--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 12:27:44 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ML2691/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -738.55 -741.99
2 -738.45 -743.25
--------------------------------------
TOTAL -738.49 -742.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.699620 0.070222 0.218391 1.209717 0.662556 1405.43 1453.22 1.000
r(A<->C){all} 0.167493 0.020951 0.000424 0.462585 0.124939 190.69 228.26 1.003
r(A<->G){all} 0.163548 0.019990 0.000054 0.462380 0.122722 167.59 189.47 1.001
r(A<->T){all} 0.168043 0.020112 0.000135 0.458560 0.130684 189.76 257.06 1.000
r(C<->G){all} 0.177677 0.021336 0.000038 0.467690 0.144266 163.54 257.34 1.000
r(C<->T){all} 0.164997 0.020843 0.000072 0.457211 0.120740 172.70 212.10 1.002
r(G<->T){all} 0.158243 0.018373 0.000009 0.427983 0.122321 279.50 300.89 1.000
pi(A){all} 0.212969 0.000309 0.180432 0.248976 0.212752 1142.23 1261.24 1.000
pi(C){all} 0.307320 0.000396 0.268487 0.344905 0.307275 1235.89 1316.62 1.002
pi(G){all} 0.293507 0.000401 0.255125 0.333940 0.293696 1180.96 1307.25 1.000
pi(T){all} 0.186204 0.000277 0.154793 0.218666 0.185417 1234.84 1367.92 1.002
alpha{1,2} 0.422802 0.240335 0.000231 1.392820 0.252505 1322.11 1347.68 1.000
alpha{3} 0.456241 0.235051 0.000220 1.392285 0.305538 1109.92 1141.21 1.000
pinvar{all} 0.996958 0.000013 0.990220 1.000000 0.998158 1152.70 1326.85 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -720.494723
Model 2: PositiveSelection -720.494728
Model 0: one-ratio -720.494733
Model 7: beta -720.494709
Model 8: beta&w>1 -720.494692
Model 0 vs 1 1.9999999949504854E-5
Model 2 vs 1 9.999999974752427E-6
Model 8 vs 7 3.399999991415825E-5
>C1
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C2
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C3
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C4
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C5
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=180
C1 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C2 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C3 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C4 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C5 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
**************************************************
C1 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C2 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C3 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C4 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C5 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
**************************************************
C1 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C2 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C3 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C4 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C5 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
**************************************************
C1 LGLESSEREVKWLNELIAAERALLGRVEQT
C2 LGLESSEREVKWLNELIAAERALLGRVEQT
C3 LGLESSEREVKWLNELIAAERALLGRVEQT
C4 LGLESSEREVKWLNELIAAERALLGRVEQT
C5 LGLESSEREVKWLNELIAAERALLGRVEQT
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 180 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 180 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3600]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3600]--->[3600]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.422 Mb, Max= 30.641 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C2 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C3 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C4 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
C5 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
**************************************************
C1 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C2 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C3 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C4 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
C5 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
**************************************************
C1 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C2 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C3 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C4 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
C5 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
**************************************************
C1 LGLESSEREVKWLNELIAAERALLGRVEQT
C2 LGLESSEREVKWLNELIAAERALLGRVEQT
C3 LGLESSEREVKWLNELIAAERALLGRVEQT
C4 LGLESSEREVKWLNELIAAERALLGRVEQT
C5 LGLESSEREVKWLNELIAAERALLGRVEQT
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
C2 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
C3 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
C4 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
C5 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
**************************************************
C1 CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
C2 CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
C3 CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
C4 CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
C5 CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
**************************************************
C1 TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
C2 TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
C3 TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
C4 TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
C5 TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
**************************************************
C1 CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
C2 CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
C3 CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
C4 CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
C5 CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
**************************************************
C1 GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
C2 GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
C3 GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
C4 GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
C5 GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
**************************************************
C1 TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
C2 TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
C3 TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
C4 TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
C5 TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
**************************************************
C1 TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
C2 TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
C3 TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
C4 TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
C5 TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
**************************************************
C1 AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
C2 AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
C3 AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
C4 AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
C5 AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
**************************************************
C1 TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
C2 TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
C3 TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
C4 TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
C5 TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
**************************************************
C1 CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
C2 CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
C3 CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
C4 CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
C5 CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
**************************************************
C1 TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
C2 TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
C3 TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
C4 TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
C5 TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
****************************************
>C1
ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>C2
ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>C3
ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>C4
ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>C5
ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG
CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT
TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG
CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG
GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG
TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC
TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA
AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG
TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA
CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT
TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>C1
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C2
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C3
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C4
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
>C5
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
LGLESSEREVKWLNELIAAERALLGRVEQT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 540 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579782398
Setting output file names to "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1391755667
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9382846395
Seed = 1782651824
Swapseed = 1579782398
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1109.159193 -- -25.624409
Chain 2 -- -1109.159239 -- -25.624409
Chain 3 -- -1109.159193 -- -25.624409
Chain 4 -- -1109.159193 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1109.159193 -- -25.624409
Chain 2 -- -1109.159193 -- -25.624409
Chain 3 -- -1109.159193 -- -25.624409
Chain 4 -- -1109.159193 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1109.159] (-1109.159) (-1109.159) (-1109.159) * [-1109.159] (-1109.159) (-1109.159) (-1109.159)
500 -- (-757.947) (-747.126) [-753.882] (-749.760) * (-745.845) (-753.232) (-745.888) [-753.763] -- 0:00:00
1000 -- (-742.901) (-748.838) (-751.482) [-745.861] * (-746.094) (-760.934) [-744.873] (-750.684) -- 0:00:00
1500 -- (-741.724) [-745.744] (-743.054) (-750.457) * (-745.786) (-749.924) [-743.716] (-742.789) -- 0:00:00
2000 -- [-744.969] (-748.996) (-746.633) (-745.817) * (-743.073) (-746.471) [-747.255] (-745.093) -- 0:00:00
2500 -- (-742.766) [-744.644] (-743.811) (-741.632) * (-743.851) (-743.842) (-746.311) [-741.577] -- 0:00:00
3000 -- [-746.423] (-748.278) (-743.666) (-748.489) * [-744.191] (-749.319) (-747.352) (-746.051) -- 0:00:00
3500 -- (-751.951) (-741.964) [-747.402] (-747.108) * [-746.963] (-743.933) (-747.451) (-743.555) -- 0:00:00
4000 -- (-746.791) (-745.467) (-745.315) [-749.949] * [-744.555] (-752.752) (-747.472) (-745.440) -- 0:00:00
4500 -- [-744.388] (-744.097) (-745.163) (-747.936) * [-743.399] (-747.571) (-741.173) (-739.134) -- 0:00:00
5000 -- [-748.120] (-740.181) (-746.953) (-743.495) * (-747.126) [-740.699] (-746.788) (-748.097) -- 0:00:00
Average standard deviation of split frequencies: 0.137493
5500 -- (-746.461) (-742.851) (-746.743) [-748.800] * (-746.927) (-749.415) (-741.730) [-745.169] -- 0:00:00
6000 -- (-753.034) (-745.891) (-743.806) [-740.975] * (-748.415) [-744.235] (-750.330) (-747.285) -- 0:00:00
6500 -- (-745.293) (-749.899) (-746.657) [-745.145] * (-751.319) [-743.116] (-747.637) (-746.171) -- 0:02:32
7000 -- (-744.839) [-753.400] (-747.202) (-745.703) * (-746.280) (-743.311) (-750.055) [-740.708] -- 0:02:21
7500 -- (-748.972) [-758.186] (-747.618) (-752.105) * (-742.740) (-751.539) (-745.586) [-743.364] -- 0:02:12
8000 -- [-743.130] (-747.397) (-741.504) (-746.583) * (-747.336) (-745.341) (-741.100) [-746.186] -- 0:02:04
8500 -- (-747.200) [-748.549] (-742.513) (-751.492) * (-747.775) (-749.757) (-741.164) [-739.451] -- 0:01:56
9000 -- [-741.511] (-744.907) (-742.297) (-745.440) * (-744.980) [-746.335] (-744.766) (-744.801) -- 0:01:50
9500 -- (-748.884) [-745.040] (-740.305) (-747.995) * (-744.285) (-755.596) [-745.052] (-746.134) -- 0:01:44
10000 -- (-744.215) [-745.222] (-752.276) (-744.310) * (-741.664) (-743.667) (-749.961) [-750.957] -- 0:01:39
Average standard deviation of split frequencies: 0.035355
10500 -- [-751.566] (-751.827) (-741.785) (-747.719) * [-746.199] (-744.793) (-740.839) (-746.800) -- 0:01:34
11000 -- (-748.371) [-747.190] (-744.030) (-749.590) * [-742.834] (-741.719) (-751.135) (-744.677) -- 0:01:29
11500 -- [-746.061] (-746.414) (-742.015) (-751.247) * (-748.379) [-745.104] (-749.753) (-745.509) -- 0:01:25
12000 -- (-750.541) (-741.343) (-747.973) [-751.927] * (-749.957) (-745.267) (-741.064) [-743.247] -- 0:01:22
12500 -- [-746.127] (-749.248) (-746.225) (-742.100) * [-744.802] (-742.091) (-749.048) (-749.913) -- 0:01:19
13000 -- (-737.758) (-745.789) [-742.035] (-744.206) * (-740.669) (-747.785) (-750.541) [-743.906] -- 0:01:15
13500 -- (-742.236) (-747.274) [-746.719] (-747.326) * (-750.495) (-748.386) [-744.358] (-746.092) -- 0:01:13
14000 -- (-743.940) (-745.284) (-758.739) [-742.613] * (-745.477) [-742.233] (-747.883) (-745.194) -- 0:01:10
14500 -- (-741.528) (-742.389) (-741.560) [-742.655] * (-746.496) (-743.401) (-745.126) [-744.762] -- 0:01:07
15000 -- [-737.312] (-749.818) (-751.300) (-747.858) * (-745.754) (-746.007) [-748.597] (-745.906) -- 0:01:05
Average standard deviation of split frequencies: 0.041248
15500 -- (-739.243) (-747.198) (-748.623) [-743.169] * (-741.908) (-748.411) [-744.609] (-756.865) -- 0:01:03
