-740.752) [-741.223] (-739.985) -- 0:00:28
479500 -- (-744.362) (-737.631) [-738.584] (-739.847) * (-738.582) [-740.791] (-743.528) (-737.851) -- 0:00:28
480000 -- [-738.949] (-738.310) (-738.269) (-740.113) * (-739.091) (-741.722) [-738.081] (-739.355) -- 0:00:28
Average standard deviation of split frequencies: 0.016672
480500 -- [-739.982] (-740.289) (-740.513) (-739.026) * [-738.639] (-741.324) (-737.471) (-739.327) -- 0:00:28
481000 -- (-737.943) [-738.987] (-740.057) (-739.754) * [-738.750] (-741.493) (-739.861) (-741.516) -- 0:00:28
481500 -- [-737.890] (-739.659) (-740.615) (-741.647) * (-737.993) (-738.792) (-739.116) [-738.174] -- 0:00:27
482000 -- [-738.383] (-740.089) (-738.371) (-740.696) * (-738.067) (-741.357) (-738.624) [-739.446] -- 0:00:27
482500 -- (-738.499) (-742.984) (-740.934) [-739.049] * (-737.943) [-742.718] (-741.127) (-739.268) -- 0:00:27
483000 -- (-739.831) (-739.250) (-738.724) [-741.003] * [-737.369] (-739.560) (-741.248) (-739.777) -- 0:00:27
483500 -- (-740.624) [-740.179] (-738.989) (-744.545) * (-738.746) (-739.892) [-737.769] (-737.534) -- 0:00:27
484000 -- (-743.170) [-738.498] (-743.567) (-739.748) * (-737.842) (-741.213) (-738.645) [-740.120] -- 0:00:28
484500 -- [-741.043] (-742.462) (-738.183) (-737.494) * (-741.488) [-737.942] (-737.303) (-743.572) -- 0:00:28
485000 -- (-743.519) [-738.325] (-738.193) (-739.468) * (-741.090) (-737.973) [-742.135] (-742.834) -- 0:00:28
Average standard deviation of split frequencies: 0.017071
485500 -- [-737.355] (-740.703) (-743.958) (-739.706) * (-740.931) (-737.280) [-740.130] (-739.154) -- 0:00:28
486000 -- [-738.433] (-742.397) (-740.019) (-740.454) * (-739.311) [-736.950] (-739.168) (-738.625) -- 0:00:28
486500 -- [-739.843] (-740.457) (-739.821) (-741.178) * (-739.651) (-737.645) (-740.019) [-740.859] -- 0:00:28
487000 -- (-739.181) [-740.581] (-740.180) (-740.894) * (-741.080) (-742.539) (-742.611) [-738.927] -- 0:00:28
487500 -- (-738.566) [-737.853] (-738.457) (-739.243) * (-737.772) (-740.591) [-741.596] (-743.514) -- 0:00:28
488000 -- (-738.838) (-739.767) [-738.426] (-739.324) * (-744.428) (-738.276) [-737.951] (-743.438) -- 0:00:28
488500 -- (-740.251) (-739.045) (-738.757) [-743.645] * (-741.461) [-739.004] (-739.013) (-739.760) -- 0:00:28
489000 -- (-738.703) (-743.975) [-737.575] (-743.647) * (-738.487) [-738.548] (-738.876) (-741.077) -- 0:00:28
489500 -- (-737.328) (-739.534) [-738.311] (-742.014) * (-740.039) [-741.098] (-738.317) (-741.855) -- 0:00:28
490000 -- [-740.084] (-738.476) (-739.030) (-737.524) * (-747.370) (-743.754) (-743.880) [-737.245] -- 0:00:28
Average standard deviation of split frequencies: 0.014219
490500 -- (-738.571) (-743.111) (-737.826) [-739.216] * (-740.041) (-738.176) (-738.013) [-740.496] -- 0:00:28
491000 -- (-740.392) [-744.395] (-738.578) (-739.061) * (-737.754) (-744.137) [-738.213] (-738.262) -- 0:00:27
491500 -- (-741.476) (-742.887) (-738.977) [-739.707] * (-737.797) (-737.654) [-738.446] (-740.367) -- 0:00:27
492000 -- [-738.966] (-740.491) (-738.891) (-739.851) * (-738.954) [-738.712] (-737.572) (-737.981) -- 0:00:27
492500 -- (-739.770) (-738.592) [-738.661] (-740.050) * (-737.672) [-739.716] (-741.207) (-737.456) -- 0:00:27
493000 -- (-738.687) (-737.963) [-740.087] (-738.458) * (-737.098) (-739.452) [-739.149] (-737.485) -- 0:00:27
493500 -- (-738.395) (-739.343) (-739.134) [-738.375] * (-739.228) (-738.641) [-739.596] (-737.959) -- 0:00:27
494000 -- (-737.748) [-738.729] (-740.844) (-738.274) * (-737.926) [-737.882] (-745.322) (-739.441) -- 0:00:27
494500 -- (-738.487) [-739.220] (-740.460) (-738.657) * (-737.401) (-742.524) [-739.105] (-739.177) -- 0:00:27
495000 -- (-739.648) (-738.594) (-738.906) [-743.550] * (-737.824) (-739.413) (-738.293) [-738.529] -- 0:00:27
Average standard deviation of split frequencies: 0.014066
495500 -- (-740.371) [-740.810] (-742.811) (-741.591) * (-737.940) (-738.373) (-738.733) [-740.465] -- 0:00:27
496000 -- [-738.084] (-741.564) (-748.583) (-738.565) * (-738.866) (-738.393) (-740.508) [-737.411] -- 0:00:27
496500 -- (-740.398) (-739.063) [-738.600] (-737.550) * (-740.466) (-738.108) (-741.271) [-738.212] -- 0:00:27
497000 -- [-738.111] (-738.789) (-739.743) (-737.658) * (-737.740) (-743.505) (-740.958) [-738.090] -- 0:00:27
497500 -- [-738.707] (-740.243) (-739.541) (-737.658) * (-739.759) (-739.931) [-739.909] (-738.123) -- 0:00:27
498000 -- (-739.022) [-739.402] (-739.722) (-741.895) * [-739.965] (-738.454) (-741.754) (-738.684) -- 0:00:27
498500 -- [-740.688] (-739.005) (-737.630) (-737.955) * (-738.746) [-737.628] (-737.813) (-737.078) -- 0:00:27
499000 -- (-739.517) (-744.648) [-737.658] (-737.624) * (-737.798) (-739.697) [-739.538] (-738.376) -- 0:00:27
499500 -- [-738.547] (-741.092) (-739.918) (-743.759) * (-738.599) (-738.569) (-738.506) [-737.728] -- 0:00:27
500000 -- [-738.085] (-739.328) (-739.331) (-743.271) * [-739.082] (-739.921) (-738.881) (-739.455) -- 0:00:27
Average standard deviation of split frequencies: 0.014877
500500 -- (-740.116) (-740.180) [-738.094] (-743.388) * (-737.328) (-743.162) [-740.973] (-739.380) -- 0:00:26
501000 -- (-744.297) (-744.692) (-737.815) [-742.086] * (-737.406) (-740.080) (-739.653) [-739.266] -- 0:00:26
501500 -- [-740.408] (-738.811) (-739.346) (-740.133) * [-737.649] (-739.065) (-738.636) (-738.765) -- 0:00:26
502000 -- (-739.302) [-738.405] (-744.012) (-738.687) * (-743.907) [-741.110] (-740.890) (-737.093) -- 0:00:26
502500 -- (-738.759) [-741.218] (-738.787) (-738.693) * (-739.095) (-740.563) [-737.163] (-739.632) -- 0:00:27
503000 -- (-737.457) [-738.921] (-739.742) (-738.007) * (-742.608) (-738.249) [-738.022] (-739.495) -- 0:00:27
503500 -- (-739.908) [-744.120] (-737.836) (-740.566) * (-739.188) (-739.558) [-738.384] (-738.450) -- 0:00:27
504000 -- (-741.909) (-738.058) [-741.569] (-741.824) * [-737.939] (-739.167) (-742.479) (-738.152) -- 0:00:27
504500 -- [-741.216] (-740.671) (-738.070) (-741.411) * [-738.370] (-738.455) (-741.988) (-740.037) -- 0:00:27
505000 -- (-741.790) [-738.016] (-737.390) (-739.616) * (-738.411) (-738.661) [-740.553] (-738.729) -- 0:00:27
Average standard deviation of split frequencies: 0.016210
505500 -- [-737.793] (-740.627) (-738.938) (-740.358) * [-740.310] (-738.186) (-744.234) (-740.381) -- 0:00:27
506000 -- [-738.992] (-737.710) (-739.123) (-739.224) * (-738.831) (-738.106) (-741.628) [-739.599] -- 0:00:27
506500 -- [-740.842] (-739.084) (-737.791) (-739.747) * (-741.511) [-739.286] (-741.506) (-743.124) -- 0:00:27
507000 -- (-738.964) [-738.158] (-738.815) (-739.858) * (-738.761) (-743.624) (-738.529) [-738.700] -- 0:00:27
507500 -- (-741.418) [-740.765] (-741.289) (-738.029) * [-738.318] (-739.416) (-740.060) (-737.999) -- 0:00:27
508000 -- [-741.353] (-737.865) (-740.109) (-738.316) * (-738.187) [-740.226] (-738.169) (-745.519) -- 0:00:27
508500 -- (-740.781) (-739.918) [-741.065] (-738.514) * (-739.471) (-740.089) [-738.662] (-738.422) -- 0:00:27
509000 -- (-741.998) (-740.114) (-739.953) [-737.994] * [-739.193] (-740.612) (-738.612) (-740.411) -- 0:00:27
509500 -- (-737.704) [-740.969] (-738.575) (-741.475) * (-744.560) (-739.622) [-739.502] (-743.125) -- 0:00:26
510000 -- (-741.200) (-739.003) [-737.220] (-738.447) * (-739.595) [-745.690] (-738.791) (-741.360) -- 0:00:26
Average standard deviation of split frequencies: 0.016431
510500 -- (-737.657) (-739.432) (-739.512) [-739.282] * (-740.134) (-740.798) [-739.470] (-739.175) -- 0:00:26
511000 -- (-738.965) (-741.522) (-738.091) [-737.323] * (-739.294) (-740.101) (-740.499) [-741.152] -- 0:00:26
511500 -- [-738.299] (-737.578) (-737.677) (-738.093) * (-739.932) (-738.333) [-742.662] (-739.090) -- 0:00:26
512000 -- (-738.870) (-738.102) (-739.574) [-739.703] * (-740.829) (-737.202) [-738.984] (-740.712) -- 0:00:26
512500 -- [-742.824] (-743.712) (-739.265) (-738.200) * [-741.004] (-740.818) (-741.412) (-738.858) -- 0:00:26
513000 -- (-744.205) (-742.284) (-740.220) [-738.344] * (-738.042) (-746.195) (-739.232) [-742.065] -- 0:00:26
513500 -- (-740.769) (-740.300) [-738.347] (-739.390) * (-739.781) (-738.665) (-745.207) [-737.718] -- 0:00:26
514000 -- (-740.410) (-740.084) [-738.706] (-741.582) * (-739.930) [-741.690] (-738.476) (-738.280) -- 0:00:26
514500 -- (-738.452) (-737.866) [-738.952] (-741.087) * (-740.201) (-743.113) [-739.135] (-741.605) -- 0:00:26
515000 -- (-737.217) (-740.343) [-739.546] (-738.482) * (-738.320) [-738.757] (-740.366) (-742.050) -- 0:00:26
Average standard deviation of split frequencies: 0.016079
515500 -- (-738.556) [-737.924] (-737.939) (-742.061) * [-737.613] (-744.415) (-738.634) (-739.481) -- 0:00:26
516000 -- (-743.339) [-738.844] (-738.684) (-743.100) * [-738.087] (-736.857) (-739.230) (-739.278) -- 0:00:26
516500 -- [-737.616] (-737.569) (-738.294) (-740.132) * (-739.296) [-739.771] (-737.933) (-738.846) -- 0:00:26
517000 -- (-738.231) (-739.026) [-738.134] (-739.915) * (-742.047) (-737.667) [-738.273] (-740.778) -- 0:00:26
517500 -- (-737.362) [-738.071] (-740.921) (-741.817) * (-743.478) [-738.400] (-738.971) (-740.393) -- 0:00:26
518000 -- [-740.259] (-738.179) (-739.344) (-743.198) * (-746.001) [-739.280] (-739.674) (-737.436) -- 0:00:26
518500 -- (-739.687) (-739.617) (-738.077) [-738.218] * (-741.950) [-739.463] (-740.838) (-738.527) -- 0:00:26
519000 -- (-736.931) (-738.113) (-738.400) [-741.428] * (-739.201) (-738.399) [-738.316] (-739.368) -- 0:00:25
519500 -- [-737.225] (-738.978) (-737.577) (-741.267) * [-740.364] (-741.538) (-739.512) (-741.464) -- 0:00:25
520000 -- (-738.750) (-741.387) (-737.884) [-739.950] * (-737.915) [-739.126] (-738.305) (-739.732) -- 0:00:25
Average standard deviation of split frequencies: 0.016659
520500 -- (-738.956) (-741.452) [-737.968] (-739.332) * (-738.135) [-737.727] (-737.831) (-738.759) -- 0:00:25
521000 -- (-737.613) [-739.062] (-738.111) (-741.969) * [-738.257] (-737.730) (-740.281) (-739.316) -- 0:00:26
521500 -- (-738.224) [-739.049] (-739.427) (-738.548) * (-741.895) (-741.053) [-738.537] (-738.283) -- 0:00:26
522000 -- [-738.364] (-740.113) (-746.196) (-741.534) * (-738.309) (-740.816) [-739.334] (-742.169) -- 0:00:26
522500 -- (-738.397) (-739.017) (-743.533) [-738.448] * (-740.885) (-747.255) [-737.583] (-739.311) -- 0:00:26
523000 -- [-739.218] (-741.511) (-737.880) (-738.585) * [-738.652] (-738.646) (-744.706) (-743.674) -- 0:00:26
523500 -- [-738.514] (-738.353) (-737.988) (-740.859) * (-741.045) (-737.717) (-743.113) [-741.425] -- 0:00:26
524000 -- (-742.110) (-738.678) [-737.688] (-737.858) * (-741.725) [-739.549] (-738.972) (-741.814) -- 0:00:26
524500 -- (-740.715) [-737.796] (-738.094) (-739.502) * (-740.467) (-740.219) [-740.153] (-745.111) -- 0:00:26
525000 -- [-738.419] (-740.226) (-738.801) (-739.110) * (-739.480) [-739.795] (-739.629) (-740.556) -- 0:00:26
Average standard deviation of split frequencies: 0.016132
525500 -- (-740.877) (-743.772) (-743.871) [-739.105] * [-741.302] (-742.776) (-737.790) (-739.321) -- 0:00:26
526000 -- (-740.321) [-737.849] (-742.351) (-738.052) * (-740.179) (-737.525) [-738.554] (-739.638) -- 0:00:26
526500 -- (-739.012) (-739.459) [-741.870] (-736.942) * (-738.776) (-739.380) [-737.624] (-739.194) -- 0:00:26
527000 -- [-737.347] (-738.110) (-739.476) (-738.500) * (-740.715) [-738.115] (-737.478) (-737.452) -- 0:00:26
527500 -- (-740.617) (-739.917) [-739.588] (-739.077) * (-741.746) [-738.543] (-738.646) (-739.963) -- 0:00:25
528000 -- [-739.077] (-737.371) (-740.564) (-741.985) * (-741.105) (-740.033) (-738.703) [-737.443] -- 0:00:25
528500 -- (-739.522) (-739.157) [-741.339] (-740.610) * (-741.843) [-739.443] (-737.871) (-738.923) -- 0:00:25
529000 -- (-738.249) (-739.967) (-746.965) [-740.478] * [-740.202] (-737.813) (-737.332) (-739.568) -- 0:00:25
529500 -- (-743.472) (-738.293) (-737.396) [-737.209] * (-738.878) (-739.003) (-741.893) [-738.959] -- 0:00:25
530000 -- (-738.341) [-744.798] (-740.410) (-738.706) * (-739.230) (-739.504) [-738.787] (-737.793) -- 0:00:25
Average standard deviation of split frequencies: 0.016878
530500 -- (-741.157) (-741.033) (-741.848) [-739.105] * (-741.259) (-739.337) [-739.900] (-741.414) -- 0:00:25
531000 -- [-739.982] (-738.659) (-739.779) (-737.809) * (-741.070) (-736.979) [-739.888] (-739.772) -- 0:00:25
531500 -- (-739.076) (-739.638) [-739.597] (-738.837) * [-742.577] (-737.650) (-737.572) (-740.917) -- 0:00:25
532000 -- (-741.025) (-738.839) [-740.564] (-737.138) * [-739.033] (-739.499) (-739.927) (-740.780) -- 0:00:25
532500 -- [-739.999] (-741.351) (-740.548) (-737.229) * (-737.990) (-740.292) (-737.241) [-740.148] -- 0:00:25
533000 -- [-738.215] (-741.723) (-737.889) (-737.701) * [-738.658] (-743.154) (-737.925) (-739.565) -- 0:00:25
533500 -- (-738.315) [-738.367] (-737.683) (-739.163) * (-737.397) [-738.350] (-738.527) (-740.510) -- 0:00:25
534000 -- [-739.733] (-738.013) (-740.461) (-740.823) * (-736.972) (-737.157) [-742.538] (-739.010) -- 0:00:25
534500 -- (-740.145) (-740.227) (-741.215) [-738.941] * [-737.564] (-738.029) (-742.711) (-738.933) -- 0:00:25
535000 -- (-739.387) [-740.742] (-738.227) (-738.164) * (-738.073) (-739.913) [-736.881] (-739.650) -- 0:00:25
Average standard deviation of split frequencies: 0.017238
535500 -- [-737.382] (-738.139) (-742.033) (-740.745) * (-738.629) (-739.739) [-737.609] (-738.083) -- 0:00:25
536000 -- (-741.457) (-741.861) [-740.173] (-738.595) * (-738.141) [-737.601] (-737.194) (-737.133) -- 0:00:25
536500 -- (-739.348) [-739.340] (-741.094) (-741.503) * (-738.040) (-739.287) [-738.209] (-740.304) -- 0:00:25
537000 -- [-737.166] (-739.394) (-742.075) (-738.953) * [-740.475] (-737.722) (-739.540) (-739.040) -- 0:00:25
537500 -- (-737.220) (-739.315) (-740.139) [-737.447] * (-739.276) (-737.628) (-739.768) [-739.702] -- 0:00:24