16000 -- (-740.294) (-744.687) [-739.461] (-743.942) * (-755.781) [-742.671] (-743.171) (-746.578) -- 0:01:01
16500 -- [-739.912] (-751.910) (-750.559) (-744.149) * [-747.949] (-757.571) (-744.110) (-749.484) -- 0:00:59
17000 -- (-739.873) (-744.946) (-745.362) [-746.071] * (-740.080) [-749.785] (-747.884) (-752.617) -- 0:00:57
17500 -- (-738.501) (-742.815) [-741.942] (-747.261) * [-750.145] (-746.496) (-749.278) (-748.048) -- 0:00:56
18000 -- [-738.497] (-741.989) (-741.463) (-752.617) * (-752.425) (-742.232) (-747.429) [-746.284] -- 0:00:54
18500 -- [-738.681] (-747.280) (-747.143) (-747.805) * (-753.784) (-739.863) (-750.046) [-739.580] -- 0:00:53
19000 -- [-738.626] (-754.664) (-744.722) (-746.283) * (-744.583) (-751.149) [-740.158] (-755.385) -- 0:00:51
19500 -- (-739.292) (-745.687) [-742.550] (-753.010) * (-749.497) [-743.115] (-746.294) (-743.601) -- 0:00:50
20000 -- [-739.042] (-748.414) (-746.820) (-750.941) * (-745.204) (-749.727) [-747.919] (-742.421) -- 0:00:49
Average standard deviation of split frequencies: 0.036496
20500 -- (-738.717) (-748.766) (-746.180) [-746.395] * (-745.075) [-742.592] (-750.446) (-745.955) -- 0:00:47
21000 -- (-737.132) (-746.067) [-744.088] (-751.278) * (-751.676) [-746.933] (-744.509) (-754.256) -- 0:00:46
21500 -- (-738.072) [-745.786] (-747.307) (-744.614) * [-744.808] (-743.418) (-749.817) (-749.962) -- 0:00:45
22000 -- (-738.874) (-743.085) [-743.538] (-753.929) * (-744.206) (-746.501) (-746.553) [-745.321] -- 0:00:44
22500 -- (-737.050) (-745.378) [-747.632] (-744.456) * (-747.619) (-748.967) [-743.468] (-748.217) -- 0:00:43
23000 -- [-738.250] (-747.695) (-741.612) (-749.735) * (-743.839) (-746.725) [-743.409] (-740.873) -- 0:00:42
23500 -- [-740.052] (-753.290) (-744.946) (-748.421) * [-745.617] (-743.989) (-750.657) (-745.994) -- 0:01:23
24000 -- (-740.991) (-743.389) (-747.333) [-745.612] * (-743.600) (-749.251) (-750.146) [-749.999] -- 0:01:21
24500 -- [-738.973] (-743.286) (-745.253) (-747.552) * (-741.454) [-745.398] (-747.259) (-747.188) -- 0:01:19
25000 -- [-737.765] (-748.146) (-745.068) (-750.693) * (-737.892) (-742.257) (-745.618) [-743.852] -- 0:01:18
Average standard deviation of split frequencies: 0.032636
25500 -- (-742.242) (-745.425) (-746.618) [-742.700] * (-737.969) [-742.942] (-746.718) (-742.602) -- 0:01:16
26000 -- (-738.107) (-743.190) [-742.738] (-739.626) * [-741.106] (-745.294) (-744.920) (-751.602) -- 0:01:14
26500 -- (-737.292) (-747.399) [-749.192] (-738.899) * (-740.033) (-745.580) (-745.593) [-744.589] -- 0:01:13
27000 -- (-741.369) [-740.715] (-747.453) (-739.177) * (-741.851) [-744.495] (-742.317) (-743.574) -- 0:01:12
27500 -- (-740.162) [-741.869] (-743.128) (-740.785) * (-739.697) (-742.783) [-746.642] (-745.177) -- 0:01:10
28000 -- (-740.903) (-747.128) (-741.428) [-741.156] * [-741.361] (-741.112) (-743.791) (-745.118) -- 0:01:09
28500 -- (-738.855) (-743.520) [-739.792] (-742.861) * (-738.110) (-758.361) (-743.710) [-739.791] -- 0:01:08
29000 -- [-738.464] (-740.105) (-739.674) (-738.740) * (-744.122) [-748.132] (-746.536) (-746.237) -- 0:01:06
29500 -- (-738.758) (-738.298) [-739.984] (-738.762) * [-741.686] (-750.173) (-748.864) (-747.010) -- 0:01:05
30000 -- (-742.047) [-738.377] (-739.209) (-737.330) * (-739.967) (-749.237) [-742.727] (-754.196) -- 0:01:04
Average standard deviation of split frequencies: 0.052264
30500 -- (-738.489) (-738.579) [-741.218] (-741.777) * [-737.201] (-748.577) (-744.824) (-749.164) -- 0:01:03
31000 -- [-739.019] (-737.536) (-739.539) (-743.730) * (-738.308) (-747.326) [-743.554] (-740.684) -- 0:01:02
31500 -- (-740.409) (-739.302) (-739.425) [-740.683] * [-738.610] (-752.841) (-740.322) (-737.979) -- 0:01:01
32000 -- (-739.085) [-738.111] (-739.630) (-741.728) * (-738.519) (-744.452) (-739.202) [-739.048] -- 0:01:00
32500 -- (-739.015) (-740.861) (-741.511) [-741.938] * (-737.818) (-742.946) [-739.075] (-739.516) -- 0:00:59
33000 -- [-738.745] (-741.128) (-739.012) (-743.049) * [-737.975] (-745.879) (-737.268) (-737.195) -- 0:00:58
33500 -- (-740.713) (-739.244) [-737.402] (-747.953) * (-737.623) (-747.352) (-740.100) [-740.645] -- 0:00:57
34000 -- (-737.723) [-738.380] (-737.806) (-749.522) * (-740.154) (-753.470) [-739.076] (-743.932) -- 0:00:56
34500 -- (-737.770) (-738.349) (-737.676) [-738.197] * (-739.994) (-748.613) (-739.856) [-738.682] -- 0:00:55
35000 -- (-739.566) (-743.398) (-741.878) [-740.572] * (-738.009) [-748.080] (-738.072) (-741.780) -- 0:00:55
Average standard deviation of split frequencies: 0.039284
35500 -- (-738.239) (-742.312) [-741.559] (-739.881) * [-737.372] (-748.198) (-737.250) (-741.224) -- 0:00:54
36000 -- (-741.167) (-743.673) (-743.314) [-738.537] * (-737.232) (-745.182) (-741.669) [-738.720] -- 0:00:53
36500 -- [-738.121] (-738.973) (-739.497) (-743.459) * (-738.415) [-743.135] (-741.799) (-738.564) -- 0:00:52
37000 -- (-738.078) (-740.135) [-738.161] (-741.258) * (-738.455) [-743.757] (-738.745) (-746.179) -- 0:00:52
37500 -- (-738.210) (-739.367) (-737.537) [-740.202] * (-739.497) [-743.154] (-738.123) (-741.520) -- 0:00:51
38000 -- (-741.368) (-739.053) (-737.436) [-740.092] * (-739.155) (-750.610) [-738.951] (-739.037) -- 0:00:50
38500 -- (-739.464) (-739.614) [-739.495] (-741.245) * (-738.109) (-754.392) (-740.892) [-740.381] -- 0:00:49
39000 -- (-741.599) (-737.510) [-737.948] (-740.332) * [-739.645] (-746.740) (-738.049) (-741.311) -- 0:00:49
39500 -- (-742.010) [-739.196] (-739.127) (-737.811) * [-736.988] (-746.170) (-739.672) (-738.305) -- 0:00:48
40000 -- (-744.439) [-738.134] (-738.373) (-738.740) * (-739.159) (-746.889) [-739.171] (-738.323) -- 0:00:48
Average standard deviation of split frequencies: 0.051004
40500 -- (-743.021) [-739.893] (-740.603) (-739.273) * [-739.605] (-746.468) (-738.011) (-740.601) -- 0:00:47
41000 -- (-737.368) (-740.581) [-742.518] (-738.180) * (-741.550) (-744.660) (-739.050) [-739.227] -- 0:01:10
41500 -- (-737.492) (-738.197) [-745.074] (-738.046) * (-742.300) (-745.309) (-739.072) [-737.878] -- 0:01:09
42000 -- (-740.416) (-738.480) [-742.592] (-739.506) * (-740.064) [-749.081] (-739.352) (-737.506) -- 0:01:08
42500 -- (-738.307) [-739.528] (-745.219) (-739.293) * (-742.067) [-744.824] (-740.600) (-739.462) -- 0:01:07
43000 -- (-743.399) (-741.667) (-743.735) [-737.894] * (-739.664) [-743.381] (-743.124) (-739.749) -- 0:01:06
43500 -- (-742.118) (-741.331) [-745.248] (-738.186) * (-738.769) (-742.067) [-741.753] (-740.044) -- 0:01:05
44000 -- (-739.741) [-740.234] (-738.591) (-740.683) * (-737.507) (-745.281) (-740.497) [-738.317] -- 0:01:05
44500 -- (-741.126) (-738.327) [-740.899] (-739.136) * [-739.683] (-749.271) (-737.005) (-739.830) -- 0:01:04
45000 -- (-741.003) (-738.510) [-738.967] (-739.897) * (-738.247) (-746.356) (-737.292) [-738.083] -- 0:01:03
Average standard deviation of split frequencies: 0.047140
45500 -- (-745.234) (-741.855) (-738.678) [-741.169] * (-739.346) [-744.922] (-738.618) (-738.109) -- 0:01:02
46000 -- (-737.363) (-740.379) [-740.150] (-744.668) * (-741.578) (-748.304) (-739.768) [-737.522] -- 0:01:02
46500 -- (-738.034) [-739.942] (-742.331) (-738.639) * (-740.607) (-744.956) [-737.290] (-740.326) -- 0:01:01
47000 -- (-740.296) (-741.548) [-737.882] (-738.691) * (-738.201) (-742.758) [-738.582] (-737.923) -- 0:01:00
47500 -- (-739.356) (-741.847) [-741.266] (-739.068) * [-737.774] (-745.242) (-738.016) (-740.621) -- 0:01:00
48000 -- [-741.727] (-739.778) (-738.799) (-742.825) * (-738.390) (-744.439) (-739.682) [-738.869] -- 0:00:59
48500 -- (-742.063) (-739.518) (-740.195) [-741.903] * [-738.058] (-749.258) (-737.923) (-738.369) -- 0:00:58
49000 -- (-738.887) [-738.437] (-739.275) (-740.018) * (-739.834) [-743.496] (-737.663) (-738.052) -- 0:00:58
49500 -- [-738.904] (-737.517) (-738.662) (-739.124) * (-738.354) (-744.973) [-737.696] (-738.347) -- 0:00:57
50000 -- (-740.239) [-738.768] (-741.214) (-739.377) * (-737.854) (-747.730) (-737.263) [-737.663] -- 0:00:57
Average standard deviation of split frequencies: 0.040938
50500 -- (-737.963) (-737.732) [-739.497] (-739.003) * (-739.207) [-743.796] (-741.268) (-738.808) -- 0:00:56
51000 -- (-737.704) [-738.439] (-739.718) (-738.899) * (-739.797) (-745.272) [-741.117] (-738.519) -- 0:00:55
51500 -- (-739.656) (-740.593) [-738.850] (-739.153) * (-740.576) (-746.803) (-738.524) [-738.822] -- 0:00:55
52000 -- (-739.265) [-741.045] (-737.667) (-737.817) * (-739.794) (-743.513) (-737.539) [-740.373] -- 0:00:54
52500 -- (-738.342) (-740.851) [-741.470] (-737.318) * (-737.659) (-744.667) [-738.616] (-740.591) -- 0:00:54
53000 -- (-738.088) [-742.261] (-740.435) (-742.708) * [-737.464] (-751.510) (-740.997) (-738.977) -- 0:00:53
53500 -- (-737.434) [-741.499] (-739.660) (-738.513) * (-741.952) [-747.050] (-737.773) (-738.637) -- 0:00:53
54000 -- (-737.858) (-740.782) (-739.230) [-738.978] * (-737.174) (-740.039) [-739.195] (-737.855) -- 0:00:52
54500 -- (-738.473) (-738.966) [-738.393] (-737.674) * (-737.344) [-744.846] (-746.781) (-740.213) -- 0:00:52
55000 -- (-739.001) [-739.178] (-738.946) (-737.064) * (-737.518) (-742.559) [-741.742] (-740.610) -- 0:00:51
Average standard deviation of split frequencies: 0.045457
55500 -- [-740.049] (-742.620) (-739.143) (-737.488) * [-738.303] (-745.747) (-740.031) (-738.622) -- 0:00:51
56000 -- (-740.966) [-739.823] (-738.565) (-738.751) * (-740.849) (-741.450) [-737.299] (-737.113) -- 0:00:50
56500 -- (-738.471) [-737.135] (-739.039) (-741.104) * (-740.721) [-747.053] (-738.074) (-738.623) -- 0:00:50
57000 -- [-740.117] (-741.686) (-739.396) (-739.390) * (-740.692) (-743.977) (-741.183) [-738.665] -- 0:00:49
57500 -- (-739.138) (-737.715) [-739.260] (-737.709) * (-739.629) [-747.963] (-747.638) (-738.343) -- 0:00:49
58000 -- [-740.229] (-739.405) (-744.736) (-739.262) * (-739.100) (-745.974) [-740.582] (-738.031) -- 0:01:04
58500 -- (-739.379) (-740.453) (-742.335) [-740.862] * (-739.233) (-746.014) (-737.668) [-738.398] -- 0:01:04
59000 -- (-740.075) [-739.270] (-742.790) (-742.733) * (-740.126) (-747.861) [-737.664] (-740.245) -- 0:01:03
59500 -- (-739.379) (-738.188) (-737.623) [-741.060] * (-739.478) [-741.785] (-742.271) (-740.651) -- 0:01:03
60000 -- (-738.752) [-739.017] (-737.371) (-739.304) * (-739.254) (-747.762) [-737.823] (-739.407) -- 0:01:02
Average standard deviation of split frequencies: 0.045068
60500 -- (-738.703) [-739.547] (-739.792) (-740.061) * [-739.188] (-746.360) (-737.368) (-739.310) -- 0:01:02
61000 -- (-739.211) (-739.748) (-741.699) [-738.986] * (-738.584) (-745.416) [-739.619] (-737.737) -- 0:01:01
61500 -- [-740.674] (-740.919) (-740.625) (-737.986) * [-738.348] (-746.623) (-738.914) (-743.608) -- 0:01:01
62000 -- (-741.631) (-742.138) [-739.537] (-738.439) * [-739.405] (-749.732) (-742.025) (-745.221) -- 0:01:00
62500 -- (-739.810) (-739.593) [-740.161] (-738.534) * (-737.373) [-742.544] (-739.198) (-738.847) -- 0:01:00
63000 -- [-739.116] (-737.874) (-741.808) (-738.999) * (-736.814) (-742.823) (-739.027) [-740.899] -- 0:00:59
63500 -- (-738.949) (-739.705) [-739.151] (-738.981) * (-740.949) (-743.407) (-740.186) [-740.447] -- 0:00:58
64000 -- [-739.115] (-738.855) (-736.974) (-742.116) * (-739.660) [-746.871] (-737.742) (-738.161) -- 0:00:58
64500 -- (-737.606) (-739.031) (-739.583) [-737.494] * (-740.112) [-745.209] (-737.624) (-740.312) -- 0:00:58
65000 -- (-736.979) [-738.223] (-738.589) (-741.987) * (-737.845) (-748.980) [-737.716] (-739.272) -- 0:00:57
Average standard deviation of split frequencies: 0.034284
65500 -- [-740.159] (-738.227) (-740.825) (-740.178) * (-738.498) (-749.346) (-742.543) [-739.256] -- 0:00:57
66000 -- (-737.691) (-738.232) [-740.403] (-738.140) * [-739.358] (-751.390) (-739.708) (-739.726) -- 0:00:56
66500 -- (-737.539) [-739.422] (-744.413) (-739.425) * [-738.214] (-758.336) (-740.717) (-739.836) -- 0:00:56
67000 -- (-742.240) (-738.791) (-738.956) [-739.878] * (-737.795) (-743.082) [-738.415] (-737.422) -- 0:00:55
67500 -- [-742.136] (-738.776) (-738.067) (-737.783) * [-737.512] (-749.383) (-740.034) (-737.401) -- 0:00:55
68000 -- [-739.699] (-737.898) (-738.898) (-737.684) * (-744.840) [-752.167] (-744.120) (-737.524) -- 0:00:54
68500 -- (-740.638) [-739.534] (-737.895) (-739.700) * [-740.904] (-739.409) (-739.078) (-742.659) -- 0:00:54
69000 -- (-743.833) (-740.506) [-741.166] (-740.073) * [-738.438] (-739.341) (-742.240) (-743.248) -- 0:00:53
69500 -- [-737.587] (-738.485) (-739.546) (-737.645) * (-739.379) [-740.553] (-740.720) (-745.611) -- 0:00:53
70000 -- (-739.268) (-739.900) [-738.298] (-737.049) * (-738.361) (-740.687) (-739.422) [-741.675] -- 0:00:53
Average standard deviation of split frequencies: 0.025349
70500 -- [-739.416] (-737.785) (-738.442) (-737.465) * [-737.903] (-737.917) (-738.139) (-738.371) -- 0:00:52
71000 -- (-739.421) (-738.050) (-737.796) [-738.804] * (-737.470) (-738.068) (-737.450) [-739.823] -- 0:00:52
71500 -- [-738.058] (-737.720) (-739.642) (-739.283) * [-737.987] (-739.345) (-739.872) (-737.137) -- 0:00:51
72000 -- (-739.323) (-740.587) (-738.141) [-742.263] * (-738.183) (-737.984) [-739.284] (-738.372) -- 0:00:51
72500 -- (-739.469) (-739.515) (-737.500) [-742.706] * [-739.295] (-737.351) (-737.446) (-741.410) -- 0:00:51
73000 -- (-739.556) (-738.499) [-736.992] (-737.762) * (-740.672) [-737.607] (-742.509) (-737.959) -- 0:00:50
73500 -- (-738.455) (-740.403) (-737.865) [-737.422] * (-740.282) (-737.065) (-740.440) [-738.498] -- 0:00:50
74000 -- (-739.142) (-737.916) (-739.172) [-740.146] * (-740.538) (-739.206) [-738.151] (-738.471) -- 0:00:50
74500 -- (-738.623) (-738.796) (-738.920) [-741.258] * (-738.315) (-740.179) [-737.538] (-738.635) -- 0:00:49
75000 -- (-742.213) (-739.823) [-739.978] (-739.322) * (-737.889) (-742.667) [-739.414] (-738.635) -- 0:00:49
Average standard deviation of split frequencies: 0.026051
75500 -- (-738.254) (-741.237) (-739.058) [-742.701] * [-739.074] (-738.094) (-738.524) (-738.284) -- 0:00:48
76000 -- (-744.948) (-741.422) [-739.145] (-737.939) * (-740.344) [-738.666] (-739.413) (-739.332) -- 0:01:00
76500 -- (-737.816) (-739.539) [-737.343] (-737.835) * (-738.568) (-737.845) (-738.227) [-737.992] -- 0:01:00
77000 -- (-739.274) (-737.971) (-740.209) [-738.011] * (-738.015) (-740.678) [-738.824] (-737.870) -- 0:00:59
77500 -- [-739.024] (-739.035) (-737.490) (-740.017) * [-737.891] (-741.536) (-741.935) (-737.580) -- 0:00:59
78000 -- (-738.575) [-737.832] (-739.034) (-737.158) * (-738.952) (-739.740) (-741.266) [-737.417] -- 0:00:59
78500 -- (-739.839) (-739.759) [-738.901] (-740.170) * [-737.498] (-740.763) (-742.767) (-740.123) -- 0:00:58
79000 -- (-742.064) [-739.613] (-738.040) (-749.750) * (-737.565) (-744.568) (-742.340) [-741.358] -- 0:00:58
79500 -- (-744.724) (-738.067) (-737.643) [-739.308] * (-738.795) [-745.336] (-742.006) (-740.173) -- 0:00:57
80000 -- [-740.686] (-742.353) (-738.283) (-740.413) * (-739.417) [-743.322] (-742.491) (-740.786) -- 0:00:57
Average standard deviation of split frequencies: 0.024544
80500 -- [-739.485] (-738.210) (-738.067) (-737.995) * (-738.260) [-737.530] (-741.721) (-739.173) -- 0:00:57
81000 -- (-738.671) (-739.658) (-741.597) [-741.446] * [-740.297] (-739.117) (-738.432) (-740.017) -- 0:00:56
81500 -- (-738.881) [-739.582] (-737.906) (-742.097) * [-738.605] (-738.573) (-738.768) (-738.564) -- 0:00:56
82000 -- (-740.680) [-738.024] (-739.097) (-740.954) * (-738.334) [-738.475] (-740.314) (-740.796) -- 0:00:55
82500 -- (-740.173) [-740.479] (-738.146) (-740.796) * (-742.300) (-738.612) (-737.947) [-741.434] -- 0:00:55
83000 -- (-738.496) (-740.386) (-739.830) [-738.073] * (-737.359) [-738.368] (-737.976) (-739.495) -- 0:00:55
83500 -- (-740.839) (-741.410) [-739.316] (-741.394) * (-740.846) [-739.014] (-737.889) (-740.552) -- 0:00:54
84000 -- (-742.351) (-740.821) (-738.409) [-742.257] * [-737.900] (-740.134) (-738.687) (-741.235) -- 0:00:54
84500 -- (-738.681) (-740.119) (-741.759) [-744.421] * [-740.359] (-738.465) (-739.341) (-741.599) -- 0:00:54
85000 -- [-739.836] (-741.172) (-743.399) (-739.348) * (-737.836) (-737.277) [-738.023] (-745.402) -- 0:00:53
Average standard deviation of split frequencies: 0.024118
85500 -- [-739.490] (-740.714) (-742.657) (-738.367) * (-737.826) (-738.890) [-739.231] (-743.473) -- 0:00:53
86000 -- (-738.169) (-740.895) (-741.730) [-737.901] * (-738.610) (-738.382) (-740.202) [-739.258] -- 0:00:53
86500 -- (-739.484) (-740.905) [-743.072] (-738.400) * (-737.967) [-738.987] (-742.479) (-741.901) -- 0:00:52
87000 -- (-740.437) (-741.415) [-737.728] (-739.472) * (-737.615) [-739.497] (-741.508) (-739.035) -- 0:00:52
87500 -- [-738.156] (-744.700) (-739.178) (-739.177) * (-740.036) (-740.747) (-740.228) [-740.903] -- 0:00:52
88000 -- (-738.290) (-741.088) (-743.321) [-738.155] * (-739.426) [-738.208] (-739.319) (-742.460) -- 0:00:51
88500 -- [-739.513] (-741.094) (-740.879) (-738.145) * (-739.237) [-738.312] (-739.144) (-740.084) -- 0:00:51
89000 -- (-737.847) (-739.483) [-738.658] (-738.302) * [-740.357] (-737.212) (-747.143) (-737.082) -- 0:00:51
89500 -- (-738.720) [-738.454] (-738.549) (-737.439) * (-739.932) (-738.431) (-743.395) [-739.923] -- 0:00:50
90000 -- (-741.683) [-739.705] (-737.932) (-747.017) * (-739.880) (-739.089) [-739.995] (-741.680) -- 0:00:50
Average standard deviation of split frequencies: 0.022877
90500 -- (-737.606) [-738.749] (-740.938) (-743.152) * [-741.791] (-738.017) (-742.090) (-737.986) -- 0:00:50
91000 -- (-737.730) (-739.793) (-737.631) [-743.024] * (-739.569) [-738.575] (-739.706) (-741.803) -- 0:00:49
91500 -- (-737.520) (-737.948) [-737.234] (-745.588) * (-738.200) [-738.646] (-737.877) (-739.907) -- 0:00:49
92000 -- (-737.004) (-737.285) [-737.285] (-739.981) * (-738.457) (-737.983) [-738.362] (-737.726) -- 0:00:49
92500 -- (-740.187) (-739.109) (-737.903) [-738.514] * (-740.266) (-739.060) (-741.370) [-737.015] -- 0:00:49
93000 -- [-739.546] (-737.772) (-738.493) (-744.643) * [-742.435] (-740.943) (-738.320) (-737.341) -- 0:00:48
93500 -- (-738.225) [-742.609] (-738.089) (-741.987) * (-738.828) [-740.244] (-738.290) (-738.122) -- 0:00:48
94000 -- (-738.005) (-740.863) (-737.207) [-738.969] * (-737.244) (-741.739) [-737.549] (-737.423) -- 0:00:48
94500 -- (-737.460) (-738.879) (-737.987) [-737.804] * (-745.733) [-740.916] (-737.142) (-737.631) -- 0:00:57
95000 -- (-739.751) (-739.375) (-738.002) [-740.153] * (-738.349) [-740.720] (-737.500) (-739.231) -- 0:00:57
Average standard deviation of split frequencies: 0.023570
95500 -- (-741.323) [-739.148] (-744.669) (-741.228) * (-737.203) [-739.678] (-737.154) (-743.133) -- 0:00:56
96000 -- (-740.424) (-738.279) (-739.763) [-738.973] * (-742.471) (-739.968) (-738.033) [-738.611] -- 0:00:56
96500 -- [-738.723] (-740.363) (-738.940) (-740.625) * (-737.656) (-738.995) [-738.402] (-739.180) -- 0:00:56
97000 -- (-741.687) [-737.558] (-739.607) (-740.810) * [-737.483] (-739.951) (-740.997) (-738.371) -- 0:00:55
97500 -- (-738.066) [-739.965] (-739.702) (-740.249) * [-737.246] (-739.167) (-739.438) (-737.497) -- 0:00:55
98000 -- (-738.104) [-739.273] (-738.247) (-740.732) * (-740.097) [-742.530] (-744.267) (-738.159) -- 0:00:55
98500 -- (-738.355) (-739.120) [-740.486] (-740.149) * (-738.687) [-738.607] (-742.105) (-738.006) -- 0:00:54
99000 -- (-739.373) [-741.572] (-739.476) (-739.755) * [-742.390] (-738.305) (-739.337) (-738.561) -- 0:00:54
99500 -- (-739.932) [-737.560] (-740.565) (-739.874) * (-738.683) (-737.926) [-740.720] (-740.465) -- 0:00:54
100000 -- (-739.663) (-744.041) [-737.332] (-739.846) * (-740.439) [-738.245] (-739.209) (-740.143) -- 0:00:54
Average standard deviation of split frequencies: 0.027160
100500 -- [-739.031] (-742.509) (-736.967) (-738.619) * [-740.351] (-739.479) (-739.166) (-742.355) -- 0:00:53
101000 -- (-737.973) (-738.564) [-739.191] (-739.088) * (-741.868) (-737.347) [-741.389] (-740.364) -- 0:00:53
101500 -- (-741.928) (-744.821) [-740.123] (-740.132) * (-739.118) (-739.855) (-737.709) [-738.744] -- 0:00:53
102000 -- (-738.955) (-738.311) (-741.547) [-737.385] * [-738.882] (-738.955) (-742.950) (-740.227) -- 0:00:52
102500 -- (-737.598) (-738.426) (-740.348) [-737.544] * [-738.871] (-738.415) (-740.248) (-743.242) -- 0:00:52
103000 -- [-737.948] (-743.832) (-743.594) (-746.853) * [-738.006] (-739.264) (-741.166) (-739.015) -- 0:00:52
103500 -- (-738.351) [-737.961] (-738.550) (-737.806) * [-738.886] (-738.540) (-740.036) (-738.911) -- 0:00:51
104000 -- (-738.791) [-738.156] (-738.703) (-737.624) * (-736.926) (-737.461) [-740.212] (-737.628) -- 0:00:51
104500 -- [-737.580] (-739.151) (-738.234) (-739.526) * (-739.123) (-739.137) [-738.239] (-737.776) -- 0:00:51
105000 -- (-741.485) (-738.868) [-738.004] (-738.049) * [-737.864] (-737.096) (-739.609) (-737.503) -- 0:00:51
Average standard deviation of split frequencies: 0.024015
105500 -- (-739.916) (-738.631) (-741.302) [-737.907] * (-741.203) (-743.295) (-739.904) [-739.375] -- 0:00:50
106000 -- [-738.952] (-742.578) (-737.562) (-738.445) * (-738.705) [-737.688] (-743.526) (-739.015) -- 0:00:50
106500 -- (-740.844) (-743.650) (-737.759) [-740.652] * (-739.266) [-738.157] (-738.385) (-738.258) -- 0:00:50
107000 -- (-747.138) [-740.433] (-741.297) (-741.545) * (-739.057) (-738.389) (-740.860) [-739.274] -- 0:00:50
107500 -- (-740.789) (-738.906) (-741.281) [-737.419] * (-741.527) (-742.208) [-740.859] (-738.316) -- 0:00:49
108000 -- (-740.505) (-738.780) [-738.999] (-737.320) * (-738.596) (-739.320) [-740.384] (-737.088) -- 0:00:49
108500 -- [-739.275] (-740.570) (-739.476) (-737.105) * (-737.943) [-739.495] (-739.200) (-738.633) -- 0:00:49
109000 -- (-739.018) (-740.135) [-740.104] (-737.122) * (-739.191) (-739.683) [-739.545] (-737.552) -- 0:00:49
109500 -- (-737.674) (-741.370) [-738.300] (-737.945) * (-737.848) [-741.300] (-742.074) (-742.043) -- 0:00:48
110000 -- (-739.235) (-742.162) (-739.210) [-736.974] * (-740.216) (-740.103) [-739.167] (-737.564) -- 0:00:48
Average standard deviation of split frequencies: 0.025558
110500 -- (-738.240) (-741.282) [-738.233] (-743.840) * (-738.273) [-743.298] (-738.063) (-737.598) -- 0:00:48
111000 -- [-736.974] (-739.501) (-737.258) (-739.596) * (-738.336) (-740.946) (-737.747) [-738.035] -- 0:00:48
111500 -- (-738.112) [-738.291] (-740.902) (-738.545) * (-737.270) (-741.020) [-740.963] (-741.308) -- 0:00:47
112000 -- (-739.945) [-739.627] (-740.873) (-737.281) * (-738.739) (-738.358) [-738.677] (-739.783) -- 0:00:47
112500 -- (-738.781) (-741.250) (-739.337) [-738.315] * (-742.622) [-738.837] (-737.474) (-740.722) -- 0:00:47
113000 -- (-738.885) (-740.503) (-740.656) [-738.250] * (-738.989) (-743.016) (-739.411) [-739.688] -- 0:00:54
113500 -- [-739.549] (-739.574) (-739.436) (-738.266) * (-745.119) [-741.941] (-739.659) (-737.185) -- 0:00:54
114000 -- (-739.843) [-743.028] (-740.830) (-738.330) * (-743.054) [-741.137] (-739.221) (-739.169) -- 0:00:54
114500 -- [-739.423] (-738.660) (-740.301) (-739.377) * (-740.022) (-740.499) (-746.076) [-738.661] -- 0:00:54
115000 -- (-738.866) (-740.818) (-742.679) [-738.711] * (-738.600) (-740.886) [-738.594] (-737.763) -- 0:00:53
Average standard deviation of split frequencies: 0.026009
115500 -- (-738.536) [-740.173] (-740.420) (-739.967) * (-739.133) (-737.306) (-740.999) [-740.901] -- 0:00:53
116000 -- (-739.400) (-741.571) (-741.945) [-738.106] * [-737.315] (-739.464) (-744.693) (-742.377) -- 0:00:53
116500 -- (-740.293) (-737.640) (-740.441) [-737.962] * (-739.680) (-740.920) [-738.500] (-739.687) -- 0:00:53
117000 -- (-738.325) (-737.650) [-738.424] (-737.435) * [-740.155] (-739.046) (-739.424) (-737.149) -- 0:00:52
117500 -- (-738.908) (-741.522) [-737.900] (-742.527) * (-740.174) (-740.428) [-743.535] (-737.234) -- 0:00:52
118000 -- (-739.494) (-741.922) [-737.883] (-739.202) * (-740.595) (-737.801) (-742.696) [-738.012] -- 0:00:52
118500 -- (-737.049) (-738.387) [-740.982] (-736.916) * [-737.711] (-739.316) (-742.440) (-739.137) -- 0:00:52
119000 -- (-737.182) (-737.742) (-740.256) [-737.190] * (-737.840) (-742.642) [-741.420] (-739.249) -- 0:00:51
119500 -- (-737.706) (-739.405) [-740.190] (-739.492) * (-737.970) (-739.698) (-738.933) [-737.261] -- 0:00:51
120000 -- [-739.291] (-739.337) (-740.636) (-738.240) * (-741.047) (-738.575) [-738.641] (-738.780) -- 0:00:51
Average standard deviation of split frequencies: 0.028909
120500 -- (-739.771) [-740.617] (-740.595) (-738.511) * (-744.651) [-738.934] (-739.751) (-738.778) -- 0:00:51
121000 -- (-737.425) [-740.355] (-741.492) (-738.604) * (-741.109) [-742.067] (-739.191) (-737.972) -- 0:00:50
121500 -- (-737.427) (-737.855) [-744.357] (-739.447) * (-738.981) [-740.008] (-738.531) (-738.971) -- 0:00:50
122000 -- (-737.617) (-738.307) [-739.406] (-741.316) * (-740.045) (-741.886) [-737.169] (-738.605) -- 0:00:50
122500 -- (-742.677) (-737.447) [-739.321] (-737.859) * (-745.845) (-737.104) [-737.409] (-738.603) -- 0:00:50
123000 -- (-739.194) (-736.858) [-737.156] (-737.406) * (-740.043) [-739.212] (-737.295) (-739.398) -- 0:00:49
123500 -- (-739.344) (-738.425) (-739.073) [-737.308] * (-739.554) (-737.934) [-740.150] (-739.567) -- 0:00:49
124000 -- [-741.352] (-739.464) (-743.998) (-739.502) * (-738.564) (-737.352) [-738.787] (-738.649) -- 0:00:49
124500 -- (-738.969) (-737.771) (-741.235) [-738.158] * (-739.280) [-737.254] (-739.552) (-740.138) -- 0:00:49
125000 -- (-744.034) [-738.114] (-744.927) (-741.339) * [-738.963] (-737.379) (-737.571) (-737.657) -- 0:00:49
Average standard deviation of split frequencies: 0.026189
125500 -- (-739.105) [-741.658] (-739.109) (-744.601) * (-742.037) (-737.923) [-738.491] (-739.089) -- 0:00:48
126000 -- (-742.061) (-739.130) [-739.042] (-738.560) * [-739.255] (-740.352) (-738.385) (-737.373) -- 0:00:48
126500 -- (-740.123) [-739.594] (-739.696) (-740.520) * (-744.350) (-745.671) [-738.329] (-738.741) -- 0:00:48
127000 -- (-740.452) [-737.920] (-737.660) (-740.840) * [-739.458] (-744.848) (-739.994) (-739.957) -- 0:00:48
127500 -- (-741.012) (-737.851) (-737.602) [-740.904] * (-738.060) (-740.488) (-740.368) [-737.911] -- 0:00:47
128000 -- [-739.143] (-737.908) (-739.872) (-740.545) * (-740.054) [-740.568] (-738.824) (-744.148) -- 0:00:47
128500 -- (-738.937) (-738.411) (-740.052) [-741.518] * (-739.910) (-739.611) [-737.949] (-743.309) -- 0:00:47
129000 -- (-738.503) (-740.153) [-739.291] (-740.882) * (-741.744) (-738.383) (-738.869) [-740.680] -- 0:00:47
129500 -- [-738.545] (-739.348) (-739.632) (-740.002) * (-740.231) [-737.724] (-739.499) (-739.176) -- 0:00:47
130000 -- (-741.396) (-738.340) [-738.896] (-737.796) * [-740.816] (-737.639) (-738.852) (-737.517) -- 0:00:46
Average standard deviation of split frequencies: 0.024532
130500 -- (-741.418) [-741.715] (-738.199) (-739.672) * [-741.384] (-738.665) (-739.107) (-745.176) -- 0:00:46
131000 -- (-738.429) [-738.761] (-748.818) (-737.534) * (-739.460) (-739.652) (-737.923) [-738.950] -- 0:00:46
131500 -- [-736.982] (-740.270) (-746.542) (-738.834) * (-738.268) (-739.386) [-737.362] (-741.026) -- 0:00:52
132000 -- (-737.976) [-738.405] (-741.843) (-738.871) * (-737.444) [-737.986] (-742.952) (-739.678) -- 0:00:52
132500 -- (-739.630) (-738.366) (-740.222) [-737.965] * [-737.297] (-740.234) (-739.028) (-739.813) -- 0:00:52
133000 -- (-738.721) (-739.863) (-738.292) [-738.263] * (-737.906) (-740.502) (-738.323) [-739.404] -- 0:00:52
133500 -- (-738.384) (-737.761) [-740.028] (-738.248) * (-740.584) (-742.099) [-739.014] (-739.868) -- 0:00:51
134000 -- (-738.934) (-737.633) [-739.425] (-738.794) * [-738.169] (-737.283) (-738.455) (-740.095) -- 0:00:51
134500 -- (-741.097) (-737.832) [-741.192] (-738.643) * (-738.790) (-739.372) [-740.333] (-741.880) -- 0:00:51
135000 -- (-738.538) (-738.280) (-742.285) [-738.637] * [-737.895] (-739.143) (-738.071) (-743.504) -- 0:00:51
Average standard deviation of split frequencies: 0.022877
135500 -- [-739.521] (-737.960) (-742.416) (-739.398) * [-741.656] (-739.705) (-738.963) (-740.916) -- 0:00:51