538000 -- (-737.587) [-738.979] (-739.912) (-737.766) * [-738.102] (-737.148) (-739.211) (-741.043) -- 0:00:24
538500 -- (-737.976) (-737.446) (-740.085) [-739.696] * [-739.801] (-741.657) (-742.535) (-737.407) -- 0:00:24
539000 -- [-739.931] (-739.323) (-737.710) (-740.557) * (-738.333) (-740.667) [-737.597] (-741.199) -- 0:00:24
539500 -- [-738.778] (-738.170) (-740.449) (-738.045) * (-745.421) (-739.909) [-737.896] (-740.810) -- 0:00:25
540000 -- (-741.820) [-740.145] (-738.479) (-739.633) * (-743.940) (-744.309) [-738.146] (-740.567) -- 0:00:25
Average standard deviation of split frequencies: 0.017612
540500 -- [-741.310] (-738.597) (-742.032) (-746.843) * (-744.025) (-737.994) [-740.025] (-739.119) -- 0:00:25
541000 -- (-742.247) [-738.070] (-739.247) (-747.578) * (-739.470) (-737.632) (-738.287) [-737.420] -- 0:00:25
541500 -- (-743.074) (-738.546) (-740.834) [-745.231] * (-737.644) (-736.968) [-736.944] (-741.570) -- 0:00:25
542000 -- (-741.880) (-742.532) (-740.582) [-739.580] * (-737.051) [-742.309] (-739.632) (-739.271) -- 0:00:25
542500 -- (-739.570) (-744.341) [-745.747] (-738.533) * [-739.730] (-738.845) (-738.335) (-740.802) -- 0:00:25
543000 -- (-739.298) (-744.382) (-739.164) [-738.037] * (-740.662) (-740.529) (-741.579) [-740.166] -- 0:00:25
543500 -- (-739.749) (-742.709) (-740.721) [-739.153] * (-740.264) (-738.166) (-738.164) [-738.176] -- 0:00:25
544000 -- (-737.540) [-738.220] (-737.533) (-738.539) * (-742.136) [-738.519] (-737.254) (-742.932) -- 0:00:25
544500 -- [-738.014] (-738.964) (-739.372) (-737.629) * (-739.355) (-739.059) (-737.942) [-740.634] -- 0:00:25
545000 -- [-738.316] (-739.279) (-744.337) (-739.121) * [-742.893] (-738.415) (-738.478) (-738.902) -- 0:00:25
Average standard deviation of split frequencies: 0.017786
545500 -- (-739.918) (-738.038) [-740.852] (-739.852) * [-742.407] (-741.319) (-746.146) (-739.212) -- 0:00:24
546000 -- [-742.026] (-740.348) (-742.251) (-743.966) * (-740.011) (-741.044) [-740.205] (-738.817) -- 0:00:24
546500 -- (-739.674) [-738.705] (-743.817) (-743.176) * (-738.445) (-740.142) (-737.233) [-738.208] -- 0:00:24
547000 -- (-741.392) (-740.049) [-744.505] (-738.800) * (-738.909) (-739.211) [-737.701] (-740.334) -- 0:00:24
547500 -- (-738.738) (-740.209) [-738.594] (-740.252) * (-738.868) (-740.469) [-740.251] (-740.378) -- 0:00:24
548000 -- (-739.504) (-740.623) [-739.958] (-738.153) * (-738.453) [-740.351] (-740.152) (-740.043) -- 0:00:24
548500 -- (-739.689) [-740.513] (-740.607) (-742.119) * [-737.354] (-740.853) (-742.383) (-739.341) -- 0:00:24
549000 -- (-739.711) [-737.634] (-738.266) (-741.306) * (-737.881) [-738.104] (-740.594) (-739.285) -- 0:00:24
549500 -- [-739.635] (-738.434) (-740.255) (-737.450) * [-737.638] (-741.298) (-738.263) (-739.666) -- 0:00:24
550000 -- (-739.558) [-738.449] (-741.671) (-739.271) * [-738.247] (-739.194) (-741.544) (-739.327) -- 0:00:24
Average standard deviation of split frequencies: 0.017292
550500 -- (-739.154) (-739.470) (-741.808) [-738.641] * (-739.896) (-738.615) (-740.747) [-737.590] -- 0:00:24
551000 -- (-738.865) (-739.412) [-738.011] (-738.619) * (-738.616) (-737.150) [-739.523] (-738.984) -- 0:00:24
551500 -- [-737.623] (-741.545) (-740.179) (-738.916) * [-739.005] (-739.034) (-740.154) (-741.440) -- 0:00:24
552000 -- (-739.200) (-740.225) (-740.221) [-737.758] * (-741.655) [-740.834] (-737.247) (-739.360) -- 0:00:24
552500 -- (-739.893) [-738.185] (-739.783) (-738.572) * (-741.337) (-738.448) (-737.206) [-739.127] -- 0:00:24
553000 -- [-739.393] (-738.218) (-741.756) (-740.939) * (-745.952) (-737.126) (-737.977) [-740.570] -- 0:00:24
553500 -- (-738.219) [-737.318] (-740.056) (-737.455) * (-741.275) (-744.194) (-739.688) [-738.142] -- 0:00:24
554000 -- [-737.840] (-738.005) (-743.800) (-740.117) * [-741.774] (-740.560) (-739.400) (-738.728) -- 0:00:24
554500 -- [-739.068] (-737.699) (-740.083) (-738.810) * (-744.550) (-739.935) [-737.870] (-738.469) -- 0:00:24
555000 -- (-744.142) (-739.951) (-739.519) [-739.589] * (-742.145) (-742.620) (-737.806) [-737.676] -- 0:00:24
Average standard deviation of split frequencies: 0.016957
555500 -- (-738.140) [-741.561] (-746.793) (-738.820) * [-739.682] (-747.282) (-737.958) (-738.230) -- 0:00:24
556000 -- (-739.376) [-739.154] (-743.061) (-738.072) * [-738.613] (-740.650) (-737.848) (-741.049) -- 0:00:23
556500 -- (-739.322) (-738.654) (-738.628) [-739.904] * [-739.394] (-739.997) (-739.913) (-739.200) -- 0:00:23
557000 -- (-739.818) (-743.887) [-738.070] (-741.139) * [-737.234] (-742.599) (-741.291) (-741.462) -- 0:00:23
557500 -- (-738.585) (-743.958) [-738.953] (-742.265) * (-739.000) (-745.052) [-738.694] (-742.986) -- 0:00:23
558000 -- (-738.325) (-738.101) [-738.024] (-739.031) * (-740.178) [-741.963] (-739.151) (-737.697) -- 0:00:24
558500 -- (-738.109) (-739.279) (-737.015) [-743.378] * (-741.574) (-743.733) (-742.285) [-740.082] -- 0:00:24
559000 -- (-739.777) (-737.457) (-740.046) [-741.655] * (-741.114) (-742.316) (-747.289) [-739.531] -- 0:00:24
559500 -- (-738.191) (-740.493) [-738.370] (-743.984) * (-738.234) (-739.097) [-740.050] (-737.217) -- 0:00:24
560000 -- (-745.926) (-740.151) (-742.098) [-740.026] * (-737.619) (-737.674) (-748.222) [-737.967] -- 0:00:24
Average standard deviation of split frequencies: 0.015807
560500 -- [-737.757] (-743.145) (-737.304) (-738.822) * (-738.256) (-740.481) [-743.411] (-737.220) -- 0:00:24
561000 -- (-742.616) [-738.579] (-737.244) (-741.685) * (-740.851) (-738.832) [-740.032] (-741.475) -- 0:00:24
561500 -- (-738.950) [-737.589] (-737.669) (-739.489) * (-736.986) [-738.054] (-738.416) (-737.776) -- 0:00:24
562000 -- (-739.149) (-738.457) (-739.122) [-740.404] * (-738.377) [-737.821] (-741.818) (-740.083) -- 0:00:24
562500 -- [-737.549] (-739.270) (-740.040) (-737.642) * [-737.985] (-738.379) (-739.390) (-740.282) -- 0:00:24
563000 -- (-738.954) (-743.377) (-740.155) [-739.430] * [-738.054] (-737.114) (-739.942) (-738.272) -- 0:00:24
563500 -- [-739.187] (-739.656) (-746.080) (-744.195) * [-738.570] (-743.269) (-740.447) (-745.965) -- 0:00:24
564000 -- [-739.792] (-740.742) (-737.509) (-739.514) * (-740.723) (-739.710) (-743.905) [-741.544] -- 0:00:23
564500 -- (-738.188) (-740.416) (-740.608) [-741.305] * [-740.747] (-741.599) (-738.983) (-740.537) -- 0:00:23
565000 -- (-741.155) (-741.422) [-739.430] (-738.164) * (-737.669) [-739.080] (-740.193) (-739.569) -- 0:00:23
Average standard deviation of split frequencies: 0.015991
565500 -- [-738.570] (-739.814) (-746.325) (-739.698) * (-737.994) (-739.441) (-739.565) [-741.315] -- 0:00:23
566000 -- (-744.124) (-741.215) (-743.024) [-740.520] * (-737.906) (-737.693) [-741.850] (-738.964) -- 0:00:23
566500 -- (-739.104) [-739.077] (-737.764) (-739.539) * [-737.375] (-739.634) (-740.605) (-745.507) -- 0:00:23
567000 -- (-737.877) [-741.411] (-739.632) (-738.612) * [-740.066] (-738.958) (-740.802) (-740.237) -- 0:00:23
567500 -- [-738.104] (-743.865) (-739.764) (-737.912) * (-739.179) [-741.068] (-739.407) (-742.601) -- 0:00:23
568000 -- (-740.068) [-739.495] (-741.095) (-738.880) * [-737.202] (-739.904) (-741.762) (-743.431) -- 0:00:23
568500 -- (-741.875) (-738.111) (-741.042) [-740.212] * (-738.733) (-740.522) (-739.662) [-739.138] -- 0:00:23
569000 -- (-736.830) [-738.069] (-741.206) (-739.680) * [-738.697] (-741.429) (-740.435) (-741.524) -- 0:00:23
569500 -- (-738.677) (-737.179) [-742.249] (-739.347) * (-737.849) (-738.180) [-737.155] (-738.109) -- 0:00:23
570000 -- [-739.027] (-739.316) (-737.177) (-738.500) * (-739.551) (-739.693) (-739.758) [-739.623] -- 0:00:23
Average standard deviation of split frequencies: 0.015695
570500 -- (-737.536) (-737.425) (-738.223) [-738.435] * (-738.555) (-740.328) [-737.317] (-737.981) -- 0:00:23
571000 -- (-740.043) (-738.494) [-738.312] (-737.955) * (-738.610) (-738.740) (-738.755) [-737.998] -- 0:00:23
571500 -- (-737.348) (-741.334) [-737.909] (-738.257) * (-739.107) (-738.548) [-737.438] (-739.462) -- 0:00:23
572000 -- [-740.314] (-737.895) (-737.209) (-738.302) * [-740.413] (-743.821) (-740.635) (-738.935) -- 0:00:23
572500 -- (-740.949) (-743.831) (-737.130) [-739.566] * (-741.809) [-740.428] (-740.249) (-739.276) -- 0:00:23
573000 -- (-738.385) (-741.146) [-742.138] (-739.433) * (-737.307) (-740.150) [-739.821] (-739.054) -- 0:00:23
573500 -- (-738.171) (-739.944) [-739.934] (-738.242) * (-740.335) (-738.589) [-739.950] (-743.951) -- 0:00:23
574000 -- (-739.243) (-738.392) (-738.224) [-737.651] * (-747.399) (-740.068) (-743.387) [-740.997] -- 0:00:23
574500 -- (-742.531) (-737.569) [-739.467] (-744.334) * [-740.334] (-737.280) (-737.627) (-738.385) -- 0:00:22
575000 -- (-739.481) [-738.504] (-737.942) (-740.985) * (-740.353) (-737.603) [-738.057] (-740.205) -- 0:00:22
Average standard deviation of split frequencies: 0.015386
575500 -- [-739.897] (-738.818) (-739.247) (-739.274) * (-737.365) (-739.514) [-738.324] (-737.620) -- 0:00:22
576000 -- (-741.307) (-738.086) [-738.079] (-738.412) * [-737.073] (-743.110) (-737.454) (-738.196) -- 0:00:22
576500 -- (-739.344) (-738.028) (-739.271) [-738.065] * [-737.592] (-739.449) (-740.157) (-738.266) -- 0:00:23
577000 -- (-741.667) [-737.250] (-738.714) (-739.140) * (-741.894) [-739.295] (-739.546) (-740.447) -- 0:00:23
577500 -- (-740.799) (-740.138) [-737.544] (-741.707) * (-743.209) [-737.591] (-741.695) (-742.778) -- 0:00:23
578000 -- (-738.924) (-740.702) [-737.504] (-738.792) * [-742.056] (-737.888) (-741.028) (-738.022) -- 0:00:23
578500 -- (-739.903) (-740.501) (-740.099) [-737.696] * (-739.098) (-739.602) (-739.043) [-737.730] -- 0:00:23
579000 -- (-739.413) (-737.887) [-740.674] (-739.473) * [-739.306] (-740.380) (-742.369) (-739.730) -- 0:00:23
579500 -- (-739.374) [-739.274] (-738.825) (-739.395) * [-739.227] (-742.673) (-739.099) (-738.849) -- 0:00:23
580000 -- [-740.725] (-739.825) (-739.839) (-738.721) * (-738.783) (-739.047) [-738.878] (-738.112) -- 0:00:23
Average standard deviation of split frequencies: 0.015262
580500 -- (-738.705) [-740.350] (-743.286) (-743.023) * (-738.739) [-739.773] (-737.018) (-741.313) -- 0:00:23
581000 -- (-737.188) (-740.470) (-737.788) [-741.511] * [-740.765] (-739.744) (-739.755) (-739.382) -- 0:00:23
581500 -- (-739.791) (-740.723) (-738.107) [-742.111] * [-740.748] (-738.923) (-740.598) (-740.540) -- 0:00:23
582000 -- [-742.945] (-741.609) (-740.691) (-738.734) * (-743.467) [-739.615] (-739.168) (-743.545) -- 0:00:22
582500 -- (-737.193) (-737.560) (-739.029) [-737.544] * [-737.944] (-737.396) (-741.779) (-740.541) -- 0:00:22
583000 -- (-737.759) (-738.351) [-741.307] (-737.621) * (-739.598) (-739.866) [-743.442] (-739.701) -- 0:00:22
583500 -- (-738.100) (-742.964) (-742.683) [-738.153] * (-738.357) (-740.857) [-739.177] (-741.267) -- 0:00:22
584000 -- (-737.586) (-738.195) [-741.081] (-737.691) * (-738.329) [-738.264] (-738.207) (-739.221) -- 0:00:22
584500 -- (-740.856) (-739.103) [-738.108] (-740.036) * (-737.486) (-737.118) (-737.687) [-737.423] -- 0:00:22
585000 -- [-741.114] (-743.893) (-746.881) (-740.228) * (-737.436) (-738.299) [-738.046] (-737.292) -- 0:00:22
Average standard deviation of split frequencies: 0.015284
585500 -- (-738.680) [-738.018] (-746.438) (-738.321) * (-737.482) (-737.978) (-738.465) [-741.335] -- 0:00:22
586000 -- (-743.922) (-738.659) (-742.790) [-737.425] * (-737.794) (-737.809) (-738.980) [-739.638] -- 0:00:22
586500 -- (-738.870) (-738.763) (-740.682) [-737.371] * (-737.608) (-737.418) [-738.164] (-738.549) -- 0:00:22
587000 -- (-741.777) [-737.818] (-740.664) (-740.962) * (-736.926) (-737.669) (-737.168) [-738.994] -- 0:00:22
587500 -- (-740.143) [-740.845] (-740.044) (-737.987) * [-738.405] (-740.336) (-737.732) (-737.770) -- 0:00:22
588000 -- (-743.273) (-742.971) [-739.872] (-739.076) * [-740.445] (-739.356) (-738.582) (-738.425) -- 0:00:22
588500 -- (-738.975) [-738.119] (-740.391) (-741.627) * [-743.673] (-737.954) (-739.259) (-738.926) -- 0:00:22
589000 -- (-739.092) (-741.617) (-739.551) [-737.799] * [-745.184] (-737.802) (-740.570) (-739.431) -- 0:00:22
589500 -- [-739.995] (-739.979) (-738.257) (-737.729) * (-743.357) (-739.242) [-737.836] (-739.878) -- 0:00:22
590000 -- (-744.217) (-740.414) (-737.772) [-740.596] * (-738.339) [-736.969] (-738.996) (-742.164) -- 0:00:22
Average standard deviation of split frequencies: 0.015802
590500 -- (-737.626) (-739.925) [-737.270] (-739.047) * [-737.963] (-738.858) (-742.106) (-740.511) -- 0:00:22
591000 -- (-742.480) [-740.358] (-738.363) (-739.082) * [-738.418] (-740.282) (-740.308) (-742.066) -- 0:00:22
591500 -- (-739.795) [-741.752] (-737.538) (-737.622) * (-741.503) [-739.783] (-738.301) (-740.582) -- 0:00:22
592000 -- (-740.569) (-741.179) (-740.670) [-737.822] * (-742.829) [-742.777] (-740.721) (-737.300) -- 0:00:22
592500 -- (-738.417) [-739.670] (-738.144) (-739.960) * (-738.394) (-738.674) (-741.851) [-738.436] -- 0:00:22
593000 -- (-738.685) (-738.128) [-743.672] (-739.804) * (-737.936) [-738.740] (-741.193) (-742.362) -- 0:00:21
593500 -- (-739.626) (-742.644) (-740.097) [-739.766] * (-737.466) [-737.522] (-739.361) (-739.947) -- 0:00:21
594000 -- (-739.236) (-738.753) [-741.592] (-739.459) * (-740.131) (-740.473) [-738.724] (-739.528) -- 0:00:21
594500 -- [-738.315] (-739.165) (-739.679) (-737.351) * (-741.704) (-741.668) (-739.794) [-740.755] -- 0:00:21
595000 -- (-738.040) (-740.322) [-740.939] (-744.228) * (-740.912) (-744.790) (-738.994) [-739.461] -- 0:00:22
Average standard deviation of split frequencies: 0.015503
595500 -- (-740.048) (-739.016) (-737.966) [-738.413] * [-737.017] (-743.352) (-739.320) (-737.917) -- 0:00:22
596000 -- (-744.933) (-740.639) (-737.915) [-739.752] * [-737.427] (-744.356) (-738.906) (-739.354) -- 0:00:22