136000 -- [-738.730] (-738.511) (-740.271) (-740.117) * (-742.135) (-739.118) [-740.095] (-738.262) -- 0:00:50
136500 -- (-738.352) [-737.718] (-742.471) (-739.993) * (-739.470) (-737.790) [-740.965] (-737.220) -- 0:00:50
137000 -- (-738.129) (-737.860) (-739.954) [-737.265] * (-738.142) (-739.975) [-740.531] (-738.914) -- 0:00:50
137500 -- (-742.496) (-741.312) (-742.575) [-737.621] * (-740.430) (-739.552) [-737.993] (-737.677) -- 0:00:50
138000 -- [-741.598] (-740.864) (-737.270) (-737.195) * (-739.562) [-738.660] (-738.935) (-742.425) -- 0:00:49
138500 -- [-737.997] (-739.538) (-740.700) (-738.856) * [-739.344] (-737.713) (-739.496) (-742.806) -- 0:00:49
139000 -- (-739.642) [-740.285] (-742.967) (-738.952) * [-738.217] (-738.720) (-739.101) (-740.315) -- 0:00:49
139500 -- (-738.586) (-738.384) (-740.547) [-739.625] * (-742.066) (-738.612) (-737.491) [-742.049] -- 0:00:49
140000 -- (-738.495) (-741.303) [-739.997] (-742.059) * [-739.601] (-740.567) (-739.180) (-739.769) -- 0:00:49
Average standard deviation of split frequencies: 0.020778
140500 -- (-738.274) [-737.684] (-738.600) (-742.310) * (-745.205) (-739.203) [-737.633] (-739.384) -- 0:00:48
141000 -- (-741.493) [-737.696] (-737.441) (-740.563) * (-737.162) (-746.532) (-738.388) [-738.836] -- 0:00:48
141500 -- (-738.845) [-739.406] (-738.305) (-740.098) * (-737.132) (-743.418) [-740.798] (-739.029) -- 0:00:48
142000 -- (-737.674) [-738.640] (-738.403) (-737.973) * (-739.754) (-740.160) [-739.564] (-738.863) -- 0:00:48
142500 -- (-738.427) [-737.229] (-741.940) (-741.563) * [-737.843] (-738.197) (-739.968) (-738.718) -- 0:00:48
143000 -- (-737.986) (-741.032) [-738.071] (-739.925) * (-740.012) (-741.152) (-738.889) [-738.608] -- 0:00:47
143500 -- (-738.212) (-739.791) (-739.870) [-738.135] * (-738.983) (-737.958) (-741.450) [-738.445] -- 0:00:47
144000 -- (-738.407) [-741.353] (-740.874) (-740.282) * (-737.530) [-737.713] (-740.089) (-737.960) -- 0:00:47
144500 -- [-738.410] (-746.751) (-739.131) (-737.384) * (-746.281) (-741.230) (-738.724) [-738.289] -- 0:00:47
145000 -- (-737.598) (-739.907) [-737.841] (-737.090) * (-739.779) (-738.834) [-741.050] (-737.546) -- 0:00:47
Average standard deviation of split frequencies: 0.023247
145500 -- (-737.470) [-738.530] (-738.512) (-739.895) * (-736.947) (-737.564) (-743.145) [-737.138] -- 0:00:46
146000 -- [-738.580] (-740.188) (-739.647) (-738.212) * (-740.161) [-736.994] (-741.238) (-737.142) -- 0:00:46
146500 -- [-739.797] (-737.668) (-738.956) (-737.702) * (-737.840) [-737.990] (-740.389) (-742.387) -- 0:00:46
147000 -- [-739.121] (-740.024) (-740.582) (-738.048) * [-738.653] (-739.961) (-743.705) (-739.239) -- 0:00:46
147500 -- [-739.750] (-743.248) (-740.298) (-738.735) * [-738.516] (-738.526) (-739.113) (-741.439) -- 0:00:46
148000 -- (-741.169) [-738.024] (-737.433) (-738.176) * (-741.858) (-740.979) (-738.770) [-741.515] -- 0:00:46
148500 -- (-737.904) [-738.290] (-737.884) (-742.594) * [-738.987] (-739.044) (-739.016) (-737.923) -- 0:00:45
149000 -- (-745.237) (-741.881) [-737.583] (-738.349) * (-741.492) [-738.363] (-738.264) (-737.526) -- 0:00:45
149500 -- (-743.861) (-738.701) [-737.377] (-737.578) * (-741.652) (-737.422) [-737.826] (-741.804) -- 0:00:45
150000 -- (-742.916) (-738.499) [-739.316] (-740.661) * (-737.948) [-740.249] (-740.081) (-741.868) -- 0:00:51
Average standard deviation of split frequencies: 0.023153
150500 -- (-740.487) [-738.185] (-738.638) (-737.800) * [-737.483] (-737.123) (-738.528) (-741.377) -- 0:00:50
151000 -- (-740.058) [-740.473] (-737.801) (-737.273) * (-737.993) [-737.113] (-740.092) (-742.136) -- 0:00:50
151500 -- (-740.426) [-739.831] (-737.231) (-741.818) * [-738.963] (-737.530) (-737.878) (-740.907) -- 0:00:50
152000 -- (-739.096) (-737.199) [-738.302] (-738.898) * (-740.299) (-737.741) (-740.292) [-739.396] -- 0:00:50
152500 -- (-741.186) [-739.300] (-737.576) (-742.612) * [-739.813] (-737.696) (-738.104) (-737.820) -- 0:00:50
153000 -- (-739.003) (-741.569) (-744.176) [-741.047] * (-740.222) (-738.660) [-737.534] (-738.527) -- 0:00:49
153500 -- (-742.336) (-741.206) [-738.374] (-738.043) * (-741.241) [-738.241] (-737.944) (-737.918) -- 0:00:49
154000 -- (-738.970) (-742.699) (-739.203) [-738.280] * [-739.912] (-740.947) (-739.908) (-738.676) -- 0:00:49
154500 -- (-738.576) (-738.407) [-737.388] (-740.816) * (-738.887) (-740.922) (-740.779) [-738.045] -- 0:00:49
155000 -- [-738.853] (-737.972) (-739.137) (-739.672) * [-741.054] (-740.692) (-738.484) (-737.737) -- 0:00:49
Average standard deviation of split frequencies: 0.022361
155500 -- (-739.164) (-737.913) [-740.934] (-740.400) * [-739.280] (-743.092) (-738.739) (-739.963) -- 0:00:48
156000 -- (-737.786) (-739.670) [-737.992] (-740.860) * (-738.883) (-738.403) [-738.488] (-740.226) -- 0:00:48
156500 -- (-739.040) (-740.271) [-741.495] (-739.551) * (-736.955) (-737.240) [-742.758] (-739.443) -- 0:00:48
157000 -- (-738.631) [-737.187] (-742.673) (-737.470) * (-739.020) (-737.159) [-737.516] (-739.094) -- 0:00:48
157500 -- (-737.718) (-739.646) [-737.046] (-738.225) * (-738.071) (-737.875) [-737.452] (-738.905) -- 0:00:48
158000 -- [-738.114] (-738.695) (-738.578) (-737.508) * [-740.331] (-737.466) (-743.704) (-739.581) -- 0:00:47
158500 -- (-738.810) (-737.101) [-738.757] (-738.654) * (-737.223) (-740.187) [-740.135] (-741.038) -- 0:00:47
159000 -- (-738.621) (-740.478) [-740.480] (-741.488) * [-737.426] (-743.776) (-739.576) (-738.947) -- 0:00:47
159500 -- (-739.704) (-742.447) (-739.242) [-739.247] * [-738.189] (-741.234) (-738.116) (-738.546) -- 0:00:47
160000 -- [-738.437] (-741.304) (-738.869) (-739.132) * (-738.983) [-738.533] (-743.496) (-742.640) -- 0:00:47
Average standard deviation of split frequencies: 0.020538
160500 -- [-737.797] (-740.119) (-737.745) (-741.534) * (-737.930) [-738.555] (-741.834) (-737.657) -- 0:00:47
161000 -- [-737.620] (-740.143) (-742.167) (-740.380) * (-741.284) (-739.846) (-744.440) [-737.391] -- 0:00:46
161500 -- (-741.243) [-739.798] (-739.536) (-742.913) * (-738.747) [-738.995] (-743.644) (-737.421) -- 0:00:46
162000 -- (-739.944) (-740.651) [-739.392] (-741.347) * [-738.128] (-738.455) (-739.678) (-737.742) -- 0:00:46
162500 -- [-741.619] (-742.878) (-737.502) (-746.127) * [-740.598] (-738.802) (-742.633) (-737.835) -- 0:00:46
163000 -- (-739.520) [-739.814] (-741.783) (-741.789) * [-737.979] (-742.558) (-745.913) (-737.085) -- 0:00:46
163500 -- [-738.184] (-741.147) (-739.218) (-741.203) * (-738.590) [-739.459] (-744.497) (-738.800) -- 0:00:46
164000 -- (-739.264) (-740.306) (-738.834) [-737.684] * (-738.942) (-739.913) [-740.264] (-738.331) -- 0:00:45
164500 -- (-738.973) (-741.651) (-738.403) [-737.701] * (-740.388) (-745.344) [-738.785] (-741.372) -- 0:00:45
165000 -- (-738.024) [-737.714] (-738.142) (-740.366) * (-740.342) (-738.884) [-737.968] (-738.331) -- 0:00:45
Average standard deviation of split frequencies: 0.019879
165500 -- [-737.206] (-740.351) (-741.334) (-738.405) * (-739.313) (-738.984) (-742.159) [-738.902] -- 0:00:45
166000 -- [-739.383] (-744.389) (-739.110) (-737.982) * (-738.292) (-738.801) [-739.067] (-740.980) -- 0:00:45
166500 -- [-738.074] (-744.276) (-741.114) (-737.291) * (-740.552) (-740.802) [-741.243] (-741.108) -- 0:00:45
167000 -- (-740.187) [-737.819] (-741.895) (-737.542) * (-738.425) (-737.371) (-738.257) [-738.792] -- 0:00:44
167500 -- (-738.983) (-737.662) (-737.921) [-739.482] * (-738.057) [-738.320] (-741.113) (-741.193) -- 0:00:44
168000 -- (-740.840) (-737.541) [-740.082] (-739.682) * (-738.696) (-739.438) (-739.063) [-738.758] -- 0:00:44
168500 -- (-741.900) (-740.442) [-738.459] (-741.039) * (-740.289) (-739.758) (-737.831) [-742.339] -- 0:00:49
169000 -- (-740.292) [-739.185] (-737.992) (-741.623) * (-738.045) (-740.340) [-739.555] (-739.659) -- 0:00:49
169500 -- (-741.597) (-739.475) [-737.700] (-740.913) * (-741.929) (-739.153) (-739.447) [-737.359] -- 0:00:48
170000 -- (-741.166) (-739.151) [-738.818] (-739.583) * (-738.290) [-739.237] (-738.172) (-737.098) -- 0:00:48
Average standard deviation of split frequencies: 0.020440
170500 -- (-738.702) (-739.959) (-741.211) [-739.047] * [-737.823] (-738.167) (-737.045) (-738.939) -- 0:00:48
171000 -- (-739.055) (-739.681) [-739.374] (-742.169) * [-739.905] (-739.290) (-739.129) (-738.512) -- 0:00:48
171500 -- (-739.091) [-739.471] (-738.923) (-737.949) * (-743.735) [-739.974] (-740.886) (-740.315) -- 0:00:48
172000 -- (-742.086) (-739.626) (-740.712) [-740.619] * (-743.507) (-740.589) [-738.545] (-738.798) -- 0:00:48
172500 -- [-738.854] (-742.570) (-739.071) (-740.317) * [-740.985] (-744.343) (-738.830) (-738.240) -- 0:00:47
173000 -- [-742.233] (-738.756) (-739.553) (-739.500) * (-737.739) [-741.863] (-738.400) (-741.238) -- 0:00:47
173500 -- (-741.521) (-741.147) [-737.132] (-739.215) * (-740.872) (-739.250) (-752.696) [-738.770] -- 0:00:47
174000 -- [-739.492] (-741.132) (-736.920) (-738.531) * (-741.486) [-740.811] (-749.851) (-738.934) -- 0:00:47
174500 -- (-737.711) (-738.857) [-738.325] (-737.529) * (-738.354) [-738.856] (-744.193) (-738.484) -- 0:00:47
175000 -- (-740.267) (-739.155) (-738.694) [-737.148] * (-741.379) [-740.605] (-738.078) (-738.346) -- 0:00:47
Average standard deviation of split frequencies: 0.021427
175500 -- [-740.398] (-738.266) (-742.654) (-737.365) * (-739.795) [-738.448] (-740.236) (-740.913) -- 0:00:46
176000 -- (-739.634) [-738.921] (-741.333) (-738.277) * (-740.531) (-737.936) (-738.529) [-739.980] -- 0:00:46
176500 -- [-740.412] (-738.348) (-739.166) (-738.714) * (-740.473) (-738.907) [-739.544] (-740.570) -- 0:00:46
177000 -- (-744.769) (-737.718) (-741.854) [-738.402] * (-739.162) (-741.392) (-738.352) [-739.942] -- 0:00:46
177500 -- [-738.680] (-739.627) (-741.077) (-739.170) * [-737.424] (-741.275) (-738.722) (-737.354) -- 0:00:46
178000 -- (-738.018) (-739.011) (-737.621) [-738.643] * [-737.926] (-741.192) (-740.550) (-741.320) -- 0:00:46
178500 -- (-739.038) (-740.500) [-738.790] (-738.530) * [-739.650] (-741.526) (-739.946) (-740.587) -- 0:00:46
179000 -- (-739.505) (-741.691) [-737.088] (-739.881) * [-738.325] (-740.476) (-739.657) (-742.298) -- 0:00:45
179500 -- (-738.666) [-741.433] (-738.667) (-742.111) * [-738.547] (-738.535) (-737.313) (-737.778) -- 0:00:45
180000 -- (-740.901) (-737.770) [-739.479] (-743.324) * (-741.157) (-739.939) [-739.467] (-738.718) -- 0:00:45
Average standard deviation of split frequencies: 0.019830
180500 -- (-747.148) (-738.376) (-739.365) [-738.042] * (-737.462) (-740.370) (-739.198) [-738.223] -- 0:00:45
181000 -- (-739.848) [-737.720] (-737.951) (-737.204) * (-738.459) (-740.843) (-738.516) [-738.163] -- 0:00:45
181500 -- (-737.731) [-738.523] (-740.563) (-738.861) * (-740.215) (-742.192) [-740.208] (-737.222) -- 0:00:45
182000 -- [-738.294] (-741.154) (-737.517) (-738.639) * [-737.314] (-741.073) (-738.789) (-737.248) -- 0:00:44
182500 -- (-741.109) [-739.398] (-740.536) (-741.302) * (-739.175) [-740.540] (-738.533) (-745.263) -- 0:00:44
183000 -- [-738.793] (-741.154) (-739.921) (-741.287) * [-740.159] (-740.030) (-737.563) (-739.131) -- 0:00:44
183500 -- (-737.252) (-744.036) (-745.231) [-738.344] * (-740.527) [-739.111] (-738.025) (-738.572) -- 0:00:44
184000 -- (-737.705) (-740.653) [-741.262] (-737.377) * (-738.291) (-738.905) [-739.394] (-739.955) -- 0:00:44
184500 -- (-738.850) [-737.733] (-743.931) (-745.119) * (-738.132) [-736.856] (-739.260) (-739.168) -- 0:00:44
185000 -- [-740.294] (-738.158) (-740.233) (-744.732) * (-742.365) (-737.257) (-739.156) [-738.507] -- 0:00:44
Average standard deviation of split frequencies: 0.018755
185500 -- (-741.423) [-738.674] (-737.924) (-738.863) * (-739.886) (-742.302) (-738.935) [-738.272] -- 0:00:43
186000 -- (-744.791) [-737.678] (-739.191) (-737.698) * [-738.391] (-738.899) (-739.119) (-742.526) -- 0:00:43
186500 -- (-737.839) (-741.732) (-740.522) [-737.813] * (-740.456) (-746.933) [-739.577] (-741.325) -- 0:00:43
187000 -- (-737.529) (-740.330) (-742.495) [-737.301] * (-739.290) (-740.627) (-738.873) [-739.503] -- 0:00:47
187500 -- (-737.477) (-738.410) (-741.769) [-737.375] * [-738.636] (-737.544) (-738.425) (-742.368) -- 0:00:47
188000 -- [-738.260] (-738.620) (-739.845) (-742.058) * (-738.466) (-739.086) [-738.090] (-737.731) -- 0:00:47
188500 -- [-741.514] (-739.332) (-739.149) (-742.056) * (-737.408) [-741.531] (-739.088) (-738.232) -- 0:00:47
189000 -- (-741.028) [-743.214] (-742.003) (-742.733) * (-740.896) (-737.598) [-737.845] (-737.582) -- 0:00:47
189500 -- (-742.125) (-737.558) (-742.888) [-737.746] * (-740.772) [-737.887] (-737.810) (-738.604) -- 0:00:47
190000 -- (-738.738) (-737.275) [-745.088] (-742.452) * (-741.414) (-738.305) [-738.988] (-738.150) -- 0:00:46
Average standard deviation of split frequencies: 0.016318
190500 -- (-738.388) [-737.922] (-741.370) (-737.214) * (-739.948) [-737.849] (-742.679) (-737.743) -- 0:00:46
191000 -- (-743.979) (-739.214) (-740.334) [-739.607] * (-741.954) [-740.240] (-737.450) (-743.364) -- 0:00:46
191500 -- (-739.675) [-738.167] (-738.406) (-739.118) * (-740.226) (-741.051) [-737.233] (-740.806) -- 0:00:46
192000 -- [-739.597] (-738.122) (-737.780) (-739.860) * (-739.870) (-737.849) [-739.112] (-738.959) -- 0:00:46
192500 -- [-737.638] (-737.366) (-738.598) (-737.850) * (-741.700) [-739.658] (-739.128) (-737.744) -- 0:00:46
193000 -- (-737.834) [-737.533] (-738.854) (-742.865) * (-738.403) (-740.513) (-739.161) [-738.746] -- 0:00:45
193500 -- (-737.657) (-740.887) (-738.306) [-738.958] * [-741.161] (-742.519) (-738.922) (-738.476) -- 0:00:45
194000 -- (-738.444) (-740.925) (-740.002) [-745.245] * [-741.416] (-741.325) (-737.101) (-737.373) -- 0:00:45
194500 -- [-741.497] (-739.431) (-742.011) (-738.437) * (-739.679) [-739.556] (-744.144) (-738.957) -- 0:00:45
195000 -- (-739.462) (-738.684) (-749.193) [-739.583] * [-739.538] (-740.311) (-741.932) (-738.690) -- 0:00:45