596500 -- [-737.409] (-742.571) (-738.131) (-740.871) * (-738.310) [-740.996] (-742.355) (-746.462) -- 0:00:22
597000 -- (-738.697) [-738.835] (-738.131) (-741.240) * (-737.930) (-741.705) [-740.266] (-738.648) -- 0:00:22
597500 -- (-739.237) [-739.950] (-739.416) (-737.705) * (-738.100) (-742.990) (-739.881) [-740.686] -- 0:00:22
598000 -- (-745.886) [-738.347] (-739.548) (-738.953) * (-739.219) (-740.785) (-744.636) [-738.472] -- 0:00:22
598500 -- (-737.883) [-737.070] (-741.778) (-737.917) * (-742.008) (-741.177) [-737.371] (-742.380) -- 0:00:22
599000 -- [-737.944] (-740.284) (-740.759) (-740.359) * (-739.979) (-738.690) [-740.319] (-738.440) -- 0:00:22
599500 -- (-738.445) [-740.770] (-743.766) (-738.046) * (-739.773) (-740.571) (-742.913) [-737.531] -- 0:00:22
600000 -- [-738.247] (-738.458) (-739.799) (-739.388) * (-741.953) (-739.026) (-741.862) [-737.520] -- 0:00:22
Average standard deviation of split frequencies: 0.014440
600500 -- (-742.055) (-738.601) [-741.592] (-741.498) * (-739.991) [-743.618] (-738.435) (-738.448) -- 0:00:21
601000 -- (-740.011) (-738.780) (-737.542) [-746.697] * (-739.763) (-738.008) (-742.264) [-738.690] -- 0:00:21
601500 -- (-745.182) [-737.674] (-739.597) (-737.558) * (-738.278) (-743.753) (-739.628) [-737.132] -- 0:00:21
602000 -- [-738.266] (-739.045) (-739.168) (-740.459) * (-737.234) (-740.226) (-740.367) [-738.341] -- 0:00:21
602500 -- (-739.093) [-739.391] (-740.994) (-740.276) * (-738.140) (-737.452) (-740.740) [-740.385] -- 0:00:21
603000 -- [-738.665] (-739.372) (-742.033) (-740.187) * [-739.637] (-738.685) (-740.812) (-741.452) -- 0:00:21
603500 -- [-739.717] (-740.498) (-740.785) (-740.178) * (-738.457) (-740.354) [-737.708] (-739.626) -- 0:00:21
604000 -- (-740.364) [-740.813] (-744.196) (-737.719) * [-739.524] (-741.163) (-737.894) (-740.722) -- 0:00:21
604500 -- [-741.527] (-737.516) (-739.760) (-738.063) * [-740.009] (-741.000) (-739.258) (-741.048) -- 0:00:21
605000 -- (-740.287) (-738.785) (-737.748) [-741.170] * (-748.415) (-739.693) [-737.467] (-738.825) -- 0:00:21
Average standard deviation of split frequencies: 0.014002
605500 -- (-739.244) (-740.684) (-740.985) [-748.039] * [-737.612] (-738.583) (-738.315) (-740.411) -- 0:00:21
606000 -- (-737.271) (-739.127) [-741.234] (-748.713) * (-739.970) [-737.304] (-740.675) (-738.016) -- 0:00:21
606500 -- (-737.679) (-741.251) [-738.959] (-744.776) * (-739.641) [-737.617] (-740.230) (-738.242) -- 0:00:21
607000 -- [-739.421] (-740.418) (-737.512) (-737.748) * (-739.236) (-738.687) (-738.165) [-744.519] -- 0:00:21
607500 -- (-741.055) (-741.087) [-738.612] (-737.982) * (-740.343) (-740.835) [-738.956] (-738.420) -- 0:00:21
608000 -- (-740.626) (-737.799) (-740.490) [-738.199] * [-737.978] (-739.740) (-739.435) (-740.116) -- 0:00:21
608500 -- (-739.990) [-740.038] (-741.217) (-738.502) * (-738.619) [-739.428] (-737.638) (-738.413) -- 0:00:21
609000 -- (-738.305) [-738.271] (-739.075) (-739.535) * (-738.006) (-740.848) (-737.553) [-737.325] -- 0:00:21
609500 -- (-740.849) [-739.196] (-739.197) (-737.142) * (-737.407) [-738.518] (-739.339) (-740.543) -- 0:00:21
610000 -- (-739.781) [-738.844] (-740.280) (-737.915) * [-739.925] (-737.573) (-740.016) (-741.420) -- 0:00:21
Average standard deviation of split frequencies: 0.014204
610500 -- (-740.572) (-740.804) [-740.557] (-739.023) * (-738.820) (-737.925) [-737.664] (-738.799) -- 0:00:21
611000 -- (-737.819) (-737.328) [-741.764] (-740.190) * [-739.807] (-737.608) (-742.185) (-742.565) -- 0:00:21
611500 -- (-737.886) [-737.007] (-740.696) (-740.038) * [-739.612] (-740.275) (-737.807) (-741.356) -- 0:00:20
612000 -- (-740.441) (-737.142) [-740.897] (-740.565) * (-738.353) [-738.107] (-741.034) (-739.622) -- 0:00:20
612500 -- (-742.797) (-737.071) (-739.700) [-742.451] * (-738.455) (-738.436) (-741.293) [-741.238] -- 0:00:20
613000 -- (-739.465) (-737.928) [-741.717] (-738.785) * (-739.308) [-737.378] (-740.275) (-741.301) -- 0:00:20
613500 -- [-740.187] (-739.868) (-741.871) (-739.778) * (-738.887) (-741.827) [-739.628] (-738.905) -- 0:00:21
614000 -- (-738.384) (-742.358) [-740.649] (-738.572) * (-738.835) [-738.174] (-740.892) (-738.376) -- 0:00:21
614500 -- (-737.884) (-738.745) (-740.243) [-740.430] * (-739.241) (-737.316) [-739.171] (-740.564) -- 0:00:21
615000 -- (-738.945) [-737.899] (-743.543) (-739.414) * [-739.473] (-737.789) (-740.397) (-740.864) -- 0:00:21
Average standard deviation of split frequencies: 0.013622
615500 -- (-740.672) (-739.537) (-742.859) [-737.659] * (-740.404) [-737.619] (-737.691) (-739.092) -- 0:00:21
616000 -- (-739.209) (-740.222) [-738.837] (-740.437) * [-738.804] (-739.156) (-737.829) (-740.023) -- 0:00:21
616500 -- (-738.226) [-740.420] (-740.201) (-739.755) * (-739.076) (-738.689) (-737.641) [-737.942] -- 0:00:21
617000 -- (-737.346) [-739.757] (-738.906) (-740.534) * [-742.214] (-740.355) (-738.593) (-739.223) -- 0:00:21
617500 -- [-737.369] (-737.578) (-741.259) (-738.306) * (-741.922) (-738.797) (-738.085) [-738.022] -- 0:00:21
618000 -- (-742.861) [-738.353] (-738.937) (-738.141) * (-740.871) [-738.267] (-738.519) (-741.955) -- 0:00:21
618500 -- [-741.348] (-744.391) (-738.521) (-738.483) * (-739.196) (-737.603) (-742.587) [-737.312] -- 0:00:20
619000 -- [-739.546] (-737.607) (-739.430) (-739.621) * [-737.380] (-739.873) (-741.144) (-741.991) -- 0:00:20
619500 -- (-742.318) [-738.330] (-742.242) (-741.514) * (-739.240) (-738.746) [-737.784] (-738.559) -- 0:00:20
620000 -- (-738.029) [-737.891] (-739.970) (-740.553) * (-738.683) (-738.668) (-739.734) [-738.809] -- 0:00:20
Average standard deviation of split frequencies: 0.012760
620500 -- (-738.661) (-737.483) [-740.305] (-739.759) * (-740.380) (-741.022) [-745.961] (-741.187) -- 0:00:20
621000 -- (-739.047) (-738.793) (-737.890) [-740.890] * (-742.883) [-740.333] (-742.235) (-739.844) -- 0:00:20
621500 -- (-739.306) (-741.634) (-739.916) [-737.083] * (-740.341) [-740.236] (-742.544) (-737.942) -- 0:00:20
622000 -- (-741.242) (-740.646) (-742.770) [-740.404] * (-739.390) [-740.971] (-743.847) (-738.169) -- 0:00:20
622500 -- (-738.278) [-740.185] (-739.070) (-738.817) * (-739.393) [-741.478] (-737.756) (-740.249) -- 0:00:20
623000 -- [-738.695] (-740.985) (-737.981) (-737.613) * (-737.362) (-743.318) (-740.111) [-738.575] -- 0:00:20
623500 -- [-742.497] (-738.898) (-738.494) (-739.034) * (-743.247) (-738.932) [-738.851] (-738.307) -- 0:00:20
624000 -- (-738.679) (-740.019) [-740.960] (-737.199) * [-740.325] (-743.057) (-739.582) (-741.626) -- 0:00:20
624500 -- [-742.195] (-740.797) (-741.320) (-738.289) * (-739.169) (-740.125) (-739.229) [-738.040] -- 0:00:20
625000 -- (-738.689) (-740.938) [-738.195] (-739.051) * (-739.654) [-742.758] (-740.579) (-738.415) -- 0:00:20
Average standard deviation of split frequencies: 0.012952
625500 -- (-740.083) (-740.044) (-738.766) [-739.051] * (-742.555) (-742.599) [-738.854] (-739.450) -- 0:00:20
626000 -- [-739.881] (-741.176) (-739.583) (-745.690) * (-738.501) [-741.856] (-737.677) (-737.708) -- 0:00:20
626500 -- (-740.041) (-738.400) [-737.694] (-739.006) * (-739.180) (-741.709) [-738.348] (-738.517) -- 0:00:20
627000 -- (-743.614) (-738.816) [-737.808] (-739.734) * (-738.440) (-742.193) (-737.245) [-739.372] -- 0:00:20
627500 -- (-742.822) (-738.736) [-738.803] (-739.082) * (-740.763) (-742.111) [-738.595] (-737.974) -- 0:00:20
628000 -- (-741.160) (-738.919) (-736.925) [-738.467] * [-739.620] (-740.633) (-739.151) (-738.283) -- 0:00:20
628500 -- [-741.175] (-739.111) (-737.537) (-738.846) * (-740.710) (-740.613) [-737.726] (-746.646) -- 0:00:20
629000 -- (-742.070) (-737.840) [-741.951] (-737.991) * (-741.185) (-738.946) [-738.425] (-738.871) -- 0:00:20
629500 -- [-737.782] (-736.916) (-739.777) (-738.537) * [-740.656] (-742.657) (-741.717) (-742.406) -- 0:00:20
630000 -- (-737.835) (-742.951) (-739.727) [-738.894] * (-738.984) (-743.939) (-737.070) [-745.244] -- 0:00:19
Average standard deviation of split frequencies: 0.013305
630500 -- [-738.650] (-741.549) (-740.532) (-739.942) * (-737.882) (-738.864) [-739.399] (-741.775) -- 0:00:19
631000 -- [-737.687] (-742.044) (-740.690) (-739.065) * (-739.398) [-739.419] (-740.372) (-739.809) -- 0:00:19
631500 -- [-737.008] (-739.585) (-740.972) (-738.603) * (-738.721) (-738.441) [-738.727] (-737.342) -- 0:00:19
632000 -- (-738.722) (-738.804) [-743.536] (-738.906) * (-737.161) (-738.966) [-738.185] (-739.556) -- 0:00:20
632500 -- [-740.133] (-737.847) (-739.127) (-745.989) * (-739.358) (-739.389) (-739.751) [-741.616] -- 0:00:20
633000 -- (-738.415) [-739.865] (-737.935) (-742.602) * (-741.158) [-741.930] (-737.650) (-740.504) -- 0:00:20
633500 -- (-738.738) [-738.476] (-739.858) (-738.178) * (-740.733) (-740.474) [-738.349] (-741.408) -- 0:00:20
634000 -- (-741.016) (-741.317) [-742.105] (-740.472) * (-739.491) (-741.908) (-737.155) [-739.460] -- 0:00:20
634500 -- (-740.986) [-740.802] (-738.893) (-740.217) * (-739.845) (-737.635) [-737.823] (-738.888) -- 0:00:20
635000 -- (-738.449) (-742.582) [-742.075] (-737.320) * (-741.014) (-744.836) (-737.311) [-737.544] -- 0:00:20
Average standard deviation of split frequencies: 0.013193
635500 -- [-738.266] (-739.572) (-738.689) (-738.665) * [-738.220] (-737.988) (-741.976) (-739.575) -- 0:00:20
636000 -- (-738.103) (-744.097) [-737.780] (-737.993) * (-749.829) (-739.211) (-738.210) [-737.763] -- 0:00:20
636500 -- [-739.511] (-742.398) (-737.256) (-751.659) * (-742.905) (-738.288) [-739.213] (-738.089) -- 0:00:19
637000 -- [-739.154] (-739.907) (-739.307) (-743.130) * (-737.897) (-739.613) [-739.085] (-739.424) -- 0:00:19
637500 -- (-741.179) (-738.555) (-740.315) [-740.935] * (-742.474) (-738.660) (-739.736) [-737.336] -- 0:00:19
638000 -- (-738.154) (-741.897) (-741.484) [-742.284] * (-737.903) (-740.552) [-738.805] (-739.704) -- 0:00:19
638500 -- [-739.946] (-739.446) (-739.706) (-740.371) * (-739.318) [-741.933] (-738.376) (-740.224) -- 0:00:19
639000 -- (-743.568) (-739.033) (-741.187) [-738.299] * (-738.856) (-741.142) [-737.241] (-737.528) -- 0:00:19
639500 -- [-737.746] (-742.961) (-741.202) (-738.937) * (-739.899) (-739.463) (-740.154) [-737.836] -- 0:00:19
640000 -- (-738.446) (-740.799) (-742.745) [-740.910] * (-742.256) (-741.973) [-741.178] (-747.572) -- 0:00:19
Average standard deviation of split frequencies: 0.013686
640500 -- [-741.535] (-737.902) (-740.339) (-738.115) * (-741.006) [-742.873] (-740.119) (-746.466) -- 0:00:19
641000 -- (-739.013) (-741.352) (-745.115) [-738.858] * (-741.619) [-737.212] (-739.387) (-739.657) -- 0:00:19
641500 -- (-739.128) (-737.762) [-737.296] (-739.478) * (-740.380) (-739.749) [-739.998] (-738.445) -- 0:00:19
642000 -- (-739.576) [-738.889] (-737.616) (-738.520) * [-738.418] (-741.334) (-740.126) (-738.497) -- 0:00:19
642500 -- (-739.124) [-738.804] (-738.421) (-739.825) * (-741.735) (-737.865) (-738.797) [-738.612] -- 0:00:19
643000 -- [-739.141] (-737.993) (-740.110) (-743.996) * (-741.105) [-738.661] (-741.944) (-738.158) -- 0:00:19
643500 -- (-739.975) (-739.331) [-740.432] (-740.010) * (-740.545) [-739.569] (-738.745) (-738.415) -- 0:00:19
644000 -- [-740.648] (-739.922) (-737.989) (-741.154) * (-739.622) (-738.225) [-743.309] (-736.860) -- 0:00:19
644500 -- (-740.499) (-740.816) [-739.000] (-737.666) * (-738.842) [-738.896] (-741.938) (-739.191) -- 0:00:19
645000 -- (-738.665) (-737.506) [-741.265] (-740.447) * [-738.581] (-738.875) (-738.416) (-737.330) -- 0:00:19
Average standard deviation of split frequencies: 0.014303
645500 -- (-740.564) [-739.628] (-738.511) (-737.085) * [-737.085] (-743.958) (-738.561) (-738.012) -- 0:00:19
646000 -- (-740.804) (-737.435) [-739.393] (-737.408) * (-737.119) [-739.985] (-737.793) (-746.030) -- 0:00:19
646500 -- (-741.988) [-737.541] (-738.259) (-737.942) * (-738.108) (-740.478) [-737.486] (-739.273) -- 0:00:19
647000 -- (-740.451) (-738.757) [-738.520] (-738.738) * (-738.275) (-742.110) (-741.902) [-739.977] -- 0:00:19
647500 -- (-739.426) (-738.537) [-737.898] (-737.957) * (-737.821) (-741.810) (-737.790) [-738.590] -- 0:00:19
648000 -- [-738.445] (-738.975) (-737.580) (-737.413) * (-739.561) (-741.227) (-737.896) [-739.435] -- 0:00:19
648500 -- (-738.624) (-739.773) (-742.240) [-738.366] * (-738.421) [-741.257] (-737.230) (-740.917) -- 0:00:18
649000 -- (-738.341) (-742.503) (-739.612) [-739.680] * (-739.392) (-739.766) (-738.163) [-741.199] -- 0:00:18
649500 -- (-739.554) [-747.312] (-743.031) (-743.517) * (-740.658) [-741.442] (-741.018) (-740.674) -- 0:00:18
650000 -- (-737.919) (-738.818) [-738.225] (-746.937) * (-740.415) (-738.647) [-740.964] (-738.428) -- 0:00:18
Average standard deviation of split frequencies: 0.013331
650500 -- (-737.493) [-740.422] (-739.800) (-738.561) * (-740.983) [-739.217] (-737.305) (-738.969) -- 0:00:19
651000 -- (-737.014) [-739.809] (-739.224) (-737.838) * (-740.169) [-741.156] (-742.011) (-738.359) -- 0:00:19
651500 -- [-744.227] (-740.574) (-740.890) (-737.860) * [-737.228] (-749.154) (-739.557) (-743.613) -- 0:00:19
652000 -- (-739.755) [-738.106] (-740.567) (-741.728) * (-738.437) (-742.576) [-738.832] (-737.592) -- 0:00:19
652500 -- [-742.765] (-739.068) (-738.757) (-740.629) * (-740.418) (-741.591) (-741.631) [-737.582] -- 0:00:19
653000 -- (-741.910) [-738.765] (-737.716) (-740.482) * (-737.741) (-740.006) [-738.290] (-738.090) -- 0:00:19
653500 -- (-741.143) (-738.574) (-739.257) [-737.819] * (-737.986) [-737.559] (-739.610) (-738.306) -- 0:00:19
654000 -- [-739.479] (-738.653) (-738.780) (-740.909) * (-743.728) (-737.625) [-740.771] (-738.000) -- 0:00:19
654500 -- [-739.891] (-737.545) (-739.950) (-738.031) * (-740.181) [-739.465] (-738.744) (-738.718) -- 0:00:19
655000 -- (-739.980) [-740.859] (-740.808) (-738.144) * [-744.496] (-738.084) (-738.043) (-742.002) -- 0:00:18
Average standard deviation of split frequencies: 0.012935
655500 -- [-740.775] (-738.608) (-740.630) (-738.459) * (-741.909) (-742.396) (-741.054) [-738.226] -- 0:00:18
656000 -- [-738.859] (-739.585) (-738.424) (-739.857) * [-741.176] (-738.752) (-741.299) (-738.795) -- 0:00:18
656500 -- (-741.163) [-739.459] (-741.653) (-737.218) * [-740.834] (-740.694) (-738.828) (-741.411) -- 0:00:18
657000 -- [-740.156] (-739.723) (-739.113) (-741.307) * (-739.643) (-742.344) [-741.297] (-742.231) -- 0:00:18
657500 -- [-738.761] (-737.973) (-740.938) (-738.254) * (-737.825) (-738.165) (-739.994) [-739.030] -- 0:00:18
658000 -- (-738.627) (-740.790) (-744.020) [-738.371] * (-740.731) [-737.223] (-741.249) (-736.972) -- 0:00:18
658500 -- (-740.454) [-740.713] (-748.153) (-740.546) * (-738.664) [-737.517] (-738.053) (-739.606) -- 0:00:18
659000 -- (-740.023) (-739.016) (-738.454) [-739.979] * (-738.794) (-737.899) (-739.686) [-740.948] -- 0:00:18
659500 -- (-740.661) (-738.421) [-738.341] (-739.362) * (-738.760) [-737.390] (-738.961) (-742.831) -- 0:00:18
660000 -- (-738.004) (-740.549) [-738.989] (-738.205) * (-740.360) [-738.018] (-737.742) (-741.454) -- 0:00:18
Average standard deviation of split frequencies: 0.013557
660500 -- (-739.097) (-740.600) [-738.941] (-737.221) * (-737.951) (-741.211) [-738.074] (-739.221) -- 0:00:18
661000 -- (-737.711) (-738.204) [-738.515] (-737.910) * (-737.865) [-737.128] (-737.648) (-737.762) -- 0:00:18
661500 -- (-738.885) [-740.511] (-737.693) (-740.993) * (-738.314) [-739.466] (-740.348) (-737.828) -- 0:00:18
662000 -- (-738.607) (-739.563) (-738.474) [-738.181] * (-738.745) [-740.614] (-738.060) (-739.967) -- 0:00:18
662500 -- (-739.236) (-737.853) [-740.020] (-739.171) * (-738.007) (-743.704) [-738.855] (-740.192) -- 0:00:18
663000 -- (-739.171) (-739.403) (-737.078) [-738.626] * (-739.917) (-743.128) [-738.642] (-738.907) -- 0:00:18
663500 -- (-738.457) (-738.728) (-737.748) [-737.513] * [-738.847] (-738.156) (-737.854) (-736.903) -- 0:00:18
664000 -- (-738.508) (-737.401) [-737.491] (-740.224) * (-738.393) (-739.259) (-739.042) [-737.684] -- 0:00:18
664500 -- (-739.100) (-738.736) (-737.391) [-741.604] * [-740.484] (-739.317) (-738.424) (-740.794) -- 0:00:18
665000 -- (-738.643) (-737.864) (-740.951) [-738.664] * (-739.284) (-742.051) (-741.315) [-740.188] -- 0:00:18
Average standard deviation of split frequencies: 0.013165
665500 -- (-738.160) (-740.580) (-739.883) [-737.745] * (-741.182) (-738.264) (-740.603) [-737.101] -- 0:00:18
666000 -- (-739.361) [-738.898] (-740.176) (-739.155) * [-738.815] (-739.213) (-737.712) (-740.533) -- 0:00:18
666500 -- (-737.926) (-741.199) (-740.340) [-740.550] * (-741.437) (-739.054) (-741.598) [-739.087] -- 0:00:18
667000 -- (-738.091) [-739.009] (-742.479) (-743.188) * (-738.717) [-738.356] (-737.924) (-738.871) -- 0:00:17
667500 -- (-738.346) (-739.290) (-739.372) [-737.267] * (-740.236) (-740.575) (-742.404) [-738.137] -- 0:00:17
668000 -- (-738.496) (-741.040) [-737.942] (-737.811) * (-737.691) (-739.906) (-740.578) [-742.918] -- 0:00:17
668500 -- (-739.926) [-739.804] (-741.579) (-737.553) * [-737.635] (-741.667) (-740.657) (-741.545) -- 0:00:17
669000 -- (-741.296) (-742.202) (-741.609) [-737.818] * (-737.786) [-739.153] (-738.370) (-740.767) -- 0:00:18
669500 -- (-739.513) (-738.132) (-737.722) [-737.712] * (-738.736) [-740.123] (-738.938) (-742.060) -- 0:00:18
670000 -- [-738.396] (-738.639) (-738.706) (-739.506) * [-739.034] (-740.491) (-741.072) (-740.709) -- 0:00:18
Average standard deviation of split frequencies: 0.013917
670500 -- (-741.032) [-738.021] (-738.326) (-739.301) * (-739.777) (-743.419) (-739.111) [-737.363] -- 0:00:18
671000 -- [-740.510] (-739.297) (-741.697) (-740.752) * (-737.449) (-737.582) (-738.539) [-737.777] -- 0:00:18
671500 -- [-743.325] (-739.290) (-737.899) (-739.033) * [-743.636] (-738.152) (-737.938) (-739.852) -- 0:00:18
672000 -- [-742.175] (-740.125) (-739.844) (-737.998) * (-739.319) (-737.200) (-737.283) [-738.502] -- 0:00:18
672500 -- [-740.462] (-740.892) (-738.427) (-739.426) * (-739.169) (-737.337) (-737.922) [-738.460] -- 0:00:18
673000 -- (-742.656) [-742.791] (-738.377) (-740.334) * (-737.288) (-742.871) (-738.888) [-738.214] -- 0:00:17
673500 -- (-743.873) (-737.930) (-740.044) [-738.953] * [-739.411] (-737.890) (-740.705) (-740.511) -- 0:00:17
674000 -- (-743.641) [-739.065] (-739.901) (-737.772) * (-741.098) (-738.995) (-745.002) [-738.378] -- 0:00:17
674500 -- (-741.434) (-740.713) (-741.642) [-737.139] * (-738.663) (-737.926) [-738.719] (-739.123) -- 0:00:17
675000 -- (-742.373) (-737.342) [-737.957] (-738.130) * (-740.414) (-737.178) (-740.027) [-738.210] -- 0:00:17
Average standard deviation of split frequencies: 0.014226
675500 -- [-741.521] (-737.634) (-743.101) (-741.066) * (-742.151) (-737.716) (-739.960) [-739.066] -- 0:00:17
676000 -- (-739.532) (-740.534) [-739.498] (-738.399) * (-743.439) (-738.456) (-739.530) [-737.878] -- 0:00:17
676500 -- (-739.423) (-741.922) [-738.444] (-738.498) * (-741.175) (-739.251) [-737.589] (-738.698) -- 0:00:17
677000 -- (-741.062) (-739.689) (-740.758) [-741.054] * (-740.873) (-740.720) (-739.925) [-738.963] -- 0:00:17
677500 -- (-737.933) [-738.343] (-738.167) (-738.677) * [-739.135] (-740.632) (-738.637) (-738.667) -- 0:00:17
678000 -- [-739.658] (-738.350) (-738.656) (-738.470) * [-739.837] (-739.448) (-739.959) (-738.544) -- 0:00:17
678500 -- (-741.310) (-738.078) [-737.534] (-740.344) * [-739.041] (-743.989) (-738.335) (-738.539) -- 0:00:17
679000 -- (-738.086) (-738.924) (-738.339) [-738.320] * (-742.565) (-739.227) (-739.350) [-737.890] -- 0:00:17
679500 -- (-741.483) (-739.234) [-738.133] (-739.459) * (-737.421) [-738.271] (-739.986) (-739.551) -- 0:00:17
680000 -- [-738.659] (-740.243) (-738.079) (-738.424) * (-740.210) (-738.280) (-739.822) [-739.311] -- 0:00:17
Average standard deviation of split frequencies: 0.013851
680500 -- (-741.127) (-739.462) (-741.141) [-737.845] * (-739.200) (-739.496) (-739.487) [-739.342] -- 0:00:17
681000 -- [-739.147] (-739.266) (-741.239) (-740.029) * (-738.565) (-740.445) (-739.710) [-742.536] -- 0:00:17
681500 -- (-742.574) (-740.613) [-738.856] (-738.689) * (-739.409) [-740.952] (-737.878) (-740.433) -- 0:00:17
682000 -- (-740.391) (-738.757) [-738.115] (-737.697) * (-743.261) (-737.934) (-737.967) [-741.379] -- 0:00:17
682500 -- (-741.524) [-738.877] (-738.724) (-738.256) * (-742.606) [-737.970] (-740.346) (-741.608) -- 0:00:17
683000 -- (-740.089) (-738.448) (-737.305) [-738.494] * [-737.434] (-741.768) (-741.019) (-738.914) -- 0:00:17
683500 -- (-738.790) [-738.813] (-738.840) (-741.002) * [-743.769] (-744.639) (-737.862) (-740.010) -- 0:00:17
684000 -- (-738.470) [-738.642] (-743.601) (-739.479) * (-738.877) [-742.580] (-738.009) (-738.599) -- 0:00:17
684500 -- [-737.954] (-742.162) (-741.496) (-737.688) * [-739.252] (-741.439) (-745.294) (-739.025) -- 0:00:17
685000 -- [-740.020] (-740.283) (-737.011) (-740.991) * (-739.492) (-739.886) (-746.376) [-744.252] -- 0:00:17
Average standard deviation of split frequencies: 0.014018
685500 -- (-746.100) [-738.082] (-741.056) (-741.487) * [-737.623] (-738.992) (-742.041) (-741.335) -- 0:00:16
686000 -- (-740.863) [-741.763] (-740.300) (-742.958) * [-737.867] (-737.022) (-739.445) (-747.794) -- 0:00:16
686500 -- (-738.002) [-739.828] (-739.629) (-739.929) * (-738.729) [-740.918] (-742.690) (-740.298) -- 0:00:16
687000 -- [-737.893] (-737.303) (-737.679) (-737.009) * (-740.618) (-737.981) (-739.146) [-738.447] -- 0:00:16
687500 -- (-738.835) (-737.813) (-738.805) [-738.234] * (-743.879) (-739.997) (-737.338) [-738.846] -- 0:00:16
688000 -- [-740.540] (-739.330) (-739.148) (-737.462) * (-740.443) [-738.675] (-741.350) (-737.529) -- 0:00:17
688500 -- (-740.523) [-738.036] (-738.842) (-739.265) * (-741.659) (-739.594) [-739.705] (-737.731) -- 0:00:17
689000 -- [-737.311] (-739.877) (-738.194) (-738.565) * [-736.917] (-737.951) (-740.070) (-743.392) -- 0:00:17
689500 -- [-737.960] (-738.850) (-737.012) (-743.340) * (-739.557) (-739.004) [-739.078] (-737.830) -- 0:00:17
690000 -- (-740.767) (-739.204) (-743.043) [-738.424] * [-738.281] (-739.648) (-739.652) (-739.890) -- 0:00:17
Average standard deviation of split frequencies: 0.013378
690500 -- (-742.242) (-739.987) (-737.196) [-738.045] * (-740.882) (-739.822) [-739.012] (-743.992) -- 0:00:17
691000 -- (-739.956) [-739.901] (-738.579) (-738.316) * (-739.587) (-740.071) (-738.869) [-737.796] -- 0:00:16
691500 -- [-737.100] (-743.975) (-739.602) (-741.957) * (-738.493) (-740.344) (-739.308) [-738.316] -- 0:00:16
692000 -- (-738.006) [-739.931] (-737.883) (-739.485) * [-737.871] (-742.760) (-737.974) (-739.819) -- 0:00:16
692500 -- (-737.558) [-738.209] (-740.061) (-745.816) * [-737.787] (-743.499) (-737.242) (-737.255) -- 0:00:16
693000 -- (-740.664) (-740.296) (-738.503) [-741.144] * [-739.255] (-738.958) (-740.871) (-737.785) -- 0:00:16
693500 -- [-739.816] (-740.820) (-740.118) (-738.757) * [-737.471] (-738.636) (-741.646) (-737.756) -- 0:00:16
694000 -- (-739.652) [-743.912] (-739.277) (-739.015) * [-736.800] (-741.138) (-738.578) (-738.378) -- 0:00:16
694500 -- (-739.387) (-740.804) [-743.120] (-741.441) * [-738.526] (-737.534) (-738.211) (-739.389) -- 0:00:16
695000 -- (-739.196) (-740.796) [-739.294] (-740.976) * (-740.375) (-739.793) (-739.963) [-739.505] -- 0:00:16
Average standard deviation of split frequencies: 0.013411
695500 -- (-747.465) [-740.269] (-738.044) (-744.457) * (-746.140) [-744.472] (-738.233) (-739.865) -- 0:00:16
696000 -- (-744.216) (-739.056) (-739.325) [-738.668] * (-742.448) (-741.985) [-737.810] (-742.483) -- 0:00:16
696500 -- [-740.508] (-740.953) (-740.781) (-738.730) * (-744.757) [-741.376] (-740.563) (-738.336) -- 0:00:16
697000 -- (-738.822) [-737.756] (-738.813) (-739.478) * (-742.666) [-741.644] (-738.302) (-738.620) -- 0:00:16
697500 -- (-741.214) [-737.551] (-739.497) (-740.976) * [-739.306] (-739.003) (-740.598) (-737.425) -- 0:00:16
698000 -- (-739.379) (-737.469) (-739.802) [-737.494] * (-738.145) [-739.538] (-740.108) (-738.415) -- 0:00:16
698500 -- [-738.575] (-737.331) (-739.069) (-740.921) * (-741.263) (-738.500) [-748.009] (-740.332) -- 0:00:16
699000 -- (-737.397) (-737.764) [-737.836] (-738.472) * (-737.395) (-737.178) [-739.422] (-742.234) -- 0:00:16
699500 -- (-739.240) [-739.754] (-737.875) (-740.015) * (-738.500) (-738.077) (-742.849) [-739.437] -- 0:00:16
700000 -- (-738.477) [-736.948] (-738.000) (-740.679) * (-739.450) [-739.115] (-742.995) (-739.677) -- 0:00:16
Average standard deviation of split frequencies: 0.013052
700500 -- (-739.744) [-737.630] (-738.505) (-743.439) * [-737.502] (-740.683) (-740.762) (-740.912) -- 0:00:16
701000 -- (-738.668) [-738.155] (-738.713) (-739.513) * [-742.803] (-739.349) (-741.401) (-738.739) -- 0:00:16
701500 -- [-739.265] (-737.681) (-738.582) (-739.965) * (-745.152) (-740.436) (-738.012) [-738.769] -- 0:00:16
702000 -- (-740.240) [-737.404] (-743.642) (-737.342) * (-739.489) (-740.397) (-742.806) [-737.223] -- 0:00:16
702500 -- (-737.469) (-738.010) (-739.663) [-739.449] * [-741.004] (-742.406) (-741.974) (-738.719) -- 0:00:16
703000 -- (-739.606) (-738.066) [-738.352] (-740.423) * (-737.444) (-739.808) (-746.788) [-741.842] -- 0:00:16
703500 -- (-741.203) (-737.671) (-740.382) [-743.364] * (-739.842) (-740.579) [-741.175] (-740.969) -- 0:00:16
704000 -- (-737.055) [-739.222] (-738.987) (-739.243) * (-739.540) (-745.162) [-739.668] (-741.207) -- 0:00:15
704500 -- [-739.699] (-738.979) (-737.597) (-741.516) * (-740.291) (-739.274) [-736.999] (-741.513) -- 0:00:15
705000 -- (-745.882) [-740.075] (-739.425) (-738.892) * (-739.749) (-742.937) (-740.678) [-737.423] -- 0:00:15
Average standard deviation of split frequencies: 0.013354
705500 -- (-745.076) (-737.710) [-739.839] (-739.477) * (-740.814) [-738.672] (-738.774) (-739.274) -- 0:00:15
706000 -- (-745.456) (-738.568) (-737.629) [-738.224] * [-740.406] (-741.292) (-739.402) (-743.730) -- 0:00:15
706500 -- (-737.513) [-738.045] (-737.239) (-737.614) * (-737.472) (-742.958) (-739.091) [-737.966] -- 0:00:16
707000 -- (-739.532) [-740.148] (-737.568) (-742.448) * (-737.574) (-742.211) [-739.090] (-740.056) -- 0:00:16
707500 -- [-738.413] (-738.703) (-740.728) (-739.159) * [-739.532] (-737.933) (-738.433) (-740.921) -- 0:00:16
708000 -- (-738.265) [-739.494] (-741.678) (-743.196) * (-738.043) [-738.919] (-737.220) (-743.214) -- 0:00:16
708500 -- [-742.564] (-748.098) (-740.318) (-741.571) * (-740.262) [-740.641] (-738.897) (-740.709) -- 0:00:16
709000 -- (-741.983) (-745.377) [-743.036] (-740.492) * (-740.460) [-739.146] (-742.480) (-741.475) -- 0:00:16
709500 -- (-740.510) (-743.290) (-738.217) [-738.295] * [-738.903] (-739.321) (-739.377) (-741.469) -- 0:00:15
710000 -- (-738.334) (-741.982) [-738.582] (-738.130) * (-739.812) (-740.699) [-739.883] (-740.341) -- 0:00:15
Average standard deviation of split frequencies: 0.012869
710500 -- (-738.743) (-742.816) [-740.159] (-738.193) * (-737.204) (-741.830) [-740.728] (-739.259) -- 0:00:15
711000 -- [-738.044] (-740.573) (-738.024) (-738.807) * (-737.400) [-738.344] (-740.951) (-737.479) -- 0:00:15
711500 -- (-738.964) (-738.371) (-737.899) [-740.171] * (-737.722) (-737.592) (-740.054) [-739.313] -- 0:00:15
712000 -- (-739.346) (-739.605) [-738.033] (-736.912) * (-738.318) [-738.728] (-737.543) (-738.646) -- 0:00:15
712500 -- [-740.034] (-742.078) (-738.230) (-737.191) * (-740.124) (-738.834) [-741.572] (-743.202) -- 0:00:15
713000 -- (-740.449) (-744.132) (-738.787) [-740.421] * (-742.192) (-741.790) (-738.249) [-739.071] -- 0:00:15
713500 -- (-740.499) (-744.218) [-739.847] (-739.660) * (-739.319) (-740.713) [-738.066] (-737.775) -- 0:00:15