Average standard deviation of split frequencies: 0.019241
195500 -- (-738.608) (-747.463) [-741.427] (-745.078) * (-742.924) [-737.791] (-741.199) (-738.288) -- 0:00:45
196000 -- (-738.821) (-739.812) [-738.094] (-738.502) * (-742.890) [-739.792] (-739.342) (-739.700) -- 0:00:45
196500 -- (-738.717) (-738.170) [-739.045] (-738.506) * (-739.704) (-740.011) (-741.050) [-742.241] -- 0:00:44
197000 -- [-740.234] (-742.983) (-739.424) (-739.385) * (-741.128) (-738.555) [-738.777] (-740.520) -- 0:00:44
197500 -- [-739.984] (-740.370) (-740.617) (-741.547) * (-737.346) [-739.411] (-738.539) (-742.047) -- 0:00:44
198000 -- [-742.379] (-738.140) (-743.889) (-739.593) * (-740.332) (-738.609) [-738.115] (-740.022) -- 0:00:44
198500 -- (-740.988) (-737.723) (-738.260) [-744.079] * [-736.967] (-743.567) (-738.486) (-739.234) -- 0:00:44
199000 -- (-740.291) (-741.444) (-739.239) [-740.976] * [-737.135] (-738.504) (-739.988) (-741.651) -- 0:00:44
199500 -- (-740.404) [-738.386] (-739.401) (-744.130) * (-739.641) (-737.961) [-740.277] (-737.979) -- 0:00:44
200000 -- (-739.500) [-737.371] (-742.656) (-737.468) * [-738.731] (-738.407) (-740.845) (-741.173) -- 0:00:44
Average standard deviation of split frequencies: 0.017854
200500 -- (-741.233) (-739.626) (-745.271) [-739.828] * (-738.677) [-741.695] (-741.047) (-741.973) -- 0:00:43
201000 -- [-740.285] (-744.121) (-739.355) (-738.307) * (-737.789) (-738.735) (-741.608) [-738.648] -- 0:00:43
201500 -- (-743.399) (-739.938) (-740.849) [-738.770] * [-739.230] (-739.313) (-738.602) (-737.266) -- 0:00:43
202000 -- (-739.925) (-737.184) [-738.462] (-739.180) * (-738.935) (-742.103) [-740.796] (-739.317) -- 0:00:43
202500 -- (-737.584) [-737.884] (-738.404) (-739.636) * [-737.660] (-742.680) (-739.113) (-738.840) -- 0:00:43
203000 -- [-737.612] (-737.271) (-737.717) (-739.291) * (-740.303) (-745.610) [-738.812] (-738.730) -- 0:00:43
203500 -- (-738.585) (-737.413) (-740.797) [-744.064] * [-743.340] (-738.750) (-737.404) (-738.151) -- 0:00:43
204000 -- (-739.274) [-739.227] (-738.285) (-741.310) * [-742.380] (-738.821) (-739.813) (-738.990) -- 0:00:42
204500 -- (-739.534) (-741.128) [-738.111] (-739.690) * (-738.760) [-737.739] (-738.821) (-739.304) -- 0:00:42
205000 -- (-737.628) (-739.635) (-743.588) [-737.535] * (-740.555) (-739.686) (-739.680) [-739.207] -- 0:00:42
Average standard deviation of split frequencies: 0.021053
205500 -- [-742.902] (-737.884) (-738.701) (-737.617) * [-737.380] (-741.054) (-743.986) (-741.390) -- 0:00:46
206000 -- (-737.722) (-743.065) [-737.237] (-739.750) * (-738.585) (-740.393) [-741.494] (-738.258) -- 0:00:46
206500 -- (-744.384) (-738.545) [-737.284] (-738.846) * [-738.475] (-739.681) (-739.607) (-740.813) -- 0:00:46
207000 -- (-742.072) (-740.707) [-739.800] (-742.368) * (-739.344) [-741.403] (-738.025) (-741.935) -- 0:00:45
207500 -- (-739.093) (-741.604) [-739.627] (-738.597) * [-737.156] (-738.629) (-740.429) (-739.873) -- 0:00:45
208000 -- (-740.925) (-739.724) (-738.225) [-741.359] * [-737.156] (-737.911) (-738.915) (-741.550) -- 0:00:45
208500 -- (-738.553) (-740.021) (-738.169) [-738.166] * (-738.694) [-738.650] (-738.538) (-737.440) -- 0:00:45
209000 -- [-742.245] (-738.217) (-739.212) (-742.035) * (-737.775) [-737.953] (-745.051) (-738.750) -- 0:00:45
209500 -- (-742.935) [-740.479] (-738.991) (-741.695) * (-738.701) (-739.739) [-739.561] (-737.134) -- 0:00:45
210000 -- (-745.393) (-739.980) (-739.229) [-741.366] * (-738.755) (-739.242) [-737.234] (-743.180) -- 0:00:45
Average standard deviation of split frequencies: 0.022824
210500 -- (-751.838) (-740.979) (-737.805) [-740.163] * (-738.278) (-739.611) [-737.633] (-738.579) -- 0:00:45
211000 -- (-744.482) (-739.990) (-737.947) [-737.640] * (-738.208) (-742.340) [-737.552] (-738.132) -- 0:00:44
211500 -- (-741.716) (-738.648) (-737.645) [-739.532] * (-737.967) [-739.148] (-742.114) (-739.186) -- 0:00:44
212000 -- (-740.351) [-737.714] (-738.466) (-737.943) * (-738.990) (-737.201) (-744.043) [-737.332] -- 0:00:44
212500 -- (-739.110) (-738.721) (-738.134) [-738.572] * (-738.567) (-737.286) [-737.445] (-737.283) -- 0:00:44
213000 -- [-739.131] (-737.134) (-741.251) (-737.496) * (-742.240) [-738.273] (-745.806) (-737.772) -- 0:00:44
213500 -- [-740.173] (-738.431) (-740.192) (-738.238) * (-741.592) (-741.707) (-740.946) [-738.441] -- 0:00:44
214000 -- (-739.559) [-742.289] (-738.959) (-741.331) * (-737.124) [-738.479] (-738.648) (-740.316) -- 0:00:44
214500 -- (-739.446) (-742.510) (-739.296) [-737.949] * (-739.214) [-740.560] (-743.551) (-740.504) -- 0:00:43
215000 -- [-738.135] (-738.411) (-739.000) (-737.123) * (-740.824) (-739.982) (-740.923) [-740.210] -- 0:00:43
Average standard deviation of split frequencies: 0.020078
215500 -- (-738.660) (-740.622) [-741.078] (-739.087) * (-737.719) (-737.675) [-739.999] (-742.233) -- 0:00:43
216000 -- (-739.349) (-741.854) [-738.561] (-746.950) * [-738.129] (-739.127) (-742.827) (-744.780) -- 0:00:43
216500 -- (-738.807) (-738.229) (-738.678) [-740.609] * [-738.352] (-737.836) (-746.107) (-737.415) -- 0:00:43
217000 -- (-738.001) [-738.024] (-738.446) (-738.407) * [-740.123] (-739.608) (-738.565) (-738.777) -- 0:00:43
217500 -- (-740.360) (-739.084) [-740.339] (-738.465) * (-743.945) (-741.701) (-738.619) [-738.090] -- 0:00:43
218000 -- (-745.967) (-743.422) (-742.287) [-739.439] * [-740.253] (-739.636) (-738.844) (-740.231) -- 0:00:43
218500 -- (-744.929) (-737.998) [-741.792] (-738.456) * [-738.904] (-737.924) (-738.724) (-741.529) -- 0:00:42
219000 -- (-738.585) [-737.522] (-738.454) (-737.445) * (-740.143) [-738.106] (-739.331) (-741.083) -- 0:00:42
219500 -- [-740.590] (-739.759) (-739.344) (-739.785) * (-740.028) (-738.358) [-738.420] (-740.822) -- 0:00:42
220000 -- (-737.606) [-737.228] (-738.895) (-737.530) * (-739.639) [-737.909] (-738.400) (-740.648) -- 0:00:42
Average standard deviation of split frequencies: 0.019654
220500 -- (-739.960) (-738.461) (-739.687) [-737.355] * [-741.588] (-742.216) (-737.547) (-742.152) -- 0:00:42
221000 -- [-738.645] (-739.193) (-738.721) (-737.480) * (-738.844) [-745.073] (-737.223) (-738.036) -- 0:00:42
221500 -- [-738.724] (-740.069) (-740.436) (-739.065) * (-738.802) (-738.214) [-737.820] (-740.040) -- 0:00:42
222000 -- (-740.891) (-739.342) (-738.201) [-741.032] * [-741.948] (-739.546) (-739.186) (-738.288) -- 0:00:42
222500 -- (-737.856) (-742.429) [-738.556] (-738.181) * (-738.489) (-740.539) (-738.859) [-738.393] -- 0:00:41
223000 -- (-737.767) [-736.961] (-737.722) (-743.059) * (-738.531) (-737.855) (-740.521) [-741.041] -- 0:00:41
223500 -- (-740.297) (-740.625) (-737.343) [-743.563] * [-738.297] (-741.116) (-738.424) (-738.365) -- 0:00:41
224000 -- (-739.861) (-739.733) (-739.878) [-738.452] * [-740.399] (-740.116) (-737.851) (-738.301) -- 0:00:45
224500 -- [-742.816] (-738.142) (-739.942) (-738.529) * (-737.923) (-738.984) (-738.939) [-738.166] -- 0:00:44
225000 -- (-741.980) [-737.043] (-739.259) (-742.080) * (-738.844) (-738.521) [-739.912] (-740.015) -- 0:00:44
Average standard deviation of split frequencies: 0.017104
225500 -- (-740.158) [-737.978] (-744.413) (-738.240) * [-738.923] (-742.611) (-739.675) (-739.313) -- 0:00:44
226000 -- (-739.031) (-737.458) [-739.573] (-737.092) * [-739.586] (-747.837) (-738.879) (-737.330) -- 0:00:44
226500 -- (-743.816) (-737.970) [-740.309] (-740.789) * (-739.780) (-742.106) (-737.487) [-738.268] -- 0:00:44
227000 -- (-740.165) (-738.102) (-740.416) [-737.217] * (-739.264) [-738.176] (-738.207) (-738.165) -- 0:00:44
227500 -- (-740.085) (-738.128) (-741.752) [-738.068] * (-738.702) (-738.211) [-739.537] (-738.341) -- 0:00:44
228000 -- (-738.382) [-737.661] (-740.003) (-737.413) * (-737.581) (-738.195) (-737.906) [-738.924] -- 0:00:44
228500 -- (-747.547) (-739.835) (-740.732) [-738.089] * (-740.054) (-742.359) (-737.365) [-740.608] -- 0:00:43
229000 -- (-741.784) (-737.697) (-742.669) [-738.025] * (-739.578) [-739.314] (-737.696) (-739.557) -- 0:00:43
229500 -- [-740.735] (-737.970) (-740.622) (-744.638) * (-741.781) (-738.480) [-738.818] (-739.277) -- 0:00:43
230000 -- [-742.080] (-739.616) (-738.292) (-738.846) * [-737.479] (-742.491) (-737.078) (-740.170) -- 0:00:43
Average standard deviation of split frequencies: 0.016349
230500 -- (-742.099) (-739.655) (-737.970) [-738.171] * [-741.683] (-737.358) (-741.608) (-737.641) -- 0:00:43
231000 -- (-741.402) (-737.780) (-739.090) [-739.528] * (-741.445) (-737.070) [-737.535] (-739.919) -- 0:00:43
231500 -- (-738.371) [-738.498] (-738.196) (-738.780) * (-741.266) (-738.291) [-739.127] (-738.505) -- 0:00:43
232000 -- [-741.395] (-739.829) (-737.876) (-739.251) * (-739.919) (-740.767) [-741.307] (-737.699) -- 0:00:43
232500 -- (-738.919) (-739.406) (-741.554) [-739.430] * (-741.109) [-742.507] (-738.126) (-738.668) -- 0:00:42
233000 -- (-738.535) (-741.005) (-738.877) [-737.923] * (-738.927) (-741.163) (-739.016) [-739.003] -- 0:00:42
233500 -- (-741.771) (-739.765) [-738.932] (-739.273) * (-739.458) [-738.153] (-740.952) (-739.402) -- 0:00:42
234000 -- (-747.692) [-738.063] (-738.514) (-738.742) * (-742.126) [-739.846] (-739.161) (-742.294) -- 0:00:42
234500 -- (-741.936) (-737.302) (-740.165) [-740.989] * (-741.583) [-738.804] (-737.830) (-745.119) -- 0:00:42
235000 -- [-742.973] (-736.991) (-738.739) (-738.360) * (-739.471) (-740.125) [-738.577] (-745.312) -- 0:00:42
Average standard deviation of split frequencies: 0.015580
235500 -- [-737.709] (-737.757) (-738.820) (-737.336) * (-739.266) (-740.367) [-739.345] (-740.173) -- 0:00:42
236000 -- (-741.123) [-737.323] (-741.106) (-738.441) * [-740.360] (-742.296) (-739.473) (-739.302) -- 0:00:42
236500 -- (-738.977) (-739.853) (-738.660) [-738.011] * [-739.466] (-739.715) (-738.862) (-740.553) -- 0:00:41
237000 -- (-738.188) (-736.982) (-740.647) [-738.971] * (-740.941) (-739.732) [-739.633] (-739.411) -- 0:00:41
237500 -- (-739.112) (-737.110) (-739.460) [-737.430] * (-739.498) (-743.107) (-738.128) [-738.857] -- 0:00:41
238000 -- [-744.433] (-739.261) (-738.484) (-739.810) * (-739.172) (-740.440) (-739.594) [-739.212] -- 0:00:41
238500 -- [-743.406] (-739.114) (-737.649) (-740.601) * (-738.626) (-738.688) (-742.663) [-740.630] -- 0:00:41
239000 -- (-737.217) (-743.030) [-738.106] (-739.886) * (-740.409) [-738.451] (-740.814) (-740.309) -- 0:00:41
239500 -- (-737.246) (-745.597) (-738.982) [-741.616] * (-739.359) (-739.738) [-739.756] (-738.792) -- 0:00:41
240000 -- (-739.990) (-740.182) (-739.815) [-738.942] * (-740.421) (-739.465) (-741.634) [-739.597] -- 0:00:41
Average standard deviation of split frequencies: 0.017629
240500 -- (-738.408) (-740.113) [-739.914] (-738.600) * (-737.689) (-742.055) (-738.024) [-742.148] -- 0:00:41
241000 -- [-739.260] (-737.741) (-740.124) (-739.228) * [-737.568] (-745.023) (-739.715) (-738.762) -- 0:00:40
241500 -- [-740.582] (-737.270) (-741.131) (-741.061) * (-737.809) (-739.722) [-740.268] (-740.807) -- 0:00:40
242000 -- (-740.527) [-737.619] (-743.489) (-739.264) * (-737.412) [-739.804] (-742.746) (-737.203) -- 0:00:40
242500 -- (-737.662) (-741.092) (-737.976) [-740.469] * [-740.577] (-740.840) (-738.566) (-737.813) -- 0:00:43
243000 -- (-743.239) [-738.757] (-737.516) (-740.453) * (-738.314) (-740.692) [-738.907] (-739.515) -- 0:00:43
243500 -- (-739.987) [-739.634] (-746.776) (-740.648) * (-740.608) (-741.806) (-740.725) [-738.256] -- 0:00:43
244000 -- (-740.711) [-739.455] (-739.318) (-738.999) * (-740.607) [-740.199] (-738.797) (-738.679) -- 0:00:43
244500 -- (-741.322) (-739.938) (-739.563) [-738.757] * [-740.976] (-741.625) (-741.431) (-744.710) -- 0:00:43
245000 -- (-740.523) (-740.542) [-738.453] (-738.643) * (-738.385) (-738.705) (-736.939) [-744.995] -- 0:00:43
Average standard deviation of split frequencies: 0.019929
245500 -- (-741.501) [-739.556] (-737.170) (-738.774) * (-739.672) [-739.322] (-737.039) (-743.876) -- 0:00:43
246000 -- (-737.290) (-738.096) (-741.663) [-740.625] * (-738.728) (-741.920) [-737.924] (-742.435) -- 0:00:42
246500 -- [-738.311] (-737.107) (-742.064) (-738.778) * (-740.336) [-738.620] (-740.299) (-737.876) -- 0:00:42
247000 -- (-740.370) (-739.669) [-737.278] (-737.748) * [-739.751] (-738.857) (-739.045) (-737.337) -- 0:00:42
247500 -- (-743.631) (-743.448) [-737.246] (-737.416) * (-740.097) [-740.916] (-738.884) (-737.525) -- 0:00:42
248000 -- [-737.473] (-744.113) (-737.713) (-736.986) * [-740.302] (-740.712) (-739.055) (-738.092) -- 0:00:42
248500 -- (-737.283) [-739.567] (-739.050) (-739.669) * (-738.925) (-737.332) [-737.962] (-740.504) -- 0:00:42
249000 -- (-738.499) [-738.973] (-740.744) (-740.899) * (-739.507) [-737.977] (-741.758) (-737.996) -- 0:00:42
249500 -- [-737.722] (-738.679) (-746.280) (-739.406) * (-739.393) (-737.840) (-742.074) [-739.707] -- 0:00:42
250000 -- (-739.552) [-741.340] (-741.366) (-738.657) * (-739.066) (-738.963) [-741.848] (-737.472) -- 0:00:42
Average standard deviation of split frequencies: 0.019558
250500 -- [-741.020] (-746.482) (-738.009) (-739.888) * [-741.326] (-738.797) (-743.340) (-739.731) -- 0:00:41
251000 -- (-737.143) (-740.970) [-737.107] (-738.409) * [-741.629] (-741.228) (-743.716) (-738.429) -- 0:00:41
251500 -- (-737.487) (-738.656) (-737.679) [-738.665] * (-740.283) [-740.772] (-742.145) (-737.695) -- 0:00:41
252000 -- (-741.869) [-737.974] (-738.092) (-739.800) * (-739.213) (-737.915) (-742.052) [-737.550] -- 0:00:41
252500 -- (-744.899) (-737.859) [-737.529] (-741.287) * (-739.341) (-742.534) [-739.580] (-738.662) -- 0:00:41
253000 -- (-739.713) (-738.249) (-737.384) [-743.310] * (-738.880) [-738.046] (-739.519) (-739.223) -- 0:00:41
253500 -- (-740.125) [-738.108] (-742.837) (-739.799) * (-737.670) (-738.308) (-739.556) [-740.078] -- 0:00:41
254000 -- (-737.781) (-739.864) (-741.311) [-740.906] * (-739.185) (-738.268) (-739.566) [-737.635] -- 0:00:41
254500 -- (-738.538) [-739.149] (-738.244) (-741.926) * [-740.397] (-740.432) (-738.874) (-737.010) -- 0:00:41