714000 -- (-741.941) (-737.923) (-738.481) [-739.948] * (-739.989) [-739.314] (-738.438) (-740.794) -- 0:00:15
714500 -- (-741.981) [-740.838] (-737.587) (-739.794) * (-739.205) (-740.363) (-738.936) [-737.617] -- 0:00:15
715000 -- (-737.043) [-740.179] (-737.268) (-740.247) * (-737.844) (-741.262) (-737.950) [-740.617] -- 0:00:15
Average standard deviation of split frequencies: 0.012904
715500 -- (-739.466) (-742.676) (-739.519) [-737.918] * (-737.639) (-738.831) [-738.820] (-738.637) -- 0:00:15
716000 -- [-739.876] (-740.153) (-737.500) (-741.206) * [-737.559] (-738.049) (-738.785) (-739.079) -- 0:00:15
716500 -- (-737.962) [-742.203] (-738.413) (-738.671) * (-739.730) (-740.482) [-737.847] (-741.410) -- 0:00:15
717000 -- (-739.417) [-737.725] (-737.750) (-742.359) * (-738.710) (-742.988) [-741.553] (-741.903) -- 0:00:15
717500 -- [-739.986] (-737.992) (-738.283) (-738.448) * (-738.036) (-738.795) [-741.178] (-737.936) -- 0:00:15
718000 -- (-739.742) (-737.864) [-738.944] (-738.673) * (-738.007) (-739.794) (-742.054) [-738.051] -- 0:00:15
718500 -- (-739.148) (-737.407) (-737.208) [-740.396] * (-738.607) (-738.713) [-739.684] (-737.132) -- 0:00:15
719000 -- [-739.658] (-737.805) (-737.011) (-738.402) * (-738.023) (-738.939) (-739.545) [-738.225] -- 0:00:15
719500 -- (-741.474) (-739.289) [-739.481] (-739.499) * (-738.087) (-740.521) [-740.604] (-740.699) -- 0:00:15
720000 -- (-738.803) (-739.084) [-737.482] (-741.352) * (-739.310) [-740.177] (-744.158) (-740.698) -- 0:00:15
Average standard deviation of split frequencies: 0.012559
720500 -- (-740.409) (-740.419) (-737.947) [-738.395] * (-737.825) [-743.250] (-743.809) (-739.438) -- 0:00:15
721000 -- (-740.784) [-737.957] (-738.508) (-740.021) * [-739.868] (-743.178) (-737.744) (-738.186) -- 0:00:15
721500 -- (-741.626) [-739.482] (-741.617) (-738.977) * [-738.148] (-740.432) (-738.723) (-738.695) -- 0:00:15
722000 -- [-740.567] (-739.981) (-742.747) (-738.301) * (-744.486) [-738.192] (-740.014) (-739.162) -- 0:00:15
722500 -- (-741.901) [-737.972] (-738.292) (-738.562) * (-737.089) (-737.527) (-740.152) [-737.399] -- 0:00:14
723000 -- (-738.323) (-741.931) [-738.367] (-738.088) * [-737.624] (-736.958) (-740.055) (-737.867) -- 0:00:14
723500 -- (-738.261) (-740.764) [-739.311] (-740.716) * (-738.090) (-740.757) [-738.117] (-742.386) -- 0:00:14
724000 -- (-737.711) (-738.212) [-739.628] (-737.890) * [-740.666] (-738.472) (-737.904) (-740.904) -- 0:00:14
724500 -- [-738.828] (-742.359) (-737.153) (-738.808) * [-738.427] (-739.171) (-738.393) (-743.082) -- 0:00:14
725000 -- (-739.039) (-740.378) [-739.576] (-738.222) * [-738.828] (-737.507) (-737.459) (-740.684) -- 0:00:15
Average standard deviation of split frequencies: 0.011688
725500 -- (-741.091) (-738.717) (-737.899) [-741.087] * (-738.519) (-742.668) [-738.235] (-737.903) -- 0:00:15
726000 -- (-738.918) [-738.836] (-738.333) (-740.612) * (-739.456) (-741.897) [-738.161] (-738.769) -- 0:00:15
726500 -- (-740.194) (-737.079) (-738.566) [-740.698] * (-737.730) (-745.234) [-738.406] (-738.565) -- 0:00:15
727000 -- [-737.703] (-738.614) (-740.719) (-741.326) * (-738.821) (-739.695) (-738.983) [-737.962] -- 0:00:15
727500 -- [-740.875] (-741.933) (-737.799) (-737.544) * [-738.851] (-738.216) (-739.601) (-738.278) -- 0:00:14
728000 -- (-739.238) (-739.522) [-738.227] (-738.576) * (-738.462) (-738.510) (-740.193) [-737.848] -- 0:00:14
728500 -- (-740.943) [-738.033] (-744.690) (-740.499) * [-737.397] (-738.983) (-739.553) (-738.100) -- 0:00:14
729000 -- [-743.667] (-742.559) (-738.738) (-738.749) * [-741.455] (-741.204) (-742.818) (-740.156) -- 0:00:14
729500 -- (-739.876) [-738.939] (-739.069) (-739.598) * [-740.622] (-743.295) (-741.649) (-738.055) -- 0:00:14
730000 -- (-740.680) [-740.155] (-738.401) (-738.386) * (-739.551) (-743.667) (-740.757) [-738.615] -- 0:00:14
Average standard deviation of split frequencies: 0.011484
730500 -- (-742.586) [-740.016] (-741.262) (-739.778) * [-737.826] (-740.276) (-738.053) (-744.866) -- 0:00:14
731000 -- [-739.425] (-739.826) (-738.343) (-740.222) * (-739.675) [-740.601] (-741.544) (-743.942) -- 0:00:14
731500 -- [-738.403] (-741.101) (-739.336) (-739.894) * [-739.968] (-738.202) (-739.747) (-741.108) -- 0:00:14
732000 -- [-737.793] (-740.819) (-737.177) (-741.083) * (-744.007) (-738.080) (-737.600) [-737.168] -- 0:00:14
732500 -- (-739.555) (-742.999) (-739.646) [-739.777] * (-738.396) [-739.330] (-740.451) (-739.290) -- 0:00:14
733000 -- (-741.642) [-741.989] (-739.285) (-746.239) * (-739.939) [-739.136] (-740.967) (-740.744) -- 0:00:14
733500 -- (-742.316) (-739.090) [-741.641] (-746.481) * (-740.442) [-738.545] (-740.624) (-738.655) -- 0:00:14
734000 -- (-737.613) [-745.687] (-739.075) (-738.847) * (-738.793) (-742.962) [-739.393] (-738.525) -- 0:00:14
734500 -- (-743.926) (-739.049) (-739.451) [-740.489] * [-738.606] (-738.655) (-739.351) (-738.514) -- 0:00:14
735000 -- (-737.567) [-738.089] (-737.430) (-738.279) * (-740.713) [-739.836] (-739.327) (-739.028) -- 0:00:14
Average standard deviation of split frequencies: 0.011785
735500 -- (-738.256) (-740.082) [-739.214] (-738.457) * [-737.821] (-740.381) (-739.319) (-737.832) -- 0:00:14
736000 -- [-738.101] (-738.550) (-740.194) (-739.481) * (-743.479) [-740.436] (-739.333) (-737.532) -- 0:00:14
736500 -- [-738.698] (-738.247) (-737.313) (-747.559) * (-742.284) [-739.687] (-739.274) (-738.667) -- 0:00:14
737000 -- (-739.048) [-738.517] (-737.852) (-738.765) * (-739.806) [-740.874] (-739.211) (-737.462) -- 0:00:14
737500 -- (-738.303) [-741.090] (-742.981) (-739.712) * (-740.433) (-738.037) (-742.971) [-738.112] -- 0:00:14
738000 -- (-738.926) (-738.984) [-742.208] (-741.557) * (-739.526) [-738.060] (-737.481) (-737.369) -- 0:00:14
738500 -- [-740.766] (-737.789) (-750.503) (-739.347) * (-736.930) (-739.036) [-738.771] (-737.382) -- 0:00:14
739000 -- (-740.922) [-737.393] (-741.606) (-739.031) * [-739.348] (-738.970) (-740.630) (-737.372) -- 0:00:14
739500 -- (-737.058) (-738.649) (-738.928) [-740.054] * (-739.490) (-739.911) (-740.029) [-737.476] -- 0:00:14
740000 -- (-739.841) (-738.994) [-739.367] (-741.282) * (-738.612) (-741.263) (-739.274) [-737.349] -- 0:00:14
Average standard deviation of split frequencies: 0.011965
740500 -- (-742.906) (-739.532) [-740.898] (-737.025) * [-739.858] (-738.605) (-737.794) (-737.387) -- 0:00:14
741000 -- (-741.326) (-737.473) (-741.631) [-737.549] * [-741.559] (-738.450) (-738.481) (-737.670) -- 0:00:13
741500 -- (-738.624) [-737.434] (-739.618) (-739.325) * (-738.264) (-737.349) (-742.372) [-737.195] -- 0:00:13
742000 -- (-738.537) (-738.048) [-738.115] (-741.032) * (-739.340) [-738.343] (-743.122) (-743.855) -- 0:00:13
742500 -- (-739.328) (-738.953) [-739.253] (-740.841) * (-741.602) [-740.238] (-743.540) (-740.990) -- 0:00:13
743000 -- [-739.065] (-738.450) (-738.776) (-739.431) * (-739.192) (-741.930) (-742.129) [-741.332] -- 0:00:13
743500 -- (-738.276) (-739.473) (-738.168) [-738.456] * (-739.765) (-740.240) (-743.128) [-738.922] -- 0:00:14
744000 -- (-737.533) (-740.384) [-738.562] (-738.610) * (-738.899) (-739.400) (-740.157) [-738.652] -- 0:00:14
744500 -- (-737.266) [-737.444] (-738.134) (-739.222) * (-738.873) [-737.951] (-738.241) (-738.230) -- 0:00:14
745000 -- [-737.925] (-737.603) (-740.173) (-739.413) * (-739.304) (-739.589) (-737.243) [-738.162] -- 0:00:14
Average standard deviation of split frequencies: 0.011627
745500 -- (-738.318) (-741.040) [-737.415] (-737.252) * (-740.538) (-740.903) (-737.947) [-740.310] -- 0:00:13
746000 -- [-737.774] (-739.158) (-737.404) (-741.154) * (-739.747) [-741.114] (-737.645) (-739.508) -- 0:00:13
746500 -- (-738.640) [-737.192] (-742.861) (-741.283) * (-739.371) (-738.090) (-739.101) [-740.370] -- 0:00:13
747000 -- [-737.732] (-737.607) (-740.635) (-741.365) * (-739.326) (-738.800) (-739.067) [-738.318] -- 0:00:13
747500 -- (-739.026) (-737.376) [-739.424] (-737.550) * (-739.838) [-739.830] (-738.184) (-737.463) -- 0:00:13
748000 -- (-739.534) [-739.247] (-741.584) (-738.067) * [-741.505] (-738.837) (-739.734) (-737.937) -- 0:00:13
748500 -- (-738.259) (-740.148) [-739.326] (-738.663) * (-740.292) (-739.323) (-737.904) [-737.385] -- 0:00:13
749000 -- (-737.863) (-737.918) (-742.942) [-739.565] * (-739.120) (-737.988) [-738.167] (-737.566) -- 0:00:13
749500 -- [-739.643] (-737.583) (-742.500) (-739.859) * (-737.599) (-738.656) (-738.637) [-737.885] -- 0:00:13
750000 -- (-737.400) [-740.506] (-743.967) (-738.704) * [-737.322] (-739.322) (-738.739) (-737.920) -- 0:00:13
Average standard deviation of split frequencies: 0.011680
750500 -- (-742.239) (-741.269) [-739.524] (-741.685) * [-738.667] (-744.224) (-739.467) (-740.264) -- 0:00:13
751000 -- (-745.188) [-739.260] (-738.059) (-741.356) * (-738.493) [-739.355] (-739.720) (-739.063) -- 0:00:13
751500 -- (-743.910) (-738.122) (-741.796) [-738.622] * (-740.499) (-739.355) (-740.963) [-737.488] -- 0:00:13
752000 -- (-739.955) [-740.856] (-742.156) (-744.136) * (-741.676) (-739.300) [-738.162] (-737.883) -- 0:00:13
752500 -- (-737.564) [-737.652] (-741.247) (-738.787) * (-738.145) [-740.472] (-738.613) (-737.215) -- 0:00:13
753000 -- (-737.863) (-737.092) [-739.989] (-737.816) * [-738.713] (-738.972) (-745.713) (-738.973) -- 0:00:13
753500 -- (-737.705) (-739.098) (-740.179) [-737.238] * (-738.549) [-739.059] (-737.659) (-737.686) -- 0:00:13
754000 -- [-737.657] (-738.671) (-740.993) (-739.498) * (-741.671) [-739.437] (-739.481) (-739.000) -- 0:00:13
754500 -- (-739.440) [-738.844] (-738.173) (-738.699) * (-744.959) (-738.629) (-742.899) [-738.602] -- 0:00:13
755000 -- (-741.147) [-741.287] (-738.797) (-742.230) * (-737.988) (-740.959) (-740.287) [-737.340] -- 0:00:13
Average standard deviation of split frequencies: 0.011349
755500 -- (-740.439) (-739.838) [-741.552] (-738.069) * (-738.831) [-738.244] (-740.835) (-738.200) -- 0:00:13
756000 -- (-741.406) [-740.408] (-744.397) (-741.781) * (-741.068) (-739.549) (-742.907) [-738.336] -- 0:00:13
756500 -- (-738.689) (-739.100) [-738.478] (-737.078) * (-740.759) (-741.723) [-738.632] (-737.892) -- 0:00:13
757000 -- (-740.875) (-741.819) (-739.674) [-742.760] * (-739.611) [-739.772] (-739.050) (-739.481) -- 0:00:13
757500 -- (-742.258) (-738.227) [-739.676] (-739.874) * (-740.069) (-738.194) [-739.690] (-738.150) -- 0:00:13
758000 -- (-740.076) (-743.832) (-740.963) [-739.626] * (-740.985) (-740.431) (-740.732) [-740.576] -- 0:00:13
758500 -- (-740.899) (-737.651) (-739.906) [-741.662] * (-740.556) [-738.570] (-741.445) (-739.632) -- 0:00:13
759000 -- (-737.889) [-737.395] (-742.316) (-740.115) * (-738.535) [-738.573] (-738.642) (-739.766) -- 0:00:13
759500 -- (-738.202) [-738.013] (-741.983) (-738.309) * (-738.550) (-738.869) (-738.386) [-740.863] -- 0:00:12
760000 -- (-738.660) (-739.439) (-739.387) [-740.358] * (-737.261) (-738.723) [-741.522] (-743.071) -- 0:00:12
Average standard deviation of split frequencies: 0.011775
760500 -- [-738.659] (-738.972) (-742.782) (-739.476) * (-739.060) [-740.737] (-741.396) (-740.756) -- 0:00:12
761000 -- [-739.072] (-738.973) (-742.513) (-739.630) * (-740.694) [-737.097] (-739.632) (-742.211) -- 0:00:12
761500 -- (-739.622) [-738.183] (-740.177) (-740.811) * (-738.813) (-737.723) [-742.180] (-741.870) -- 0:00:12
762000 -- (-740.325) [-738.181] (-742.336) (-739.736) * (-743.266) [-737.085] (-739.144) (-737.733) -- 0:00:12
762500 -- (-739.771) (-744.004) [-741.128] (-743.466) * [-743.362] (-739.203) (-738.921) (-738.350) -- 0:00:13
763000 -- (-738.799) (-747.752) [-739.222] (-746.552) * (-739.141) (-740.366) [-738.366] (-744.301) -- 0:00:13
763500 -- (-738.586) (-738.552) [-738.307] (-739.991) * [-738.709] (-740.477) (-739.112) (-739.708) -- 0:00:13
764000 -- (-737.624) (-740.792) [-739.112] (-740.261) * [-739.048] (-738.764) (-737.461) (-739.752) -- 0:00:12
764500 -- [-739.431] (-743.713) (-740.265) (-740.658) * (-739.446) [-737.671] (-737.954) (-740.813) -- 0:00:12
765000 -- (-742.280) [-741.473] (-737.612) (-737.424) * [-741.389] (-738.057) (-740.548) (-738.718) -- 0:00:12
Average standard deviation of split frequencies: 0.011570
765500 -- [-740.459] (-740.198) (-737.211) (-738.254) * (-737.616) [-738.766] (-739.930) (-737.644) -- 0:00:12
766000 -- (-743.141) (-739.879) (-738.392) [-741.100] * (-739.633) (-737.098) [-738.014] (-740.289) -- 0:00:12
766500 -- (-737.650) [-739.353] (-739.983) (-740.189) * (-742.083) (-737.320) [-738.596] (-737.441) -- 0:00:12
767000 -- (-738.744) (-738.274) [-739.577] (-738.012) * [-738.253] (-738.158) (-738.736) (-743.652) -- 0:00:12
767500 -- (-740.403) (-742.487) [-738.683] (-738.622) * (-737.353) (-742.729) (-740.010) [-740.727] -- 0:00:12
768000 -- (-739.223) (-737.614) [-737.979] (-739.116) * [-737.669] (-738.940) (-741.727) (-739.441) -- 0:00:12
768500 -- (-738.941) (-738.454) (-738.547) [-739.034] * (-737.452) (-741.880) (-741.002) [-738.623] -- 0:00:12
769000 -- (-743.142) (-737.396) [-737.592] (-739.634) * (-740.175) (-739.848) (-737.820) [-738.181] -- 0:00:12
769500 -- (-738.500) (-740.821) [-739.907] (-742.557) * (-739.639) (-738.308) [-740.241] (-738.545) -- 0:00:12
770000 -- [-738.936] (-739.889) (-738.189) (-740.620) * (-739.629) (-738.771) (-742.284) [-741.600] -- 0:00:12
Average standard deviation of split frequencies: 0.012356
770500 -- (-738.316) (-740.892) [-741.725] (-737.823) * (-741.536) [-742.202] (-744.007) (-738.216) -- 0:00:12
771000 -- (-737.648) (-739.025) (-737.464) [-742.208] * (-740.468) (-738.378) [-741.038] (-738.594) -- 0:00:12
771500 -- [-737.751] (-742.313) (-737.498) (-744.610) * (-738.460) [-738.252] (-742.860) (-738.439) -- 0:00:12
772000 -- (-739.111) (-738.554) (-743.090) [-740.992] * [-738.404] (-738.326) (-744.114) (-738.832) -- 0:00:12
772500 -- [-737.752] (-742.557) (-739.923) (-741.729) * (-740.335) [-739.937] (-742.234) (-740.069) -- 0:00:12