255000 -- (-737.752) (-742.681) [-739.663] (-738.329) * [-739.325] (-740.062) (-738.832) (-737.164) -- 0:00:40
Average standard deviation of split frequencies: 0.015836
255500 -- (-737.641) [-738.805] (-739.980) (-738.750) * [-740.133] (-737.930) (-737.178) (-737.083) -- 0:00:40
256000 -- (-739.358) (-739.226) (-740.531) [-744.782] * (-742.326) (-738.991) [-737.537] (-739.277) -- 0:00:40
256500 -- (-737.594) (-736.994) (-741.107) [-737.212] * (-739.359) (-738.463) [-739.207] (-738.357) -- 0:00:40
257000 -- (-737.200) [-736.818] (-740.842) (-738.005) * (-739.668) (-737.392) [-740.081] (-741.227) -- 0:00:40
257500 -- [-740.621] (-737.227) (-738.658) (-744.596) * (-743.577) [-739.748] (-747.437) (-738.350) -- 0:00:40
258000 -- (-740.166) (-740.719) [-740.995] (-744.808) * (-737.414) (-741.088) (-738.099) [-737.737] -- 0:00:40
258500 -- (-740.659) (-740.967) [-740.198] (-744.776) * [-738.055] (-739.174) (-738.673) (-742.974) -- 0:00:40
259000 -- (-738.113) [-738.417] (-738.748) (-739.776) * (-737.550) (-738.064) [-739.524] (-743.979) -- 0:00:40
259500 -- (-741.723) [-740.524] (-738.419) (-745.490) * [-741.153] (-741.305) (-738.425) (-742.204) -- 0:00:39
260000 -- (-741.151) (-739.306) (-739.348) [-738.578] * (-739.604) (-739.643) [-737.362] (-738.775) -- 0:00:39
Average standard deviation of split frequencies: 0.015914
260500 -- (-737.217) [-738.760] (-745.512) (-739.586) * (-739.875) (-737.671) (-738.265) [-737.687] -- 0:00:39
261000 -- (-738.057) [-740.165] (-737.933) (-740.742) * (-740.491) (-742.821) (-740.025) [-738.633] -- 0:00:42
261500 -- [-738.113] (-738.642) (-739.405) (-740.685) * [-741.075] (-738.401) (-737.626) (-740.049) -- 0:00:42
262000 -- (-738.345) (-738.282) [-738.833] (-740.141) * (-740.538) (-739.724) (-738.404) [-737.219] -- 0:00:42
262500 -- (-742.073) (-738.347) [-737.745] (-745.682) * (-737.636) [-738.379] (-745.338) (-737.263) -- 0:00:42
263000 -- (-738.590) (-739.301) (-741.992) [-743.787] * [-737.654] (-738.513) (-743.656) (-738.979) -- 0:00:42
263500 -- (-737.857) [-739.661] (-744.261) (-737.744) * (-737.688) (-740.265) (-742.678) [-747.625] -- 0:00:41
264000 -- (-738.203) (-738.806) [-738.065] (-737.690) * (-737.459) (-743.219) [-742.961] (-739.184) -- 0:00:41
264500 -- (-742.190) (-738.538) (-737.624) [-737.840] * (-738.595) (-738.489) [-737.296] (-738.245) -- 0:00:41
265000 -- (-740.255) (-740.158) (-738.944) [-738.831] * (-741.134) (-738.504) (-737.477) [-741.590] -- 0:00:41
Average standard deviation of split frequencies: 0.016659
265500 -- (-738.695) [-739.394] (-738.824) (-739.787) * (-741.919) (-740.972) (-740.242) [-739.467] -- 0:00:41
266000 -- [-738.159] (-738.826) (-738.402) (-739.548) * (-738.714) [-741.451] (-737.839) (-739.757) -- 0:00:41
266500 -- [-737.485] (-743.582) (-741.131) (-740.891) * [-742.004] (-737.789) (-738.465) (-739.643) -- 0:00:41
267000 -- [-739.360] (-739.505) (-739.189) (-739.094) * [-737.879] (-740.491) (-738.924) (-738.959) -- 0:00:41
267500 -- (-739.313) (-739.490) (-740.233) [-738.366] * [-739.344] (-740.067) (-739.928) (-738.894) -- 0:00:41
268000 -- [-741.436] (-737.804) (-739.885) (-739.169) * (-741.386) (-739.920) (-741.253) [-737.985] -- 0:00:40
268500 -- (-738.356) (-740.177) (-739.914) [-739.512] * (-738.511) (-739.373) [-739.783] (-741.719) -- 0:00:40
269000 -- (-737.536) (-740.200) [-737.960] (-740.372) * (-737.469) [-739.523] (-741.275) (-739.041) -- 0:00:40
269500 -- (-738.551) (-740.637) [-739.278] (-739.458) * [-737.390] (-737.935) (-740.830) (-738.708) -- 0:00:40
270000 -- (-737.184) (-737.157) [-741.530] (-740.390) * (-738.208) [-737.905] (-737.770) (-743.099) -- 0:00:40
Average standard deviation of split frequencies: 0.017416
270500 -- (-739.660) (-740.411) (-740.705) [-739.263] * (-738.123) (-740.341) (-739.454) [-738.500] -- 0:00:40
271000 -- (-740.531) [-740.981] (-739.023) (-742.751) * [-737.100] (-740.617) (-739.990) (-744.563) -- 0:00:40
271500 -- [-739.099] (-743.669) (-743.015) (-738.761) * [-737.527] (-741.947) (-739.610) (-737.334) -- 0:00:40
272000 -- [-739.834] (-738.849) (-738.276) (-742.341) * (-739.620) (-740.739) [-738.569] (-738.672) -- 0:00:40
272500 -- [-737.640] (-740.150) (-739.337) (-737.370) * [-737.082] (-739.911) (-737.968) (-738.021) -- 0:00:40
273000 -- (-737.304) (-739.924) [-740.633] (-738.900) * (-739.020) (-738.186) [-738.616] (-741.343) -- 0:00:39
273500 -- [-741.201] (-740.061) (-740.652) (-738.583) * [-737.438] (-737.950) (-738.220) (-737.825) -- 0:00:39
274000 -- (-738.637) (-739.869) (-741.887) [-739.019] * (-739.274) (-738.997) (-737.622) [-738.679] -- 0:00:39
274500 -- (-740.361) [-741.935] (-740.538) (-739.018) * (-738.426) [-737.918] (-742.450) (-741.142) -- 0:00:39
275000 -- (-737.809) (-738.512) (-740.145) [-738.351] * (-739.996) (-738.611) (-744.669) [-740.624] -- 0:00:39
Average standard deviation of split frequencies: 0.018105
275500 -- (-737.874) [-740.954] (-740.399) (-741.827) * (-742.404) [-738.753] (-739.639) (-740.780) -- 0:00:39
276000 -- (-741.315) [-739.641] (-738.005) (-739.740) * (-741.911) (-738.012) [-741.182] (-738.763) -- 0:00:39
276500 -- (-737.676) (-739.403) (-741.196) [-740.754] * [-739.826] (-738.473) (-739.952) (-737.952) -- 0:00:39
277000 -- (-739.557) [-743.110] (-741.196) (-739.012) * (-741.560) (-738.695) (-739.637) [-737.533] -- 0:00:39
277500 -- (-743.664) [-739.297] (-743.612) (-745.373) * (-740.456) (-738.641) (-738.572) [-738.064] -- 0:00:39
278000 -- (-740.995) [-740.591] (-739.656) (-739.125) * (-742.199) [-738.196] (-742.085) (-740.962) -- 0:00:38
278500 -- (-738.122) (-740.673) [-744.916] (-742.466) * (-740.616) (-737.682) (-738.896) [-743.943] -- 0:00:38
279000 -- (-738.379) (-743.733) [-742.355] (-738.352) * (-738.642) (-742.476) [-739.185] (-737.518) -- 0:00:38
279500 -- (-738.536) (-737.932) (-741.695) [-738.643] * (-738.622) (-737.409) [-738.278] (-740.106) -- 0:00:41
280000 -- (-737.823) (-737.718) (-739.438) [-737.299] * (-738.199) [-737.494] (-740.232) (-737.358) -- 0:00:41
Average standard deviation of split frequencies: 0.018140
280500 -- (-742.406) (-740.322) [-737.371] (-741.648) * (-740.145) (-741.395) [-739.901] (-736.954) -- 0:00:41
281000 -- (-740.144) (-739.367) (-740.750) [-742.766] * [-742.119] (-740.246) (-743.115) (-737.391) -- 0:00:40
281500 -- (-737.152) [-742.218] (-742.465) (-738.899) * (-738.300) (-737.510) [-748.545] (-739.166) -- 0:00:40
282000 -- (-738.492) [-741.883] (-739.709) (-740.670) * (-737.643) [-737.063] (-739.448) (-741.681) -- 0:00:40
282500 -- [-736.986] (-737.368) (-743.066) (-739.124) * (-738.058) (-737.064) (-739.603) [-738.056] -- 0:00:40
283000 -- (-740.349) (-739.078) (-742.057) [-739.286] * (-742.037) (-739.898) (-739.727) [-739.909] -- 0:00:40
283500 -- (-740.531) (-738.551) (-741.288) [-740.507] * (-738.709) (-739.473) (-740.209) [-737.717] -- 0:00:40
284000 -- (-741.307) [-738.709] (-739.331) (-739.647) * [-737.739] (-739.351) (-738.514) (-738.536) -- 0:00:40
284500 -- [-739.684] (-738.525) (-739.839) (-740.265) * (-738.682) (-738.551) (-738.393) [-741.219] -- 0:00:40
285000 -- (-741.858) (-741.769) [-738.623] (-740.338) * (-738.740) (-738.940) (-741.558) [-739.257] -- 0:00:40
Average standard deviation of split frequencies: 0.017801
285500 -- (-739.036) (-738.924) [-741.227] (-740.539) * (-739.475) (-738.984) [-738.750] (-737.748) -- 0:00:40
286000 -- (-738.637) [-739.522] (-737.521) (-740.954) * (-737.776) (-738.015) [-737.853] (-738.006) -- 0:00:39
286500 -- (-741.379) [-738.487] (-738.193) (-743.362) * (-737.315) (-738.262) [-737.885] (-738.110) -- 0:00:39
287000 -- (-737.780) [-740.155] (-737.864) (-740.185) * (-739.870) [-739.166] (-738.167) (-739.877) -- 0:00:39
287500 -- (-738.998) (-738.107) [-738.473] (-737.548) * (-737.063) (-737.793) [-739.041] (-740.922) -- 0:00:39
288000 -- [-737.578] (-739.815) (-738.258) (-737.557) * [-739.228] (-739.319) (-742.442) (-739.603) -- 0:00:39
288500 -- [-737.732] (-743.702) (-737.870) (-737.683) * (-749.017) (-742.231) [-738.237] (-738.786) -- 0:00:39
289000 -- (-739.173) [-739.266] (-740.271) (-741.045) * (-745.298) (-739.514) (-738.468) [-741.096] -- 0:00:39
289500 -- [-739.428] (-743.431) (-741.197) (-742.059) * (-738.068) (-738.899) [-740.333] (-737.703) -- 0:00:39
290000 -- [-737.373] (-738.279) (-740.919) (-741.003) * (-740.369) [-738.448] (-738.587) (-740.630) -- 0:00:39
Average standard deviation of split frequencies: 0.019786
290500 -- (-740.504) (-736.793) [-739.727] (-740.837) * (-737.644) (-740.579) [-740.024] (-739.374) -- 0:00:39
291000 -- (-739.339) (-737.297) [-739.001] (-739.448) * (-737.920) (-741.130) (-739.945) [-739.402] -- 0:00:38
291500 -- (-739.313) (-740.742) [-737.462] (-738.741) * [-739.050] (-737.447) (-739.415) (-739.623) -- 0:00:38
292000 -- (-737.683) (-740.578) [-741.669] (-738.552) * (-738.299) (-736.888) (-740.236) [-737.419] -- 0:00:38
292500 -- (-740.514) [-739.744] (-741.549) (-737.559) * (-738.891) [-737.107] (-738.652) (-737.273) -- 0:00:38
293000 -- (-742.432) (-738.866) [-738.493] (-737.677) * (-738.848) (-739.955) (-741.161) [-742.148] -- 0:00:38
293500 -- (-740.699) (-737.758) [-740.505] (-737.158) * (-738.770) (-741.956) [-738.231] (-737.909) -- 0:00:38
294000 -- (-739.203) (-738.046) [-737.723] (-738.829) * [-737.899] (-738.699) (-737.798) (-737.766) -- 0:00:38
294500 -- [-744.786] (-742.071) (-739.739) (-737.793) * [-738.731] (-740.424) (-738.029) (-738.775) -- 0:00:38
295000 -- (-740.762) (-740.552) (-737.548) [-737.405] * (-738.951) [-737.923] (-737.499) (-738.782) -- 0:00:38
Average standard deviation of split frequencies: 0.018792
295500 -- [-739.751] (-739.713) (-743.282) (-739.453) * (-737.216) [-737.496] (-737.137) (-737.211) -- 0:00:38
296000 -- (-741.289) (-741.940) (-739.902) [-738.214] * (-738.591) [-738.624] (-739.448) (-737.897) -- 0:00:38
296500 -- (-738.678) (-738.544) [-737.502] (-737.037) * (-742.922) (-740.908) [-741.371] (-746.027) -- 0:00:37
297000 -- (-738.643) (-740.684) [-737.954] (-737.102) * [-740.311] (-739.909) (-741.465) (-744.558) -- 0:00:37
297500 -- (-742.836) (-739.943) (-739.584) [-737.548] * (-737.748) (-738.157) [-739.480] (-738.497) -- 0:00:37
298000 -- (-740.441) (-739.226) (-737.868) [-741.196] * (-737.052) (-740.156) [-739.122] (-741.061) -- 0:00:40
298500 -- (-738.755) (-741.627) [-738.220] (-738.628) * (-738.041) (-741.423) (-740.626) [-740.904] -- 0:00:39
299000 -- (-737.635) [-738.646] (-740.866) (-738.929) * [-739.579] (-740.380) (-738.356) (-740.386) -- 0:00:39
299500 -- (-744.712) (-739.917) [-738.357] (-739.228) * [-739.137] (-740.622) (-737.748) (-739.039) -- 0:00:39
300000 -- [-738.422] (-738.914) (-738.360) (-738.501) * (-739.349) [-737.743] (-737.612) (-737.829) -- 0:00:39
Average standard deviation of split frequencies: 0.017560
300500 -- (-740.067) (-738.666) (-738.299) [-738.768] * (-737.464) [-738.857] (-738.058) (-738.287) -- 0:00:39
301000 -- (-738.796) (-737.985) (-738.386) [-744.931] * (-738.922) (-738.761) [-737.156] (-738.408) -- 0:00:39
301500 -- (-738.297) (-743.623) (-740.456) [-741.001] * (-744.730) (-739.182) [-737.024] (-738.128) -- 0:00:39
302000 -- (-737.534) (-742.376) [-740.774] (-740.548) * [-742.790] (-738.741) (-736.978) (-740.512) -- 0:00:39
302500 -- [-737.267] (-740.167) (-741.545) (-738.828) * [-738.334] (-738.111) (-737.861) (-739.112) -- 0:00:39
303000 -- (-738.541) (-738.751) [-739.590] (-738.956) * (-739.688) [-742.647] (-741.131) (-740.264) -- 0:00:39
303500 -- (-738.942) (-739.244) [-740.901] (-737.578) * [-738.906] (-741.330) (-740.014) (-739.109) -- 0:00:39
304000 -- (-736.797) [-737.951] (-743.761) (-737.195) * [-738.660] (-739.080) (-738.647) (-742.125) -- 0:00:38
304500 -- [-736.795] (-740.621) (-742.067) (-737.858) * (-742.384) [-737.425] (-739.810) (-740.536) -- 0:00:38
305000 -- [-738.653] (-744.678) (-742.337) (-748.900) * (-738.206) (-738.816) [-739.978] (-739.184) -- 0:00:38
Average standard deviation of split frequencies: 0.019719
305500 -- (-738.948) (-740.688) [-739.007] (-741.276) * (-738.922) [-737.924] (-741.508) (-739.894) -- 0:00:38
306000 -- (-742.838) (-740.147) (-738.575) [-742.781] * (-740.398) (-737.386) (-739.782) [-741.328] -- 0:00:38
306500 -- (-742.154) (-737.917) (-738.634) [-741.313] * (-740.365) [-738.272] (-739.308) (-743.354) -- 0:00:38
307000 -- [-738.606] (-741.720) (-740.013) (-737.693) * [-737.498] (-737.592) (-738.492) (-738.887) -- 0:00:38
307500 -- [-739.555] (-738.039) (-738.049) (-737.720) * (-737.411) [-737.212] (-740.834) (-739.549) -- 0:00:38
308000 -- [-738.511] (-738.905) (-738.344) (-738.174) * (-738.515) [-739.653] (-737.853) (-738.840) -- 0:00:38
308500 -- (-737.957) (-741.391) [-741.908] (-738.564) * (-738.453) (-742.182) (-738.016) [-738.841] -- 0:00:38
309000 -- [-740.236] (-740.568) (-738.905) (-738.432) * (-741.878) (-739.348) [-738.206] (-741.338) -- 0:00:38
309500 -- (-739.529) [-738.500] (-741.111) (-738.746) * (-739.903) [-739.840] (-742.019) (-742.589) -- 0:00:37
310000 -- (-738.622) (-740.490) (-740.703) [-739.249] * [-739.329] (-743.196) (-742.515) (-738.394) -- 0:00:37
Average standard deviation of split frequencies: 0.018816
310500 -- (-739.287) (-742.612) (-743.109) [-741.668] * [-740.828] (-739.213) (-737.400) (-738.680) -- 0:00:37
311000 -- (-739.136) (-737.313) (-737.483) [-741.608] * (-741.122) [-740.787] (-739.111) (-741.123) -- 0:00:37
311500 -- (-740.077) (-741.183) [-738.521] (-741.438) * (-740.146) [-737.874] (-738.896) (-738.790) -- 0:00:37
312000 -- [-740.664] (-741.002) (-741.088) (-738.808) * (-738.692) (-737.938) (-737.650) [-739.040] -- 0:00:37
312500 -- (-737.762) [-738.378] (-738.654) (-742.507) * (-738.617) (-739.509) (-739.765) [-740.493] -- 0:00:37
313000 -- (-739.271) [-739.458] (-739.922) (-739.953) * (-741.867) [-739.308] (-737.606) (-738.034) -- 0:00:37
313500 -- (-738.095) [-738.261] (-743.562) (-740.801) * (-738.907) (-739.488) [-737.030] (-740.199) -- 0:00:37
314000 -- (-738.053) [-737.216] (-737.135) (-739.869) * [-738.638] (-737.951) (-737.029) (-737.554) -- 0:00:37