773000 -- [-740.419] (-741.001) (-740.193) (-737.540) * [-738.160] (-739.403) (-744.909) (-738.387) -- 0:00:12
773500 -- (-739.143) (-739.424) [-738.832] (-738.337) * (-738.085) (-737.536) (-744.866) [-740.985] -- 0:00:12
774000 -- (-740.856) [-740.465] (-739.049) (-738.797) * [-740.171] (-739.680) (-738.786) (-739.814) -- 0:00:12
774500 -- (-738.831) (-739.339) (-739.219) [-741.291] * [-741.501] (-741.282) (-740.431) (-737.583) -- 0:00:12
775000 -- (-739.474) [-739.381] (-741.540) (-740.501) * (-739.681) (-740.358) (-740.302) [-737.594] -- 0:00:12
Average standard deviation of split frequencies: 0.011907
775500 -- (-738.451) (-738.435) [-738.161] (-738.891) * (-746.743) [-741.853] (-743.660) (-737.311) -- 0:00:12
776000 -- (-742.140) [-739.190] (-741.848) (-738.545) * (-739.390) [-737.683] (-739.641) (-737.865) -- 0:00:12
776500 -- (-738.977) (-740.231) [-740.462] (-739.280) * [-739.328] (-738.555) (-740.490) (-742.555) -- 0:00:12
777000 -- (-738.350) (-743.449) [-744.494] (-741.166) * (-741.751) [-738.455] (-739.017) (-741.377) -- 0:00:12
777500 -- (-742.235) [-739.747] (-753.697) (-744.183) * (-739.060) (-738.721) (-737.426) [-738.533] -- 0:00:12
778000 -- (-742.055) [-738.710] (-738.486) (-741.388) * [-738.833] (-737.014) (-738.562) (-737.400) -- 0:00:11
778500 -- (-738.730) [-738.856] (-740.725) (-739.301) * (-742.370) (-737.120) (-737.536) [-738.029] -- 0:00:11
779000 -- (-737.623) (-738.510) (-737.542) [-739.753] * (-740.022) (-738.113) [-739.536] (-737.735) -- 0:00:11
779500 -- (-739.331) (-742.578) (-739.489) [-741.452] * (-742.513) (-742.462) (-739.752) [-738.570] -- 0:00:11
780000 -- (-743.605) (-741.931) (-739.335) [-738.713] * [-738.707] (-741.973) (-739.625) (-738.825) -- 0:00:11
Average standard deviation of split frequencies: 0.012319
780500 -- (-742.159) (-739.141) [-742.477] (-739.157) * (-739.711) (-738.899) [-737.610] (-738.720) -- 0:00:11
781000 -- [-742.054] (-740.808) (-743.019) (-739.613) * (-742.876) [-739.452] (-737.828) (-741.837) -- 0:00:12
781500 -- (-740.038) (-738.671) [-743.751] (-738.318) * [-739.117] (-737.991) (-738.106) (-739.776) -- 0:00:12
782000 -- (-739.760) (-739.240) (-742.092) [-740.229] * (-739.435) (-738.693) (-737.034) [-737.906] -- 0:00:11
782500 -- (-737.434) [-741.907] (-739.569) (-738.348) * (-739.742) (-740.818) [-741.885] (-738.331) -- 0:00:11
783000 -- [-737.408] (-741.150) (-738.505) (-737.787) * (-740.491) (-740.669) (-739.739) [-739.459] -- 0:00:11
783500 -- (-737.409) (-736.966) [-739.769] (-739.508) * (-744.381) (-737.745) (-739.746) [-739.337] -- 0:00:11
784000 -- (-738.732) (-737.379) [-739.201] (-737.748) * (-745.624) (-737.397) [-740.185] (-738.350) -- 0:00:11
784500 -- (-738.629) (-740.042) [-739.611] (-737.803) * (-738.340) (-737.394) [-740.233] (-740.240) -- 0:00:11
785000 -- (-742.451) [-738.279] (-741.232) (-737.626) * (-739.340) (-749.452) (-737.724) [-738.455] -- 0:00:11
Average standard deviation of split frequencies: 0.011875
785500 -- (-742.450) (-742.599) (-742.586) [-739.556] * (-738.712) [-740.530] (-738.089) (-738.907) -- 0:00:11
786000 -- (-742.334) (-738.030) (-737.606) [-738.846] * (-739.553) (-740.147) (-737.425) [-739.483] -- 0:00:11
786500 -- (-738.846) (-738.910) (-738.334) [-740.062] * [-740.308] (-739.064) (-738.360) (-739.135) -- 0:00:11
787000 -- [-737.975] (-741.358) (-740.878) (-739.123) * (-739.717) (-738.332) [-740.796] (-738.622) -- 0:00:11
787500 -- (-740.041) (-738.630) [-740.933] (-740.498) * [-738.579] (-739.605) (-738.465) (-738.656) -- 0:00:11
788000 -- (-738.470) (-738.221) [-740.310] (-737.326) * [-739.348] (-738.516) (-739.709) (-738.265) -- 0:00:11
788500 -- (-737.955) (-740.707) (-741.658) [-737.778] * (-738.877) (-738.906) [-740.752] (-739.297) -- 0:00:11
789000 -- (-737.668) [-738.105] (-739.232) (-742.146) * [-738.323] (-739.370) (-737.815) (-741.774) -- 0:00:11
789500 -- (-738.311) [-739.350] (-739.473) (-738.408) * (-738.714) (-739.534) [-740.249] (-737.263) -- 0:00:11
790000 -- (-739.027) (-739.009) (-739.722) [-740.280] * (-739.076) (-740.431) [-738.377] (-739.176) -- 0:00:11
Average standard deviation of split frequencies: 0.011805
790500 -- (-737.494) (-739.304) (-739.503) [-739.025] * [-738.682] (-738.339) (-738.043) (-738.202) -- 0:00:11
791000 -- [-737.330] (-740.888) (-737.461) (-737.496) * (-740.753) (-740.393) [-738.030] (-739.153) -- 0:00:11
791500 -- (-739.122) (-740.883) [-737.185] (-737.220) * [-739.562] (-739.144) (-738.737) (-746.117) -- 0:00:11
792000 -- (-739.754) (-741.414) (-737.270) [-740.128] * (-739.410) (-740.469) (-742.443) [-737.764] -- 0:00:11
792500 -- (-739.969) (-741.399) [-737.269] (-741.706) * (-739.423) (-737.556) (-739.320) [-741.213] -- 0:00:11
793000 -- (-740.227) [-738.201] (-738.284) (-739.710) * (-739.029) (-740.347) [-740.549] (-742.698) -- 0:00:11
793500 -- (-743.356) (-738.091) [-740.584] (-740.986) * (-737.520) (-737.327) (-741.391) [-738.756] -- 0:00:11
794000 -- (-744.012) [-740.014] (-739.041) (-737.512) * [-737.302] (-740.391) (-737.851) (-739.069) -- 0:00:11
794500 -- (-741.789) (-738.776) (-738.132) [-738.281] * [-738.855] (-739.532) (-739.336) (-739.611) -- 0:00:11
795000 -- (-740.733) [-737.978] (-737.750) (-739.235) * (-742.977) (-737.582) [-738.748] (-739.767) -- 0:00:11
Average standard deviation of split frequencies: 0.011844
795500 -- (-741.017) (-738.778) (-742.544) [-741.517] * (-737.749) (-738.653) (-739.134) [-738.961] -- 0:00:11
796000 -- (-738.585) (-742.695) [-739.930] (-737.969) * (-740.343) [-740.465] (-741.116) (-739.466) -- 0:00:11
796500 -- (-739.128) (-740.486) [-739.646] (-739.563) * (-740.063) (-740.915) (-741.082) [-738.143] -- 0:00:10
797000 -- (-738.074) [-738.680] (-740.351) (-738.282) * (-739.515) (-737.712) (-737.193) [-743.248] -- 0:00:10
797500 -- (-738.089) (-739.372) (-740.695) [-738.264] * (-738.799) (-740.731) [-737.985] (-739.555) -- 0:00:10
798000 -- [-738.860] (-738.850) (-737.727) (-739.302) * (-738.366) (-746.020) [-738.585] (-739.406) -- 0:00:10
798500 -- (-739.446) (-740.674) [-739.221] (-741.125) * [-741.259] (-740.610) (-738.054) (-738.982) -- 0:00:10
799000 -- (-738.742) [-739.576] (-738.438) (-741.104) * (-738.311) (-739.439) [-738.657] (-737.339) -- 0:00:10
799500 -- [-738.389] (-738.623) (-739.639) (-739.066) * [-738.000] (-742.295) (-738.960) (-738.718) -- 0:00:11
800000 -- (-740.341) [-739.349] (-739.169) (-740.105) * (-737.727) [-740.146] (-743.073) (-739.581) -- 0:00:11
Average standard deviation of split frequencies: 0.012129
800500 -- (-741.071) [-737.749] (-738.120) (-741.450) * (-739.806) (-737.261) (-748.077) [-738.971] -- 0:00:10
801000 -- (-738.154) (-738.201) (-738.420) [-740.066] * (-741.801) (-737.842) [-737.706] (-738.929) -- 0:00:10
801500 -- (-737.898) [-738.109] (-738.845) (-739.255) * [-738.665] (-737.967) (-737.141) (-740.271) -- 0:00:10
802000 -- [-738.760] (-738.275) (-738.068) (-742.401) * [-742.326] (-744.379) (-740.123) (-739.166) -- 0:00:10
802500 -- (-738.791) (-737.745) (-738.200) [-739.036] * [-740.640] (-738.598) (-737.615) (-737.254) -- 0:00:10
803000 -- (-742.321) (-737.078) [-738.694] (-737.527) * (-740.057) (-738.094) (-738.005) [-737.623] -- 0:00:10
803500 -- (-740.209) (-740.307) [-741.816] (-741.996) * (-738.708) (-740.359) (-740.344) [-737.717] -- 0:00:10
804000 -- (-740.471) [-738.584] (-744.740) (-739.980) * (-739.011) [-738.267] (-739.523) (-737.396) -- 0:00:10
804500 -- (-740.135) [-737.116] (-739.100) (-740.452) * (-741.437) [-737.332] (-737.110) (-737.457) -- 0:00:10
805000 -- (-737.146) (-739.922) (-740.090) [-742.099] * (-743.782) [-738.464] (-738.654) (-740.872) -- 0:00:10
Average standard deviation of split frequencies: 0.011580
805500 -- (-739.288) (-737.782) [-738.243] (-739.598) * [-737.911] (-738.537) (-737.322) (-739.998) -- 0:00:10
806000 -- (-738.461) (-740.660) [-739.484] (-739.220) * [-739.847] (-739.345) (-737.214) (-741.355) -- 0:00:10
806500 -- (-737.989) [-737.895] (-742.167) (-743.334) * (-741.888) [-739.856] (-737.917) (-738.962) -- 0:00:10
807000 -- [-739.049] (-739.159) (-744.888) (-744.571) * [-739.438] (-739.169) (-738.192) (-739.319) -- 0:00:10
807500 -- (-741.640) (-737.098) (-746.966) [-737.925] * (-738.713) (-737.186) (-739.117) [-738.661] -- 0:00:10
808000 -- (-739.544) (-742.185) [-741.077] (-743.097) * (-739.635) (-738.640) (-743.212) [-740.372] -- 0:00:10
808500 -- [-738.681] (-743.064) (-738.153) (-743.985) * (-739.012) (-738.889) [-740.734] (-739.083) -- 0:00:10
809000 -- [-737.631] (-738.842) (-742.703) (-739.979) * (-738.479) (-742.015) [-738.281] (-738.108) -- 0:00:10
809500 -- (-737.634) (-739.677) [-737.410] (-739.229) * (-737.723) [-738.958] (-737.864) (-739.504) -- 0:00:10
810000 -- [-737.378] (-738.428) (-740.145) (-741.493) * (-738.299) [-737.552] (-737.964) (-741.563) -- 0:00:10
Average standard deviation of split frequencies: 0.011397
810500 -- (-739.090) [-738.399] (-740.469) (-742.129) * (-739.117) (-739.561) (-738.959) [-739.691] -- 0:00:10
811000 -- (-741.965) (-740.768) [-739.091] (-740.100) * (-739.732) [-739.537] (-739.583) (-737.517) -- 0:00:10
811500 -- (-744.961) [-739.100] (-739.845) (-743.079) * (-739.122) (-741.140) (-737.267) [-737.708] -- 0:00:10
812000 -- (-740.787) (-737.547) [-738.768] (-739.619) * [-738.676] (-739.654) (-737.259) (-737.175) -- 0:00:10
812500 -- (-740.690) [-737.788] (-740.707) (-737.947) * [-738.780] (-737.623) (-739.932) (-738.988) -- 0:00:10
813000 -- (-744.405) (-741.041) (-738.279) [-737.851] * (-739.683) (-740.135) (-738.487) [-741.032] -- 0:00:10
813500 -- [-740.189] (-740.378) (-738.811) (-737.907) * (-739.040) (-739.292) (-739.976) [-739.794] -- 0:00:10
814000 -- (-737.026) [-739.164] (-738.732) (-737.437) * (-738.683) [-738.290] (-740.697) (-738.930) -- 0:00:10
814500 -- (-738.103) (-742.345) (-738.727) [-738.543] * (-742.129) [-738.131] (-741.987) (-739.018) -- 0:00:10
815000 -- (-738.499) [-740.782] (-737.091) (-737.610) * (-737.255) (-738.351) [-741.899] (-737.466) -- 0:00:09
Average standard deviation of split frequencies: 0.011554
815500 -- [-737.722] (-741.547) (-741.403) (-738.616) * (-738.726) (-739.478) [-740.746] (-737.462) -- 0:00:09
816000 -- [-739.184] (-739.260) (-742.392) (-739.585) * [-738.453] (-739.690) (-741.854) (-737.417) -- 0:00:09
816500 -- (-739.076) [-738.932] (-739.570) (-738.682) * (-739.579) [-740.133] (-742.796) (-737.540) -- 0:00:09
817000 -- (-738.910) (-740.358) (-738.642) [-741.085] * (-738.957) (-738.630) [-737.665] (-737.187) -- 0:00:09
817500 -- (-740.058) [-740.609] (-737.781) (-739.112) * (-738.331) (-737.581) [-737.670] (-743.721) -- 0:00:09
818000 -- (-738.284) [-739.174] (-742.488) (-740.022) * (-738.099) (-738.979) (-739.977) [-739.990] -- 0:00:10
818500 -- (-740.311) [-737.955] (-737.339) (-739.413) * (-737.509) [-738.823] (-742.398) (-739.418) -- 0:00:09
819000 -- (-743.776) (-740.188) (-737.886) [-738.765] * (-742.054) (-738.018) (-738.284) [-738.920] -- 0:00:09
819500 -- (-738.578) (-738.357) (-739.469) [-739.355] * (-738.232) (-740.399) (-739.366) [-740.778] -- 0:00:09
820000 -- (-738.627) (-739.632) (-737.956) [-737.881] * (-737.974) (-737.995) (-740.342) [-739.826] -- 0:00:09
Average standard deviation of split frequencies: 0.012063
820500 -- (-739.029) (-740.068) [-739.088] (-740.867) * (-738.089) (-740.796) [-737.707] (-741.940) -- 0:00:09
821000 -- [-739.875] (-741.087) (-739.054) (-741.885) * (-739.443) (-739.941) [-738.460] (-737.937) -- 0:00:09
821500 -- (-737.969) (-740.579) (-737.421) [-738.660] * (-737.415) (-740.468) [-740.161] (-738.700) -- 0:00:09
822000 -- (-739.531) (-737.544) (-741.337) [-738.068] * (-740.533) (-737.377) (-741.431) [-739.611] -- 0:00:09
822500 -- (-738.597) (-742.283) [-739.398] (-738.471) * [-737.838] (-738.168) (-738.144) (-739.998) -- 0:00:09
823000 -- [-737.406] (-740.350) (-739.470) (-740.317) * (-737.950) [-737.424] (-744.200) (-739.799) -- 0:00:09
823500 -- (-737.199) [-737.392] (-737.306) (-740.302) * (-738.568) [-738.116] (-741.542) (-737.213) -- 0:00:09
824000 -- (-740.067) (-739.598) (-738.602) [-738.430] * (-739.250) (-738.891) [-740.104] (-740.184) -- 0:00:09
824500 -- (-739.825) (-740.299) (-738.538) [-737.933] * (-737.611) (-738.816) [-738.882] (-740.230) -- 0:00:09
825000 -- (-737.610) (-739.068) (-737.547) [-740.203] * (-741.204) (-739.034) [-738.071] (-742.046) -- 0:00:09
Average standard deviation of split frequencies: 0.011985
825500 -- (-737.072) [-739.775] (-737.313) (-741.598) * (-741.640) (-738.016) (-739.458) [-744.542] -- 0:00:09
826000 -- (-741.281) (-738.534) (-738.885) [-743.509] * (-738.638) [-740.558] (-738.101) (-742.745) -- 0:00:09
826500 -- (-738.981) (-738.844) (-742.837) [-737.838] * (-738.806) (-737.524) (-738.048) [-737.233] -- 0:00:09
827000 -- [-738.197] (-737.622) (-740.368) (-740.748) * [-739.017] (-738.821) (-737.638) (-739.639) -- 0:00:09
827500 -- (-740.316) (-741.248) (-739.985) [-737.917] * (-738.440) (-740.895) [-737.080] (-737.686) -- 0:00:09
828000 -- (-743.272) (-739.774) (-738.811) [-736.968] * (-739.230) (-738.899) [-737.032] (-737.660) -- 0:00:09
828500 -- [-737.143] (-738.366) (-737.725) (-737.732) * [-740.465] (-740.508) (-737.390) (-737.561) -- 0:00:09
829000 -- (-737.586) (-741.610) [-737.901] (-739.649) * [-739.708] (-737.875) (-740.748) (-737.162) -- 0:00:09
829500 -- (-738.827) (-738.581) (-737.830) [-738.218] * (-739.423) (-738.408) [-740.130] (-738.507) -- 0:00:09
830000 -- (-740.722) (-740.516) [-738.603] (-755.422) * (-740.260) (-740.882) (-737.299) [-739.011] -- 0:00:09
Average standard deviation of split frequencies: 0.011350
830500 -- (-738.570) (-737.508) [-739.138] (-739.300) * (-739.825) [-739.917] (-739.413) (-738.146) -- 0:00:09
831000 -- (-739.454) (-737.079) [-739.218] (-738.057) * [-740.764] (-739.776) (-738.402) (-740.002) -- 0:00:09