314500 -- (-742.359) (-737.543) [-741.223] (-739.847) * [-737.124] (-740.272) (-738.334) (-738.774) -- 0:00:37
315000 -- [-738.766] (-738.217) (-740.150) (-739.770) * (-739.032) (-739.996) [-739.509] (-740.056) -- 0:00:36
Average standard deviation of split frequencies: 0.019095
315500 -- (-742.164) [-739.889] (-739.309) (-741.660) * (-738.128) (-737.280) (-741.927) [-739.769] -- 0:00:36
316000 -- [-738.266] (-742.914) (-737.418) (-737.646) * (-736.865) [-737.343] (-743.116) (-740.705) -- 0:00:36
316500 -- [-738.986] (-738.838) (-739.521) (-738.534) * (-738.279) (-737.626) (-742.281) [-741.601] -- 0:00:38
317000 -- (-738.162) (-741.179) [-738.475] (-738.301) * (-737.119) [-739.700] (-739.373) (-741.967) -- 0:00:38
317500 -- [-738.913] (-741.278) (-740.623) (-738.838) * (-739.652) (-738.226) [-737.663] (-740.072) -- 0:00:38
318000 -- (-739.794) [-737.617] (-740.392) (-738.121) * (-738.093) (-744.444) [-742.454] (-739.359) -- 0:00:38
318500 -- [-738.352] (-737.262) (-741.632) (-739.201) * (-739.778) (-743.357) [-738.195] (-742.101) -- 0:00:38
319000 -- (-743.750) (-742.572) (-739.452) [-738.726] * (-739.473) [-737.970] (-739.111) (-737.890) -- 0:00:38
319500 -- [-741.764] (-739.097) (-738.010) (-738.954) * (-737.925) (-740.203) (-748.597) [-738.693] -- 0:00:38
320000 -- [-738.220] (-739.546) (-741.958) (-738.909) * (-740.600) [-740.441] (-739.694) (-740.140) -- 0:00:38
Average standard deviation of split frequencies: 0.017935
320500 -- (-738.804) (-738.880) (-739.635) [-743.412] * [-739.542] (-738.549) (-738.740) (-740.334) -- 0:00:38
321000 -- (-739.902) (-741.997) (-745.409) [-737.430] * [-737.716] (-740.307) (-738.000) (-739.754) -- 0:00:38
321500 -- (-741.987) (-737.800) (-746.546) [-742.315] * (-737.735) [-738.680] (-740.845) (-744.243) -- 0:00:37
322000 -- (-741.078) [-739.316] (-745.688) (-740.133) * (-738.798) [-737.172] (-739.111) (-740.944) -- 0:00:37
322500 -- (-738.329) (-739.202) (-741.891) [-738.580] * (-738.216) (-740.913) [-737.950] (-737.856) -- 0:00:37
323000 -- (-737.837) (-739.862) [-742.759] (-741.402) * (-738.214) (-739.805) [-737.565] (-737.536) -- 0:00:37
323500 -- [-736.978] (-740.385) (-738.085) (-738.086) * [-737.204] (-738.945) (-739.125) (-737.049) -- 0:00:37
324000 -- [-738.757] (-737.704) (-739.260) (-740.749) * [-738.906] (-739.514) (-745.241) (-739.562) -- 0:00:37
324500 -- (-737.218) (-737.719) (-740.005) [-742.486] * [-749.730] (-739.679) (-742.099) (-738.170) -- 0:00:37
325000 -- (-741.397) (-737.910) (-743.575) [-743.088] * (-745.179) (-737.906) (-743.899) [-739.837] -- 0:00:37
Average standard deviation of split frequencies: 0.016195
325500 -- (-739.795) (-738.252) [-738.736] (-741.296) * (-743.102) (-741.180) [-738.791] (-742.138) -- 0:00:37
326000 -- (-740.059) (-741.316) [-740.926] (-740.198) * (-738.598) (-743.791) (-738.485) [-738.625] -- 0:00:37
326500 -- (-739.988) (-744.563) (-742.331) [-740.008] * (-737.388) (-742.141) (-742.934) [-738.225] -- 0:00:37
327000 -- (-737.085) (-741.067) (-738.415) [-738.513] * (-737.457) (-738.644) (-738.378) [-737.783] -- 0:00:37
327500 -- (-738.977) (-738.202) [-738.729] (-741.005) * [-739.268] (-739.021) (-737.250) (-738.122) -- 0:00:36
328000 -- (-738.101) (-738.548) (-739.011) [-738.413] * (-738.421) (-740.130) [-740.332] (-741.690) -- 0:00:36
328500 -- (-737.004) [-740.167] (-741.394) (-742.741) * (-738.990) (-738.377) (-738.316) [-737.921] -- 0:00:36
329000 -- (-738.787) [-739.162] (-741.892) (-739.022) * [-737.393] (-740.971) (-737.971) (-739.615) -- 0:00:36
329500 -- [-738.983] (-739.720) (-741.230) (-738.260) * (-737.835) [-738.561] (-738.101) (-739.089) -- 0:00:36
330000 -- (-741.450) (-738.580) [-737.919] (-737.547) * (-737.403) (-738.510) (-738.053) [-737.994] -- 0:00:36
Average standard deviation of split frequencies: 0.015397
330500 -- (-741.298) (-740.250) [-736.953] (-737.548) * (-737.376) (-737.339) [-737.806] (-739.151) -- 0:00:36
331000 -- (-738.530) [-743.249] (-743.129) (-737.302) * (-738.825) [-737.800] (-738.594) (-741.917) -- 0:00:36
331500 -- (-738.513) [-739.241] (-740.677) (-737.329) * (-737.975) (-738.028) (-738.534) [-738.098] -- 0:00:36
332000 -- [-742.259] (-739.499) (-738.633) (-740.699) * (-738.166) [-739.354] (-738.785) (-738.740) -- 0:00:36
332500 -- (-739.139) (-737.803) (-738.488) [-738.282] * [-741.759] (-737.792) (-738.801) (-739.169) -- 0:00:36
333000 -- (-739.200) (-737.915) [-737.997] (-739.775) * [-738.063] (-743.741) (-740.996) (-744.578) -- 0:00:36
333500 -- [-738.984] (-740.520) (-738.633) (-738.233) * (-740.171) [-737.698] (-740.210) (-746.024) -- 0:00:35
334000 -- (-739.941) [-740.302] (-738.808) (-742.257) * [-739.059] (-739.760) (-741.705) (-741.421) -- 0:00:35
334500 -- (-741.085) (-738.422) (-741.892) [-740.124] * [-739.629] (-739.570) (-738.910) (-739.388) -- 0:00:35
335000 -- (-737.656) [-741.158] (-741.088) (-740.291) * (-739.858) (-740.256) (-737.236) [-738.747] -- 0:00:37
Average standard deviation of split frequencies: 0.016555
335500 -- [-739.449] (-742.331) (-739.271) (-739.294) * [-739.096] (-740.373) (-739.868) (-739.759) -- 0:00:37
336000 -- (-743.278) (-737.988) [-738.505] (-740.495) * [-739.320] (-741.096) (-737.555) (-739.071) -- 0:00:37
336500 -- (-737.689) [-737.247] (-738.159) (-739.791) * (-741.251) [-740.793] (-741.536) (-739.483) -- 0:00:37
337000 -- (-737.504) (-737.864) [-739.315] (-740.432) * (-738.800) (-737.941) (-745.038) [-737.944] -- 0:00:37
337500 -- [-738.876] (-737.710) (-740.168) (-737.906) * (-740.914) (-738.519) (-740.605) [-737.592] -- 0:00:37
338000 -- [-741.730] (-740.384) (-739.782) (-738.263) * (-739.641) (-738.622) (-739.141) [-737.568] -- 0:00:37
338500 -- (-742.247) (-739.734) (-740.038) [-739.694] * [-741.131] (-738.342) (-737.450) (-737.159) -- 0:00:37
339000 -- (-739.722) (-742.866) (-739.661) [-738.768] * (-738.387) (-738.070) [-739.174] (-738.678) -- 0:00:37
339500 -- (-737.399) (-742.222) (-740.124) [-738.079] * (-737.310) (-741.167) (-738.543) [-738.590] -- 0:00:36
340000 -- (-737.449) (-738.275) [-738.537] (-740.042) * (-737.745) (-740.980) (-738.577) [-740.224] -- 0:00:36
Average standard deviation of split frequencies: 0.016882
340500 -- (-738.225) [-737.414] (-739.373) (-740.995) * (-737.981) (-738.055) (-738.518) [-738.232] -- 0:00:36
341000 -- (-739.024) [-737.374] (-739.182) (-739.124) * (-742.649) (-738.308) [-739.094] (-737.776) -- 0:00:36
341500 -- [-738.422] (-739.003) (-739.754) (-742.514) * (-743.830) (-739.365) [-738.755] (-737.859) -- 0:00:36
342000 -- [-739.241] (-739.547) (-742.754) (-740.668) * (-739.910) (-738.889) [-738.277] (-739.383) -- 0:00:36
342500 -- (-742.479) (-739.506) (-739.688) [-741.763] * (-741.963) [-738.228] (-738.246) (-740.071) -- 0:00:36
343000 -- (-740.752) [-738.043] (-743.975) (-741.230) * (-738.289) (-741.155) (-740.832) [-737.884] -- 0:00:36
343500 -- (-737.110) (-737.816) [-742.450] (-739.834) * (-738.337) (-739.340) [-741.490] (-741.387) -- 0:00:36
344000 -- (-737.254) (-738.526) (-740.491) [-739.940] * (-738.168) [-740.579] (-739.055) (-740.238) -- 0:00:36
344500 -- (-737.602) (-738.315) (-740.601) [-739.520] * [-737.925] (-740.287) (-737.874) (-740.868) -- 0:00:36
345000 -- [-738.064] (-738.759) (-740.671) (-738.605) * (-738.640) (-742.209) [-739.281] (-744.318) -- 0:00:36
Average standard deviation of split frequencies: 0.016622
345500 -- (-739.920) (-744.519) (-740.059) [-737.781] * (-737.368) (-741.106) [-738.186] (-740.219) -- 0:00:35
346000 -- (-739.001) (-738.462) [-738.505] (-739.937) * [-741.767] (-737.659) (-739.170) (-740.164) -- 0:00:35
346500 -- (-739.396) (-740.277) [-739.020] (-738.464) * [-738.069] (-738.078) (-737.649) (-738.279) -- 0:00:35
347000 -- (-749.289) [-739.863] (-737.259) (-747.869) * (-739.937) (-738.067) (-742.302) [-738.553] -- 0:00:35
347500 -- (-738.891) (-740.547) [-737.482] (-740.038) * (-740.099) [-737.541] (-740.022) (-740.251) -- 0:00:35
348000 -- (-739.890) (-738.873) (-737.880) [-737.702] * [-739.016] (-738.436) (-738.032) (-739.485) -- 0:00:35
348500 -- [-738.475] (-738.409) (-739.869) (-739.805) * (-737.927) [-738.493] (-742.745) (-738.701) -- 0:00:35
349000 -- (-740.160) (-739.001) [-737.288] (-742.295) * (-740.804) [-737.336] (-739.578) (-738.354) -- 0:00:35
349500 -- (-742.049) [-741.272] (-739.383) (-737.689) * (-741.438) [-737.640] (-739.052) (-738.428) -- 0:00:35
350000 -- (-742.732) [-737.701] (-737.487) (-737.926) * (-740.346) [-737.556] (-738.607) (-737.827) -- 0:00:35
Average standard deviation of split frequencies: 0.018014
350500 -- [-737.455] (-737.623) (-739.882) (-737.903) * (-742.176) [-737.615] (-739.000) (-738.465) -- 0:00:35
351000 -- [-739.940] (-739.975) (-738.527) (-743.424) * (-738.221) [-737.243] (-738.340) (-739.084) -- 0:00:35
351500 -- (-737.892) (-741.897) (-740.449) [-737.383] * [-739.315] (-737.266) (-739.558) (-740.789) -- 0:00:35
352000 -- [-738.022] (-743.897) (-741.357) (-740.542) * (-739.454) (-737.374) [-738.949] (-738.327) -- 0:00:34
352500 -- (-738.275) (-738.747) [-738.663] (-740.590) * [-737.737] (-738.701) (-737.877) (-738.748) -- 0:00:34
353000 -- (-739.019) (-739.842) (-739.284) [-740.397] * (-740.399) [-738.478] (-741.506) (-738.901) -- 0:00:34
353500 -- (-738.662) (-741.758) (-741.993) [-739.323] * [-739.808] (-739.970) (-741.939) (-737.687) -- 0:00:36
354000 -- (-738.186) (-743.715) (-742.117) [-739.359] * (-745.489) [-737.971] (-739.853) (-737.693) -- 0:00:36
354500 -- (-742.664) (-738.102) (-739.923) [-738.436] * [-737.738] (-738.162) (-738.116) (-738.804) -- 0:00:36
355000 -- (-739.405) [-739.009] (-742.573) (-740.190) * (-738.104) (-741.379) [-737.514] (-739.907) -- 0:00:36
Average standard deviation of split frequencies: 0.016685
355500 -- (-740.296) (-741.073) [-739.953] (-739.433) * (-738.103) (-738.299) [-740.292] (-739.851) -- 0:00:36
356000 -- (-738.426) (-741.758) (-741.934) [-737.739] * (-738.861) (-745.528) (-739.765) [-738.096] -- 0:00:36
356500 -- [-739.671] (-739.461) (-742.184) (-739.415) * (-740.233) [-738.960] (-738.222) (-743.897) -- 0:00:36
357000 -- (-737.764) (-738.352) (-740.951) [-742.380] * (-742.261) [-739.574] (-738.958) (-738.328) -- 0:00:36
357500 -- (-739.487) (-742.405) [-738.705] (-740.796) * [-739.152] (-743.043) (-738.860) (-737.027) -- 0:00:35
358000 -- [-739.129] (-741.187) (-740.524) (-737.077) * (-738.661) [-737.016] (-740.140) (-739.427) -- 0:00:35
358500 -- (-741.204) (-739.912) (-738.570) [-740.233] * (-739.300) [-737.057] (-739.271) (-739.251) -- 0:00:35
359000 -- (-740.506) [-738.621] (-738.079) (-738.571) * [-739.166] (-739.034) (-737.482) (-738.001) -- 0:00:35
359500 -- (-743.583) [-738.504] (-737.307) (-739.532) * (-741.512) (-739.519) (-737.776) [-737.792] -- 0:00:35
360000 -- (-740.436) [-739.549] (-743.453) (-739.292) * (-740.276) (-739.730) [-739.847] (-737.113) -- 0:00:35
Average standard deviation of split frequencies: 0.015946
360500 -- (-740.254) (-737.647) (-738.967) [-739.562] * [-737.748] (-739.968) (-742.672) (-742.827) -- 0:00:35
361000 -- [-739.768] (-737.599) (-738.051) (-742.037) * (-740.664) (-739.256) [-740.010] (-741.526) -- 0:00:35
361500 -- (-751.366) (-742.560) [-737.656] (-737.871) * (-737.896) [-738.164] (-737.537) (-738.275) -- 0:00:35
362000 -- [-744.958] (-738.831) (-746.857) (-737.800) * [-738.900] (-740.616) (-737.752) (-737.402) -- 0:00:35
362500 -- (-739.139) (-738.373) (-741.253) [-741.495] * (-745.796) (-739.729) [-738.100] (-741.607) -- 0:00:35
363000 -- (-742.942) (-738.114) (-740.054) [-738.919] * (-738.305) [-738.171] (-741.425) (-738.899) -- 0:00:35
363500 -- (-737.571) [-738.581] (-745.399) (-737.696) * (-738.175) (-738.755) (-741.247) [-737.607] -- 0:00:35
364000 -- (-737.824) (-738.741) (-741.375) [-738.715] * [-739.017] (-742.702) (-739.667) (-738.902) -- 0:00:34
364500 -- [-738.870] (-738.086) (-737.691) (-739.049) * [-737.591] (-739.067) (-741.198) (-742.861) -- 0:00:34
365000 -- (-738.993) (-740.816) [-736.984] (-739.332) * [-737.543] (-739.927) (-739.656) (-743.060) -- 0:00:34
Average standard deviation of split frequencies: 0.015198
365500 -- (-737.999) (-740.605) [-737.811] (-737.751) * (-744.182) (-738.279) [-738.273] (-746.022) -- 0:00:34
366000 -- [-737.505] (-740.580) (-738.243) (-741.903) * (-739.150) (-738.573) (-741.124) [-741.220] -- 0:00:34
366500 -- (-739.950) (-742.946) [-740.653] (-742.374) * [-738.230] (-737.835) (-742.170) (-739.199) -- 0:00:34
367000 -- [-739.516] (-740.928) (-738.967) (-740.249) * (-738.525) (-738.855) [-740.417] (-739.323) -- 0:00:34
367500 -- (-738.148) (-738.859) [-739.693] (-737.745) * [-739.310] (-739.600) (-737.220) (-741.508) -- 0:00:34
368000 -- (-739.409) (-739.340) (-738.583) [-738.656] * (-739.483) [-737.653] (-741.438) (-740.452) -- 0:00:34
368500 -- (-739.123) (-739.056) [-738.637] (-738.659) * (-737.330) [-737.786] (-738.826) (-739.159) -- 0:00:34
369000 -- (-738.208) [-739.459] (-739.672) (-738.734) * (-739.016) (-738.633) [-739.934] (-739.297) -- 0:00:34
369500 -- (-737.415) [-738.857] (-741.713) (-738.272) * (-740.637) (-740.586) (-738.819) [-738.162] -- 0:00:34
370000 -- (-739.418) (-742.983) [-741.730] (-737.345) * (-739.586) [-740.596] (-740.412) (-738.127) -- 0:00:34
Average standard deviation of split frequencies: 0.014753
370500 -- (-741.059) (-743.246) [-740.323] (-747.707) * (-739.272) (-737.580) (-740.299) [-737.343] -- 0:00:33
371000 -- (-738.162) [-738.439] (-743.818) (-744.400) * [-738.248] (-737.341) (-739.494) (-738.309) -- 0:00:33
371500 -- (-737.531) (-739.420) [-737.973] (-737.339) * (-738.181) (-737.203) [-739.869] (-744.407) -- 0:00:33
372000 -- (-737.484) [-739.538] (-740.081) (-741.026) * (-739.159) [-738.045] (-738.302) (-738.228) -- 0:00:33
372500 -- (-737.600) (-738.582) (-739.248) [-740.455] * (-738.409) (-740.077) [-739.532] (-738.202) -- 0:00:35
373000 -- (-737.487) [-740.405] (-739.802) (-740.370) * [-741.046] (-742.572) (-741.176) (-739.041) -- 0:00:35
373500 -- (-737.639) [-739.356] (-743.658) (-740.980) * (-739.640) (-737.168) (-740.284) [-739.483] -- 0:00:35