831500 -- (-739.112) (-738.027) [-742.385] (-740.450) * (-741.332) [-738.247] (-740.679) (-742.126) -- 0:00:09
832000 -- [-738.242] (-737.547) (-738.666) (-737.964) * [-741.780] (-738.083) (-742.233) (-737.719) -- 0:00:09
832500 -- (-744.195) [-739.384] (-741.050) (-739.578) * (-743.028) (-738.520) (-744.422) [-737.347] -- 0:00:09
833000 -- [-742.380] (-740.591) (-741.512) (-738.963) * (-738.820) (-739.620) [-740.006] (-737.800) -- 0:00:09
833500 -- (-738.411) (-739.988) (-739.230) [-737.123] * (-739.568) (-737.822) [-738.599] (-739.351) -- 0:00:08
834000 -- (-737.822) (-738.137) [-739.098] (-738.097) * (-740.472) [-739.187] (-737.787) (-740.700) -- 0:00:08
834500 -- (-737.743) (-739.208) (-740.281) [-737.833] * [-739.815] (-740.556) (-738.415) (-738.660) -- 0:00:08
835000 -- [-737.703] (-738.593) (-738.878) (-738.355) * [-737.589] (-740.225) (-740.169) (-736.840) -- 0:00:08
Average standard deviation of split frequencies: 0.011842
835500 -- (-741.136) (-737.927) [-738.910] (-737.214) * (-739.159) (-742.212) (-740.521) [-740.253] -- 0:00:08
836000 -- (-742.006) (-739.708) (-743.027) [-737.257] * [-738.507] (-738.284) (-741.134) (-741.808) -- 0:00:08
836500 -- (-742.864) [-736.974] (-739.346) (-742.266) * (-742.821) [-742.247] (-739.145) (-740.178) -- 0:00:08
837000 -- (-743.293) (-739.620) [-739.868] (-741.156) * (-740.183) [-740.708] (-738.713) (-741.180) -- 0:00:08
837500 -- (-740.025) (-739.125) (-739.084) [-739.903] * (-739.991) [-738.793] (-739.304) (-740.183) -- 0:00:08
838000 -- (-741.613) (-737.992) [-739.336] (-739.835) * (-740.756) (-744.028) (-740.630) [-737.804] -- 0:00:08
838500 -- (-742.825) [-740.270] (-739.591) (-741.915) * (-738.222) (-740.135) [-737.217] (-741.057) -- 0:00:08
839000 -- (-740.454) [-738.432] (-739.652) (-738.947) * (-739.854) (-742.999) (-737.098) [-741.924] -- 0:00:08
839500 -- (-738.135) (-738.272) [-741.340] (-740.616) * (-738.908) (-738.249) [-738.522] (-738.371) -- 0:00:08
840000 -- (-738.285) (-740.325) (-739.500) [-738.585] * (-739.057) (-737.591) [-739.553] (-738.726) -- 0:00:08
Average standard deviation of split frequencies: 0.012000
840500 -- [-740.386] (-742.125) (-739.121) (-740.053) * (-740.170) (-739.440) [-739.399] (-737.525) -- 0:00:08
841000 -- (-743.210) [-737.950] (-739.292) (-739.482) * (-740.170) (-741.285) [-740.155] (-740.019) -- 0:00:08
841500 -- (-743.626) [-739.052] (-740.199) (-739.207) * [-738.027] (-739.232) (-740.349) (-737.510) -- 0:00:08
842000 -- (-740.876) [-740.980] (-738.782) (-740.352) * (-738.867) (-742.676) (-738.660) [-737.304] -- 0:00:08
842500 -- [-737.465] (-738.100) (-741.227) (-739.690) * [-737.799] (-744.928) (-738.376) (-739.646) -- 0:00:08
843000 -- [-738.540] (-737.987) (-740.841) (-740.210) * (-740.425) (-740.022) [-738.373] (-740.781) -- 0:00:08
843500 -- (-744.199) [-737.437] (-742.060) (-738.080) * (-740.425) [-741.755] (-739.042) (-738.502) -- 0:00:08
844000 -- (-743.071) [-738.566] (-739.303) (-738.825) * (-738.309) (-738.104) [-737.716] (-739.001) -- 0:00:08
844500 -- (-746.361) [-740.328] (-740.494) (-747.903) * (-738.013) [-737.796] (-738.147) (-739.032) -- 0:00:08
845000 -- (-737.884) [-738.083] (-739.379) (-741.389) * [-738.306] (-739.234) (-738.665) (-738.764) -- 0:00:08
Average standard deviation of split frequencies: 0.011924
845500 -- [-739.191] (-739.888) (-739.036) (-737.321) * [-739.411] (-738.964) (-738.831) (-737.661) -- 0:00:08
846000 -- (-739.712) (-737.708) (-737.767) [-740.257] * (-741.568) (-738.476) (-739.077) [-738.837] -- 0:00:08
846500 -- (-744.082) (-737.750) (-737.871) [-738.561] * [-742.624] (-744.497) (-739.741) (-740.258) -- 0:00:08
847000 -- (-743.922) (-737.727) [-739.967] (-737.748) * (-737.808) (-740.171) (-737.262) [-738.700] -- 0:00:08
847500 -- (-737.785) (-737.772) [-739.991] (-738.335) * [-741.546] (-738.829) (-744.109) (-739.110) -- 0:00:08
848000 -- (-738.661) (-738.681) [-737.302] (-739.586) * (-742.835) [-741.352] (-745.113) (-742.482) -- 0:00:08
848500 -- [-737.712] (-744.839) (-739.451) (-741.089) * (-741.721) (-741.038) [-737.741] (-739.569) -- 0:00:08
849000 -- [-738.158] (-737.643) (-739.133) (-739.663) * (-744.147) [-739.030] (-739.521) (-737.041) -- 0:00:08
849500 -- (-740.585) [-738.362] (-740.641) (-743.614) * (-739.990) (-737.994) [-740.226] (-738.577) -- 0:00:08
850000 -- [-738.653] (-739.012) (-738.800) (-741.382) * [-743.106] (-739.650) (-741.852) (-739.175) -- 0:00:08
Average standard deviation of split frequencies: 0.011859
850500 -- [-738.116] (-744.855) (-742.479) (-741.673) * (-743.703) [-740.721] (-740.077) (-739.910) -- 0:00:08
851000 -- [-743.907] (-740.433) (-741.149) (-738.088) * (-742.819) (-738.096) (-740.086) [-739.015] -- 0:00:08
851500 -- (-738.554) (-738.059) [-742.201] (-738.586) * (-737.006) (-737.509) (-737.613) [-739.768] -- 0:00:08
852000 -- (-739.041) (-737.414) [-738.924] (-738.725) * (-737.334) (-739.546) (-740.553) [-737.741] -- 0:00:07
852500 -- (-739.259) (-740.758) [-740.417] (-740.880) * (-739.616) (-739.349) [-743.868] (-742.174) -- 0:00:07
853000 -- [-738.168] (-737.360) (-740.468) (-737.479) * (-740.851) [-739.169] (-738.238) (-738.342) -- 0:00:07
853500 -- [-740.042] (-740.666) (-739.024) (-740.291) * (-742.792) [-738.337] (-738.970) (-741.613) -- 0:00:07
854000 -- [-740.661] (-738.144) (-738.824) (-739.524) * (-741.156) (-737.629) (-739.819) [-739.637] -- 0:00:07
854500 -- [-738.987] (-738.442) (-740.977) (-745.191) * (-743.835) (-742.725) (-740.493) [-741.815] -- 0:00:07
855000 -- (-738.209) [-738.983] (-741.474) (-741.015) * (-740.745) [-740.790] (-739.932) (-741.131) -- 0:00:07
Average standard deviation of split frequencies: 0.011675
855500 -- [-740.111] (-738.672) (-741.749) (-744.215) * (-738.690) (-743.806) (-738.805) [-740.209] -- 0:00:07
856000 -- (-737.652) [-738.642] (-740.659) (-740.091) * (-738.397) (-739.487) [-738.275] (-739.859) -- 0:00:07
856500 -- (-738.157) [-738.030] (-738.884) (-738.484) * [-738.304] (-737.822) (-741.617) (-739.547) -- 0:00:07
857000 -- (-738.908) (-737.358) (-739.992) [-739.069] * (-738.550) [-738.393] (-738.922) (-738.958) -- 0:00:07
857500 -- (-739.357) [-737.167] (-742.190) (-742.211) * [-740.314] (-738.534) (-738.391) (-738.367) -- 0:00:07
858000 -- (-740.128) [-737.495] (-738.815) (-739.243) * (-743.857) (-740.167) [-737.236] (-740.031) -- 0:00:07
858500 -- (-742.672) [-737.165] (-738.850) (-738.509) * (-738.194) [-739.811] (-737.521) (-742.025) -- 0:00:07
859000 -- (-739.522) [-737.170] (-738.343) (-738.932) * (-739.158) [-740.268] (-737.691) (-741.373) -- 0:00:07
859500 -- (-740.159) (-741.565) [-738.855] (-738.469) * [-739.738] (-739.361) (-737.391) (-738.447) -- 0:00:07
860000 -- (-738.067) (-737.265) [-740.734] (-738.617) * (-739.653) (-740.664) (-739.169) [-738.061] -- 0:00:07
Average standard deviation of split frequencies: 0.011173
860500 -- [-738.054] (-740.422) (-738.716) (-737.696) * (-740.070) (-737.067) (-738.965) [-737.570] -- 0:00:07
861000 -- (-737.552) (-741.596) (-741.654) [-738.050] * (-737.583) (-738.893) (-737.107) [-742.264] -- 0:00:07
861500 -- (-740.509) (-739.192) [-740.024] (-744.092) * (-743.809) [-741.488] (-736.987) (-742.660) -- 0:00:07
862000 -- (-744.000) [-737.914] (-738.848) (-741.514) * (-742.699) [-742.116] (-738.442) (-739.397) -- 0:00:07
862500 -- (-738.013) [-737.406] (-738.369) (-737.472) * (-737.586) (-738.585) [-738.233] (-740.523) -- 0:00:07
863000 -- (-738.181) (-740.516) [-738.050] (-739.636) * (-739.566) (-740.422) [-738.148] (-737.970) -- 0:00:07
863500 -- (-739.263) (-737.824) [-737.509] (-741.597) * (-740.179) (-738.271) [-738.621] (-738.787) -- 0:00:07
864000 -- (-741.004) (-739.657) [-739.229] (-743.135) * (-745.034) (-739.916) (-737.879) [-738.611] -- 0:00:07
864500 -- (-737.356) (-741.106) [-742.484] (-742.547) * (-737.470) (-740.247) (-738.979) [-737.124] -- 0:00:07
865000 -- (-739.274) (-737.062) (-737.631) [-738.663] * [-738.506] (-740.218) (-737.420) (-738.737) -- 0:00:07
Average standard deviation of split frequencies: 0.009907
865500 -- (-740.423) (-738.555) (-738.945) [-738.815] * (-738.766) [-742.763] (-737.315) (-740.232) -- 0:00:07
866000 -- (-739.434) [-738.027] (-742.097) (-742.457) * (-737.806) [-739.842] (-737.555) (-737.465) -- 0:00:07
866500 -- [-737.906] (-737.345) (-740.844) (-740.461) * [-739.346] (-742.315) (-738.270) (-737.602) -- 0:00:07
867000 -- (-739.438) (-738.381) (-744.121) [-739.846] * (-739.937) (-740.044) (-738.508) [-738.164] -- 0:00:07
867500 -- (-737.728) (-742.257) [-738.832] (-742.475) * (-738.641) (-739.265) (-740.043) [-738.426] -- 0:00:07
868000 -- (-738.354) [-741.529] (-738.453) (-739.280) * (-739.138) (-740.739) (-738.556) [-739.594] -- 0:00:07
868500 -- (-740.660) (-743.265) [-739.183] (-741.134) * (-738.219) (-738.362) (-739.048) [-738.951] -- 0:00:07
869000 -- [-740.202] (-739.666) (-742.248) (-738.075) * (-737.953) (-738.708) (-739.230) [-738.731] -- 0:00:07
869500 -- (-737.433) (-738.727) [-740.174] (-739.794) * [-737.065] (-740.008) (-739.827) (-739.271) -- 0:00:07
870000 -- (-739.100) (-743.208) [-741.374] (-743.278) * (-738.295) (-739.661) [-739.903] (-737.865) -- 0:00:07
Average standard deviation of split frequencies: 0.010504
870500 -- (-739.272) [-742.073] (-741.521) (-739.059) * (-737.565) (-738.205) [-742.244] (-737.290) -- 0:00:06
871000 -- (-738.058) [-740.146] (-738.432) (-739.051) * (-741.169) (-739.920) (-740.264) [-745.067] -- 0:00:06
871500 -- (-740.282) [-738.521] (-743.804) (-737.875) * (-742.158) (-740.131) [-738.577] (-743.295) -- 0:00:06
872000 -- [-738.834] (-743.757) (-740.228) (-740.234) * (-741.191) [-745.011] (-741.121) (-738.431) -- 0:00:06
872500 -- (-740.676) [-742.868] (-738.481) (-739.649) * (-738.150) (-740.618) [-738.864] (-740.439) -- 0:00:06
873000 -- [-739.719] (-741.791) (-739.719) (-739.165) * (-740.111) (-738.343) [-739.375] (-745.881) -- 0:00:06
873500 -- (-741.698) (-740.327) [-738.128] (-740.218) * (-740.953) (-737.843) (-739.958) [-740.056] -- 0:00:06
874000 -- (-740.735) (-740.253) [-738.601] (-739.102) * [-739.080] (-740.471) (-739.632) (-738.723) -- 0:00:06
874500 -- (-739.490) [-739.474] (-739.676) (-738.475) * (-739.668) (-740.338) [-738.132] (-740.305) -- 0:00:06
875000 -- (-741.951) (-737.243) (-738.882) [-737.815] * (-741.763) (-743.285) (-741.974) [-740.118] -- 0:00:06
Average standard deviation of split frequencies: 0.010225
875500 -- (-741.989) (-741.434) (-738.441) [-739.143] * (-738.470) (-748.403) [-737.175] (-740.914) -- 0:00:06
876000 -- (-745.221) (-739.416) [-736.981] (-742.152) * (-742.832) (-739.877) (-738.526) [-737.651] -- 0:00:06
876500 -- (-739.220) (-739.032) [-743.197] (-737.043) * (-738.013) (-739.268) (-739.265) [-739.387] -- 0:00:06
877000 -- [-737.726] (-742.846) (-742.589) (-738.173) * (-741.055) (-743.504) [-739.909] (-738.453) -- 0:00:06
877500 -- (-738.037) (-740.026) (-737.498) [-737.967] * (-737.469) [-738.279] (-742.817) (-738.589) -- 0:00:06
878000 -- (-744.929) [-739.763] (-738.936) (-745.325) * [-737.963] (-738.279) (-740.125) (-740.045) -- 0:00:06
878500 -- (-738.211) (-741.152) (-740.820) [-742.536] * (-737.817) (-738.437) [-739.681] (-738.552) -- 0:00:06
879000 -- [-739.499] (-741.822) (-741.700) (-741.887) * (-738.355) (-738.784) [-738.557] (-739.004) -- 0:00:06
879500 -- (-742.199) (-739.634) (-739.925) [-738.384] * (-740.275) [-740.420] (-738.107) (-738.144) -- 0:00:06
880000 -- (-737.665) (-738.516) (-741.454) [-743.438] * [-737.636] (-738.561) (-739.455) (-737.932) -- 0:00:06
Average standard deviation of split frequencies: 0.010599
880500 -- (-738.333) (-737.902) [-740.414] (-745.404) * (-738.053) (-741.414) [-741.174] (-737.944) -- 0:00:06
881000 -- (-738.447) (-741.564) (-739.612) [-738.065] * [-739.725] (-738.175) (-743.399) (-737.507) -- 0:00:06
881500 -- (-737.841) [-738.024] (-738.698) (-738.090) * (-741.676) (-738.539) [-739.688] (-738.156) -- 0:00:06
882000 -- (-738.009) [-740.400] (-738.499) (-739.313) * [-738.942] (-740.389) (-740.020) (-738.706) -- 0:00:06
882500 -- (-739.107) (-739.961) [-737.745] (-738.418) * (-739.380) [-741.615] (-739.885) (-737.558) -- 0:00:06
883000 -- (-741.793) (-737.636) (-737.307) [-738.193] * (-738.205) [-741.840] (-739.071) (-743.453) -- 0:00:06
883500 -- (-738.444) (-740.100) [-737.293] (-739.716) * [-738.449] (-741.747) (-739.323) (-741.986) -- 0:00:06
884000 -- [-740.512] (-739.453) (-739.407) (-743.133) * (-738.894) [-740.138] (-739.612) (-738.275) -- 0:00:06
884500 -- [-742.508] (-743.059) (-738.214) (-741.960) * (-739.272) (-742.885) (-738.570) [-739.417] -- 0:00:06
885000 -- (-743.994) (-742.395) (-738.343) [-740.801] * (-741.935) (-740.635) [-737.746] (-737.807) -- 0:00:06
Average standard deviation of split frequencies: 0.010003
885500 -- [-737.363] (-742.611) (-740.402) (-737.929) * (-741.821) (-740.601) [-739.037] (-740.171) -- 0:00:06
886000 -- (-741.305) [-738.274] (-738.291) (-740.657) * (-740.152) (-741.690) (-737.704) [-742.725] -- 0:00:06
886500 -- (-742.750) (-740.361) [-738.976] (-740.028) * (-739.571) [-738.140] (-739.581) (-739.160) -- 0:00:06
887000 -- [-742.192] (-739.963) (-740.253) (-743.488) * (-738.947) (-738.947) [-737.707] (-739.611) -- 0:00:06
887500 -- (-738.835) [-739.246] (-740.784) (-738.682) * (-738.161) (-738.439) [-737.503] (-738.848) -- 0:00:06
888000 -- (-738.061) (-738.300) [-737.481] (-741.447) * (-737.133) [-737.920] (-742.240) (-741.282) -- 0:00:06
888500 -- (-737.957) (-737.750) (-739.787) [-739.066] * (-738.312) (-737.566) [-741.313] (-742.268) -- 0:00:06
889000 -- (-738.757) (-744.019) (-739.996) [-740.948] * (-738.312) [-738.235] (-739.845) (-740.343) -- 0:00:05
889500 -- (-738.925) (-739.846) [-738.172] (-741.360) * [-738.679] (-743.203) (-739.175) (-738.738) -- 0:00:05
890000 -- (-739.896) [-738.992] (-738.007) (-738.748) * (-738.292) (-739.970) [-740.222] (-739.682) -- 0:00:05
Average standard deviation of split frequencies: 0.009739
890500 -- (-738.203) (-739.518) [-738.441] (-738.258) * (-740.541) [-743.313] (-738.998) (-741.908) -- 0:00:05
891000 -- (-738.753) (-740.199) (-738.424) [-739.601] * (-738.441) (-737.495) (-739.804) [-741.949] -- 0:00:05
891500 -- (-739.045) [-740.043] (-739.627) (-740.958) * (-738.130) (-738.948) [-740.180] (-741.038) -- 0:00:05
892000 -- (-740.093) [-741.901] (-739.827) (-737.880) * (-738.883) [-737.383] (-738.934) (-739.685) -- 0:00:05
892500 -- [-739.644] (-745.285) (-738.473) (-738.465) * (-738.816) [-737.494] (-738.798) (-740.026) -- 0:00:05
893000 -- [-739.714] (-739.083) (-737.357) (-741.236) * (-740.204) [-739.233] (-739.966) (-739.017) -- 0:00:05
893500 -- (-738.278) (-738.676) (-739.742) [-739.306] * [-738.787] (-737.948) (-737.725) (-741.850) -- 0:00:05
894000 -- (-738.982) [-743.909] (-738.956) (-743.272) * [-741.299] (-737.302) (-739.828) (-739.023) -- 0:00:05
894500 -- (-739.702) [-738.086] (-739.311) (-741.802) * (-738.694) (-737.885) [-737.664] (-738.285) -- 0:00:05
895000 -- (-741.450) (-737.368) [-741.010] (-738.267) * (-740.087) (-737.315) (-741.215) [-738.377] -- 0:00:05
Average standard deviation of split frequencies: 0.009260
895500 -- [-738.317] (-739.692) (-744.189) (-739.949) * (-738.901) [-738.194] (-738.856) (-739.229) -- 0:00:05
896000 -- (-738.223) (-738.754) (-742.156) [-737.796] * (-738.428) (-737.237) [-738.489] (-738.245) -- 0:00:05
896500 -- (-738.984) (-738.638) (-738.060) [-740.729] * [-737.796] (-737.050) (-743.528) (-737.454) -- 0:00:05
897000 -- (-738.446) (-737.942) [-738.448] (-738.675) * (-740.676) [-738.039] (-740.522) (-739.564) -- 0:00:05
897500 -- [-737.010] (-737.644) (-738.536) (-739.962) * (-737.958) (-740.609) [-737.649] (-738.334) -- 0:00:05
898000 -- [-737.540] (-737.993) (-739.531) (-740.274) * [-737.670] (-737.584) (-740.685) (-741.512) -- 0:00:05
898500 -- (-741.568) [-738.144] (-737.435) (-738.642) * [-738.979] (-738.034) (-740.491) (-738.039) -- 0:00:05
899000 -- (-739.872) (-737.368) (-741.654) [-739.970] * (-741.962) (-737.780) (-742.658) [-738.284] -- 0:00:05
899500 -- (-738.563) [-739.657] (-739.977) (-745.302) * (-740.162) (-739.119) (-741.795) [-740.286] -- 0:00:05
900000 -- (-741.305) (-738.552) [-740.567] (-739.247) * [-740.038] (-738.784) (-745.021) (-739.474) -- 0:00:05
Average standard deviation of split frequencies: 0.009212
900500 -- (-741.058) (-737.786) (-738.101) [-739.350] * (-737.065) [-741.130] (-742.078) (-738.413) -- 0:00:05
901000 -- [-740.354] (-738.211) (-737.653) (-740.358) * (-737.880) [-738.883] (-740.190) (-738.068) -- 0:00:05
901500 -- [-741.087] (-740.486) (-738.616) (-738.010) * [-739.431] (-741.403) (-744.557) (-739.782) -- 0:00:05
902000 -- (-739.053) (-739.309) [-737.274] (-737.370) * [-739.352] (-739.414) (-739.709) (-737.357) -- 0:00:05
902500 -- (-738.393) (-740.882) (-737.621) [-737.436] * [-739.170] (-739.926) (-742.233) (-739.563) -- 0:00:05
903000 -- (-740.430) [-738.201] (-738.668) (-738.085) * (-737.671) (-740.505) [-741.108] (-740.439) -- 0:00:05
903500 -- (-743.476) [-740.887] (-742.103) (-739.641) * (-737.612) [-743.540] (-740.003) (-739.768) -- 0:00:05
904000 -- (-739.027) [-737.914] (-742.946) (-738.825) * (-738.546) (-739.490) [-739.268] (-741.239) -- 0:00:05
904500 -- (-743.024) (-740.509) (-738.973) [-738.064] * (-739.978) (-738.679) [-738.831] (-741.029) -- 0:00:05
905000 -- (-741.049) (-740.606) (-737.801) [-739.035] * [-738.239] (-740.608) (-739.846) (-740.716) -- 0:00:05
Average standard deviation of split frequencies: 0.009262
905500 -- (-738.415) (-738.672) [-738.694] (-737.206) * (-737.726) (-739.140) (-738.088) [-739.170] -- 0:00:05
906000 -- (-738.086) [-738.781] (-737.916) (-739.783) * (-738.522) (-740.784) [-737.856] (-739.225) -- 0:00:05
906500 -- [-738.022] (-737.466) (-738.026) (-738.017) * (-739.208) (-740.115) [-738.661] (-738.809) -- 0:00:05
907000 -- (-738.362) [-739.886] (-737.951) (-737.776) * (-737.479) (-740.626) [-738.762] (-738.701) -- 0:00:05
907500 -- (-742.384) [-739.025] (-737.681) (-739.041) * (-739.327) [-738.985] (-740.337) (-739.581) -- 0:00:04
908000 -- (-739.979) (-744.599) [-737.485] (-740.132) * (-741.850) [-737.649] (-739.742) (-743.538) -- 0:00:04
908500 -- (-740.478) (-742.669) [-738.233] (-739.009) * (-739.222) [-737.931] (-738.184) (-738.050) -- 0:00:04
909000 -- (-743.672) [-737.923] (-737.773) (-738.532) * (-741.555) (-737.602) [-739.603] (-738.581) -- 0:00:04
909500 -- (-737.260) [-737.694] (-737.166) (-738.799) * (-744.860) [-738.105] (-741.579) (-738.444) -- 0:00:04
910000 -- (-737.575) (-741.807) (-738.725) [-737.309] * (-739.535) (-738.453) [-743.705] (-738.477) -- 0:00:04
Average standard deviation of split frequencies: 0.009628
910500 -- (-740.465) [-737.724] (-739.392) (-738.278) * [-740.870] (-737.998) (-742.705) (-742.698) -- 0:00:04
911000 -- (-740.492) (-740.443) [-739.477] (-738.292) * (-738.806) (-737.441) (-739.930) [-740.441] -- 0:00:04
911500 -- (-742.948) [-740.462] (-739.815) (-738.505) * (-740.861) (-737.814) (-739.339) [-736.870] -- 0:00:04
912000 -- (-741.445) (-736.930) [-740.551] (-739.737) * (-739.908) (-737.309) (-739.189) [-738.451] -- 0:00:04
912500 -- (-738.985) [-738.004] (-738.163) (-745.401) * (-741.947) (-739.779) [-738.798] (-740.093) -- 0:00:04
913000 -- [-740.643] (-738.850) (-741.369) (-740.897) * [-740.236] (-740.665) (-737.701) (-739.636) -- 0:00:04
913500 -- (-742.213) [-742.850] (-738.570) (-741.309) * (-743.251) [-738.401] (-741.400) (-741.627) -- 0:00:04
914000 -- (-740.368) [-741.550] (-741.641) (-740.427) * (-742.819) [-738.478] (-738.440) (-741.188) -- 0:00:04
914500 -- (-738.408) [-737.176] (-748.660) (-739.880) * [-740.387] (-737.011) (-737.290) (-740.527) -- 0:00:04
915000 -- (-738.363) (-737.343) [-738.735] (-740.229) * [-738.129] (-739.717) (-738.981) (-739.376) -- 0:00:04
Average standard deviation of split frequencies: 0.009778
915500 -- (-738.300) [-741.362] (-738.750) (-738.435) * [-737.364] (-744.018) (-739.065) (-737.521) -- 0:00:04
916000 -- [-739.924] (-738.587) (-739.232) (-737.560) * (-738.493) [-739.679] (-739.296) (-741.264) -- 0:00:04
916500 -- (-740.195) [-738.003] (-739.344) (-738.090) * [-738.007] (-740.955) (-739.914) (-737.472) -- 0:00:04
917000 -- [-738.856] (-742.922) (-739.676) (-740.707) * [-740.031] (-738.739) (-740.824) (-740.752) -- 0:00:04
917500 -- [-738.007] (-738.498) (-743.341) (-737.954) * (-738.972) (-737.433) [-739.412] (-737.219) -- 0:00:04
918000 -- [-737.940] (-741.108) (-738.463) (-738.183) * (-739.138) [-736.787] (-742.785) (-738.754) -- 0:00:04
918500 -- (-740.882) [-739.200] (-739.188) (-738.925) * [-741.055] (-737.599) (-738.410) (-742.177) -- 0:00:04
919000 -- [-738.571] (-741.972) (-739.609) (-738.037) * [-741.254] (-738.120) (-739.242) (-741.960) -- 0:00:04
919500 -- (-737.895) (-740.632) [-737.690] (-737.108) * (-741.136) (-738.004) (-742.623) [-737.110] -- 0:00:04
920000 -- (-738.620) (-738.139) (-738.093) [-740.140] * (-739.278) [-741.301] (-738.655) (-743.511) -- 0:00:04
Average standard deviation of split frequencies: 0.009728
920500 -- (-741.697) [-737.389] (-740.691) (-746.018) * (-739.070) (-737.301) [-737.545] (-738.355) -- 0:00:04
921000 -- (-741.353) (-741.131) [-739.398] (-738.248) * (-737.280) (-739.629) (-739.302) [-739.067] -- 0:00:04
921500 -- (-737.257) (-737.658) (-737.956) [-737.863] * (-738.735) [-739.120] (-737.177) (-743.784) -- 0:00:04
922000 -- (-738.922) (-742.113) (-738.676) [-737.917] * [-737.883] (-739.712) (-741.654) (-741.328) -- 0:00:04
922500 -- (-738.173) (-740.431) [-738.136] (-739.138) * (-739.209) (-738.897) (-739.194) [-741.530] -- 0:00:04
923000 -- (-743.831) (-740.571) [-739.661] (-737.976) * (-739.704) (-737.877) (-739.149) [-739.937] -- 0:00:04
923500 -- (-739.984) (-738.520) [-738.914] (-738.458) * (-737.642) (-742.355) (-739.816) [-740.507] -- 0:00:04
924000 -- (-739.750) [-738.993] (-739.456) (-739.207) * (-738.032) [-738.453] (-739.592) (-737.816) -- 0:00:04
924500 -- [-740.557] (-737.906) (-739.458) (-738.114) * (-739.762) [-741.874] (-741.290) (-744.099) -- 0:00:04
925000 -- (-740.228) (-741.477) (-739.856) [-737.117] * (-737.662) (-740.930) (-739.863) [-739.778] -- 0:00:04
Average standard deviation of split frequencies: 0.009265
925500 -- (-740.914) [-741.891] (-739.492) (-737.197) * (-739.372) (-742.935) [-741.792] (-740.076) -- 0:00:04
926000 -- (-738.548) (-741.782) [-739.405] (-739.980) * [-742.625] (-741.474) (-739.693) (-742.927) -- 0:00:03
926500 -- (-738.872) (-739.044) (-739.988) [-737.868] * (-738.357) (-746.463) (-738.775) [-740.684] -- 0:00:03
927000 -- [-739.669] (-737.944) (-739.065) (-738.956) * [-738.727] (-743.395) (-739.443) (-739.261) -- 0:00:03
927500 -- (-737.883) (-738.343) [-737.901] (-738.315) * (-738.501) (-737.085) [-739.450] (-738.495) -- 0:00:03
928000 -- (-737.998) (-737.597) (-738.669) [-739.685] * (-742.600) (-739.947) [-737.722] (-740.055) -- 0:00:03
928500 -- (-745.157) [-738.922] (-737.668) (-738.973) * [-742.126] (-743.692) (-741.845) (-739.920) -- 0:00:03
929000 -- (-738.651) (-741.810) (-737.475) [-739.047] * (-739.819) (-742.901) [-741.525] (-741.579) -- 0:00:03
929500 -- [-744.050] (-741.778) (-740.228) (-740.301) * (-740.451) (-739.053) [-737.445] (-738.648) -- 0:00:03
930000 -- [-742.864] (-739.293) (-740.754) (-746.030) * (-741.779) (-739.927) [-737.424] (-737.688) -- 0:00:03
Average standard deviation of split frequencies: 0.009421
930500 -- (-738.976) (-739.306) (-738.410) [-739.442] * (-750.749) (-738.969) [-741.689] (-739.086) -- 0:00:03
931000 -- (-739.835) (-741.654) [-740.415] (-740.228) * (-740.998) (-741.588) [-737.982] (-738.506) -- 0:00:03
931500 -- (-737.795) [-742.101] (-738.678) (-745.128) * (-738.502) [-741.477] (-738.348) (-741.503) -- 0:00:03
932000 -- [-737.062] (-743.144) (-741.639) (-751.528) * (-738.093) (-741.808) [-738.348] (-739.080) -- 0:00:03
932500 -- (-738.167) (-739.584) [-737.766] (-745.222) * (-738.490) (-737.479) [-741.007] (-740.006) -- 0:00:03
933000 -- (-740.305) (-739.187) [-741.313] (-744.275) * (-737.459) (-739.842) [-739.171] (-739.718) -- 0:00:03
933500 -- [-737.967] (-739.652) (-740.127) (-737.902) * (-739.081) (-743.986) (-740.109) [-737.902] -- 0:00:03
934000 -- (-739.143) (-740.064) (-739.566) [-737.638] * [-746.695] (-739.680) (-740.270) (-737.255) -- 0:00:03
934500 -- [-738.590] (-738.227) (-744.661) (-739.499) * (-740.635) (-739.502) (-740.566) [-737.202] -- 0:00:03
935000 -- (-739.332) [-738.115] (-741.052) (-737.369) * (-738.377) [-738.825] (-741.000) (-738.500) -- 0:00:03
Average standard deviation of split frequencies: 0.009065
935500 -- (-739.915) [-737.311] (-742.706) (-737.772) * (-737.818) (-739.638) [-739.523] (-742.209) -- 0:00:03
936000 -- (-738.162) (-739.364) [-739.851] (-741.387) * (-738.167) (-739.045) (-739.914) [-740.359] -- 0:00:03
936500 -- (-738.050) [-738.541] (-739.768) (-737.716) * (-739.052) [-738.460] (-738.861) (-740.973) -- 0:00:03
937000 -- [-738.160] (-738.650) (-741.452) (-739.569) * (-738.316) (-739.027) (-737.767) [-741.111] -- 0:00:03
937500 -- (-739.121) [-737.753] (-739.318) (-739.311) * (-740.049) [-742.316] (-738.712) (-738.366) -- 0:00:03
938000 -- (-739.606) (-741.223) (-739.253) [-738.279] * [-738.397] (-737.886) (-739.072) (-737.724) -- 0:00:03
938500 -- (-740.553) [-739.199] (-739.069) (-738.005) * (-739.018) (-737.314) [-739.089] (-741.106) -- 0:00:03
939000 -- [-738.287] (-743.264) (-739.763) (-741.163) * (-745.558) [-740.088] (-738.745) (-738.587) -- 0:00:03
939500 -- [-739.629] (-739.511) (-738.115) (-739.560) * (-739.598) (-739.124) [-739.737] (-738.410) -- 0:00:03
940000 -- (-741.188) (-742.709) (-740.164) [-738.337] * (-738.179) [-742.994] (-739.728) (-740.536) -- 0:00:03
Average standard deviation of split frequencies: 0.009421
940500 -- (-741.075) (-737.303) [-738.184] (-738.178) * (-739.052) (-737.407) (-737.954) [-740.687] -- 0:00:03
941000 -- (-745.289) (-739.343) (-739.532) [-738.873] * (-738.982) (-739.223) [-738.141] (-740.981) -- 0:00:03
941500 -- (-740.093) [-739.327] (-738.787) (-739.325) * (-737.402) (-737.803) [-739.951] (-737.124) -- 0:00:03
942000 -- (-738.390) (-738.488) [-737.184] (-740.655) * [-737.251] (-743.454) (-738.511) (-737.490) -- 0:00:03
942500 -- (-737.941) (-741.009) [-740.782] (-739.064) * (-741.108) (-750.422) (-740.027) [-738.982] -- 0:00:03
943000 -- (-738.232) (-740.288) (-738.353) [-738.810] * (-747.264) [-741.663] (-738.496) (-738.498) -- 0:00:03
943500 -- (-740.698) (-742.591) (-739.310) [-738.824] * (-741.120) (-738.517) [-739.221] (-738.348) -- 0:00:03
944000 -- (-737.650) [-741.514] (-742.050) (-739.359) * (-739.036) (-737.015) (-738.311) [-738.426] -- 0:00:03
944500 -- (-737.851) [-737.471] (-746.539) (-740.369) * (-737.655) (-737.329) (-738.389) [-738.771] -- 0:00:02
945000 -- [-737.678] (-740.150) (-738.883) (-739.803) * (-739.191) [-739.402] (-743.035) (-738.280) -- 0:00:02
Average standard deviation of split frequencies: 0.009368
945500 -- (-737.730) (-739.489) (-737.273) [-740.999] * (-740.433) (-739.035) (-739.984) [-737.303] -- 0:00:02
946000 -- [-739.971] (-736.944) (-739.971) (-737.912) * (-739.117) [-738.630] (-740.653) (-737.769) -- 0:00:02
946500 -- (-738.765) (-736.825) (-740.737) [-738.258] * [-739.781] (-742.068) (-736.959) (-738.615) -- 0:00:02
947000 -- (-740.579) [-738.324] (-738.854) (-739.744) * (-741.629) [-740.858] (-742.781) (-742.041) -- 0:00:02
947500 -- [-741.779] (-738.960) (-740.649) (-741.985) * [-739.977] (-741.414) (-741.890) (-741.700) -- 0:00:02
948000 -- (-742.742) [-737.580] (-740.441) (-743.964) * [-739.139] (-740.762) (-740.630) (-739.779) -- 0:00:02
948500 -- (-741.460) [-738.602] (-739.161) (-742.741) * [-741.881] (-739.536) (-738.634) (-738.837) -- 0:00:02
949000 -- (-737.749) (-738.821) (-742.52 