374000 -- [-738.231] (-739.992) (-743.783) (-743.589) * (-741.594) [-737.809] (-737.934) (-738.741) -- 0:00:35
374500 -- (-739.193) (-740.610) [-738.351] (-738.208) * (-737.679) (-741.621) (-738.446) [-738.366] -- 0:00:35
375000 -- (-737.965) [-741.168] (-738.651) (-742.218) * (-738.693) (-741.152) [-737.266] (-739.317) -- 0:00:35
Average standard deviation of split frequencies: 0.015546
375500 -- [-739.396] (-737.686) (-740.941) (-740.184) * [-738.639] (-742.953) (-738.297) (-738.575) -- 0:00:34
376000 -- [-743.702] (-738.663) (-739.567) (-742.948) * (-743.639) [-741.353] (-740.605) (-739.336) -- 0:00:34
376500 -- (-741.182) (-739.731) [-737.942] (-741.043) * (-737.321) [-739.339] (-742.641) (-747.736) -- 0:00:34
377000 -- (-738.058) (-744.757) (-737.671) [-741.010] * [-738.913] (-741.790) (-738.616) (-742.131) -- 0:00:34
377500 -- (-739.967) (-740.483) (-737.830) [-739.324] * [-738.046] (-737.678) (-737.430) (-740.983) -- 0:00:34
378000 -- [-741.560] (-744.734) (-739.601) (-737.487) * (-738.169) (-737.038) (-741.427) [-738.051] -- 0:00:34
378500 -- (-738.656) (-737.484) [-738.292] (-739.202) * [-742.464] (-742.144) (-738.504) (-738.649) -- 0:00:34
379000 -- (-742.497) (-737.335) [-737.593] (-740.312) * (-742.198) (-741.023) [-739.427] (-741.438) -- 0:00:34
379500 -- (-739.088) [-737.808] (-741.377) (-743.664) * (-739.187) [-738.838] (-741.480) (-737.398) -- 0:00:34
380000 -- (-738.264) (-737.321) [-740.451] (-741.687) * (-738.487) [-742.265] (-741.279) (-736.890) -- 0:00:34
Average standard deviation of split frequencies: 0.014613
380500 -- (-739.282) (-737.251) (-741.932) [-743.018] * [-739.094] (-737.844) (-741.279) (-740.088) -- 0:00:34
381000 -- (-738.328) (-737.096) (-737.497) [-738.830] * (-737.281) (-745.053) (-742.010) [-741.037] -- 0:00:34
381500 -- (-739.549) (-739.073) [-741.117] (-739.698) * (-737.871) (-741.303) (-741.365) [-737.968] -- 0:00:34
382000 -- [-739.145] (-737.361) (-738.596) (-743.268) * (-737.774) (-738.747) (-740.910) [-738.445] -- 0:00:33
382500 -- (-739.940) [-737.674] (-738.938) (-741.554) * (-738.585) (-738.022) (-740.104) [-738.718] -- 0:00:33
383000 -- (-738.985) (-743.573) (-740.216) [-743.613] * (-738.392) [-739.609] (-738.583) (-738.265) -- 0:00:33
383500 -- [-739.203] (-739.349) (-741.136) (-739.151) * (-739.659) (-738.787) (-738.991) [-744.116] -- 0:00:33
384000 -- (-737.859) (-740.949) (-739.827) [-738.891] * (-738.717) [-738.025] (-739.052) (-741.079) -- 0:00:33
384500 -- (-738.882) [-738.125] (-742.187) (-737.719) * [-739.429] (-740.064) (-737.890) (-741.226) -- 0:00:33
385000 -- [-740.521] (-737.507) (-738.960) (-738.087) * (-745.392) (-738.575) (-738.091) [-739.797] -- 0:00:33
Average standard deviation of split frequencies: 0.014411
385500 -- (-741.204) (-737.208) (-737.883) [-737.723] * (-739.497) [-737.295] (-738.091) (-740.316) -- 0:00:33
386000 -- (-741.370) (-742.188) (-737.917) [-739.137] * (-739.985) (-737.802) [-740.197] (-739.105) -- 0:00:33
386500 -- (-738.226) (-741.715) [-737.367] (-740.191) * (-737.571) (-740.789) [-739.725] (-739.777) -- 0:00:33
387000 -- (-737.781) [-740.091] (-738.172) (-740.798) * [-738.910] (-739.707) (-741.172) (-737.578) -- 0:00:33
387500 -- (-739.972) (-740.056) (-737.149) [-738.552] * (-738.011) [-741.863] (-745.542) (-739.314) -- 0:00:33
388000 -- (-739.991) (-738.948) [-739.791] (-739.348) * (-737.845) (-739.544) (-738.748) [-739.672] -- 0:00:33
388500 -- (-737.232) (-745.051) (-740.113) [-740.517] * [-739.540] (-737.304) (-738.457) (-741.370) -- 0:00:33
389000 -- (-743.682) (-738.584) [-740.002] (-740.741) * (-744.972) (-744.363) (-738.980) [-738.003] -- 0:00:32
389500 -- (-740.228) (-738.133) (-737.994) [-740.228] * (-737.393) (-738.077) [-743.189] (-741.228) -- 0:00:32
390000 -- (-739.217) (-737.660) (-738.348) [-741.720] * (-739.099) [-737.583] (-737.910) (-739.567) -- 0:00:32
Average standard deviation of split frequencies: 0.014480
390500 -- (-741.092) (-738.485) (-739.494) [-741.251] * [-738.273] (-737.896) (-736.919) (-740.148) -- 0:00:32
391000 -- (-737.036) (-737.751) [-738.187] (-739.120) * (-737.255) (-739.136) (-741.892) [-738.288] -- 0:00:34
391500 -- (-737.424) (-743.518) [-738.255] (-742.787) * (-739.561) (-737.479) [-739.179] (-738.477) -- 0:00:34
392000 -- (-737.302) [-737.977] (-738.691) (-739.213) * (-739.532) [-737.257] (-737.227) (-737.292) -- 0:00:34
392500 -- (-739.787) (-743.317) (-739.512) [-737.188] * [-738.433] (-738.443) (-739.188) (-739.721) -- 0:00:34
393000 -- (-740.963) (-737.837) (-737.467) [-738.994] * (-738.139) (-737.484) (-745.190) [-739.332] -- 0:00:33
393500 -- (-740.774) (-738.499) [-737.949] (-744.662) * (-741.125) [-744.596] (-743.151) (-737.255) -- 0:00:33
394000 -- (-740.129) (-738.101) (-740.097) [-740.892] * (-737.879) (-738.917) (-737.899) [-737.535] -- 0:00:33
394500 -- (-738.780) (-739.024) [-741.421] (-738.958) * (-738.833) (-741.702) [-740.520] (-739.514) -- 0:00:33
395000 -- (-740.994) [-737.338] (-739.691) (-741.643) * [-737.787] (-738.178) (-738.533) (-738.503) -- 0:00:33
Average standard deviation of split frequencies: 0.014047
395500 -- (-740.785) (-738.019) (-738.228) [-738.199] * (-738.010) (-737.472) (-739.776) [-738.682] -- 0:00:33
396000 -- (-738.951) (-738.990) (-740.888) [-738.757] * (-739.450) (-737.334) (-744.694) [-738.348] -- 0:00:33
396500 -- (-738.455) (-739.605) (-745.323) [-737.569] * [-738.461] (-739.155) (-741.271) (-739.483) -- 0:00:33
397000 -- (-741.733) (-737.222) (-740.041) [-739.352] * (-741.073) (-738.333) (-737.957) [-737.727] -- 0:00:33
397500 -- (-738.890) (-737.962) [-742.030] (-741.818) * [-737.840] (-741.848) (-739.970) (-740.673) -- 0:00:33
398000 -- (-740.765) (-741.458) [-739.219] (-740.470) * [-737.647] (-743.836) (-740.567) (-747.362) -- 0:00:33
398500 -- [-738.902] (-738.675) (-738.692) (-741.364) * (-740.133) (-736.899) [-740.536] (-740.604) -- 0:00:33
399000 -- (-743.229) (-739.144) [-738.608] (-737.299) * [-742.327] (-743.498) (-742.171) (-737.024) -- 0:00:33
399500 -- [-740.000] (-740.106) (-739.312) (-739.403) * (-741.453) (-738.508) [-739.283] (-737.315) -- 0:00:33
400000 -- (-743.062) (-738.550) [-742.484] (-739.134) * (-739.869) [-737.478] (-738.676) (-738.814) -- 0:00:33
Average standard deviation of split frequencies: 0.014589
400500 -- (-738.235) [-739.001] (-738.654) (-740.641) * (-742.314) (-737.883) (-743.992) [-739.546] -- 0:00:32
401000 -- (-738.484) (-742.658) [-740.830] (-743.456) * [-738.158] (-737.561) (-743.238) (-740.173) -- 0:00:32
401500 -- (-737.389) (-744.397) [-738.880] (-739.452) * (-737.781) [-739.893] (-740.366) (-737.992) -- 0:00:32
402000 -- (-739.405) [-740.380] (-738.271) (-738.359) * (-738.276) (-742.820) (-738.543) [-739.413] -- 0:00:32
402500 -- (-738.057) (-740.046) [-739.312] (-740.275) * [-739.213] (-743.610) (-738.869) (-738.439) -- 0:00:32
403000 -- (-740.494) (-740.512) [-737.785] (-741.397) * [-738.138] (-737.602) (-739.784) (-738.663) -- 0:00:32
403500 -- (-739.382) [-739.891] (-740.967) (-738.526) * (-741.932) (-737.707) (-740.299) [-740.748] -- 0:00:32
404000 -- (-739.405) [-742.999] (-740.061) (-737.706) * (-739.128) [-737.837] (-739.144) (-738.069) -- 0:00:32
404500 -- [-740.132] (-740.286) (-737.939) (-737.776) * [-742.377] (-738.371) (-737.968) (-737.972) -- 0:00:32
405000 -- (-738.590) [-740.124] (-738.340) (-736.989) * [-738.549] (-739.082) (-737.750) (-738.577) -- 0:00:32
Average standard deviation of split frequencies: 0.014165
405500 -- [-737.659] (-738.789) (-738.541) (-740.617) * (-738.751) (-738.464) [-739.829] (-738.011) -- 0:00:32
406000 -- [-737.660] (-738.971) (-739.034) (-738.219) * (-740.777) (-740.110) (-741.043) [-736.862] -- 0:00:32
406500 -- (-738.401) (-741.226) [-738.391] (-737.984) * [-740.167] (-738.574) (-738.576) (-739.533) -- 0:00:32
407000 -- [-738.961] (-738.373) (-739.374) (-738.902) * [-739.279] (-737.915) (-742.152) (-737.408) -- 0:00:32
407500 -- [-739.975] (-740.622) (-738.343) (-738.594) * (-738.835) (-740.644) (-737.955) [-739.754] -- 0:00:31
408000 -- (-738.470) (-742.598) (-739.108) [-738.124] * (-740.105) (-743.932) [-737.108] (-737.189) -- 0:00:31
408500 -- (-738.139) (-742.677) (-740.995) [-737.182] * (-741.797) [-741.133] (-742.471) (-737.509) -- 0:00:31
409000 -- (-739.263) (-743.122) [-739.774] (-737.465) * (-737.118) (-737.956) [-739.186] (-738.985) -- 0:00:31
409500 -- [-738.897] (-743.460) (-738.896) (-737.557) * (-739.116) (-742.571) [-738.387] (-740.140) -- 0:00:33
410000 -- (-739.981) [-740.058] (-742.685) (-737.487) * (-737.995) (-744.973) (-738.077) [-739.824] -- 0:00:33
Average standard deviation of split frequencies: 0.012856
410500 -- (-745.592) (-738.965) [-738.147] (-740.799) * [-737.505] (-738.459) (-737.630) (-740.369) -- 0:00:33
411000 -- [-740.143] (-738.010) (-747.573) (-742.258) * [-742.085] (-737.874) (-738.869) (-740.915) -- 0:00:32
411500 -- (-739.044) (-738.790) [-739.056] (-742.756) * (-741.545) (-746.532) (-739.002) [-738.631] -- 0:00:32
412000 -- (-738.831) (-739.462) (-738.199) [-742.635] * (-740.273) (-741.451) (-739.299) [-739.304] -- 0:00:32
412500 -- (-742.479) (-742.599) [-739.976] (-743.800) * (-740.368) (-740.426) (-747.466) [-737.883] -- 0:00:32
413000 -- (-740.616) (-738.957) [-737.970] (-739.454) * [-737.545] (-739.664) (-741.445) (-741.053) -- 0:00:32
413500 -- (-742.633) [-743.152] (-739.848) (-744.990) * [-739.220] (-738.259) (-737.716) (-742.232) -- 0:00:32
414000 -- [-745.792] (-740.758) (-741.399) (-743.100) * [-739.006] (-742.454) (-737.705) (-739.060) -- 0:00:32
414500 -- [-743.026] (-743.543) (-737.334) (-739.963) * (-740.899) (-738.816) [-737.339] (-738.012) -- 0:00:32
415000 -- [-737.227] (-737.938) (-746.913) (-739.071) * [-738.861] (-740.161) (-740.878) (-738.240) -- 0:00:32
Average standard deviation of split frequencies: 0.013598
415500 -- (-738.009) [-738.992] (-743.585) (-743.113) * (-741.432) (-742.687) [-738.617] (-740.804) -- 0:00:32
416000 -- (-739.290) (-739.667) [-738.505] (-738.563) * (-737.164) [-739.793] (-740.638) (-738.716) -- 0:00:32
416500 -- (-740.787) (-739.557) (-743.037) [-739.753] * (-738.744) (-743.082) [-737.566] (-738.304) -- 0:00:32
417000 -- (-740.573) [-739.512] (-739.090) (-739.488) * [-737.864] (-743.526) (-739.865) (-742.203) -- 0:00:32
417500 -- (-738.624) [-739.874] (-739.353) (-737.679) * [-740.137] (-741.059) (-740.214) (-739.200) -- 0:00:32
418000 -- [-739.124] (-737.169) (-738.693) (-738.442) * [-740.166] (-740.134) (-738.220) (-740.438) -- 0:00:32
418500 -- [-738.653] (-740.147) (-738.855) (-739.558) * [-737.481] (-738.342) (-739.107) (-739.667) -- 0:00:31
419000 -- (-739.699) (-740.103) (-738.116) [-738.468] * (-740.383) (-738.826) (-741.855) [-737.542] -- 0:00:31
419500 -- (-739.376) [-737.132] (-741.727) (-738.709) * (-739.125) (-740.072) (-738.993) [-743.070] -- 0:00:31
420000 -- [-738.494] (-738.788) (-742.221) (-740.685) * (-743.174) (-738.542) (-740.849) [-739.664] -- 0:00:31
Average standard deviation of split frequencies: 0.012327
420500 -- [-739.476] (-738.980) (-740.052) (-739.335) * [-740.293] (-741.180) (-738.799) (-739.791) -- 0:00:31
421000 -- (-738.110) [-738.433] (-738.845) (-739.921) * (-738.004) (-742.498) (-740.455) [-737.831] -- 0:00:31
421500 -- (-739.503) [-743.790] (-737.808) (-739.504) * (-740.504) [-741.655] (-740.382) (-739.481) -- 0:00:31
422000 -- [-739.316] (-738.126) (-737.004) (-737.105) * (-740.963) (-739.592) (-739.459) [-740.225] -- 0:00:31
422500 -- [-737.323] (-737.333) (-738.289) (-743.879) * (-740.018) [-739.645] (-737.979) (-737.226) -- 0:00:31
423000 -- (-741.339) [-739.048] (-737.576) (-741.761) * (-742.823) [-738.182] (-739.259) (-738.882) -- 0:00:31
423500 -- [-738.782] (-740.165) (-738.770) (-739.641) * (-738.151) [-738.526] (-737.772) (-741.223) -- 0:00:31
424000 -- (-738.929) (-738.431) (-739.548) [-738.547] * (-738.610) [-737.582] (-740.422) (-741.338) -- 0:00:31
424500 -- (-741.428) (-738.171) [-738.844] (-742.104) * (-738.272) (-738.155) (-739.238) [-739.337] -- 0:00:31
425000 -- (-738.294) [-738.978] (-740.099) (-743.303) * (-741.813) (-737.417) (-737.850) [-739.298] -- 0:00:31
Average standard deviation of split frequencies: 0.012394
425500 -- (-743.579) (-740.319) [-738.066] (-738.277) * (-739.896) (-738.548) [-738.285] (-740.405) -- 0:00:31
426000 -- [-738.467] (-738.593) (-739.267) (-739.940) * [-737.769] (-739.366) (-737.984) (-739.768) -- 0:00:30
426500 -- (-737.928) (-740.165) (-740.626) [-740.958] * (-740.492) (-738.542) [-739.040] (-740.969) -- 0:00:30
427000 -- (-740.915) (-739.029) [-739.298] (-738.205) * (-739.074) [-743.520] (-740.227) (-738.677) -- 0:00:30
427500 -- (-742.421) [-738.147] (-738.067) (-738.851) * (-738.051) [-741.832] (-740.230) (-740.375) -- 0:00:30
428000 -- [-737.323] (-738.065) (-737.823) (-741.622) * [-738.437] (-743.461) (-741.100) (-742.193) -- 0:00:32
428500 -- [-739.478] (-739.108) (-737.757) (-740.178) * [-739.040] (-739.422) (-741.997) (-737.622) -- 0:00:32
429000 -- (-738.110) (-739.155) [-737.206] (-743.143) * [-737.598] (-750.133) (-742.950) (-741.852) -- 0:00:31
429500 -- [-740.097] (-742.841) (-738.006) (-746.585) * (-739.072) (-740.101) [-748.769] (-740.836) -- 0:00:31
430000 -- (-742.779) (-738.336) (-737.664) [-741.116] * (-740.689) (-738.811) (-737.943) [-738.453] -- 0:00:31
Average standard deviation of split frequencies: 0.012259
430500 -- [-738.738] (-737.774) (-741.253) (-747.527) * (-739.248) [-739.974] (-739.308) (-738.149) -- 0:00:31
431000 -- [-741.560] (-737.833) (-739.295) (-743.041) * (-741.343) (-740.690) [-739.547] (-742.019) -- 0:00:31
431500 -- (-737.877) [-740.926] (-738.620) (-739.871) * (-747.086) (-737.624) [-739.472] (-741.281) -- 0:00:31
432000 -- (-739.732) (-740.249) (-739.121) [-740.203] * (-744.119) [-737.623] (-739.314) (-741.048) -- 0:00:31
432500 -- [-737.046] (-739.717) (-743.554) (-738.479) * (-740.667) [-737.814] (-741.606) (-740.890) -- 0:00:31
433000 -- (-739.544) [-739.279] (-737.522) (-737.198) * [-738.377] (-739.138) (-739.333) (-739.075) -- 0:00:31
433500 -- (-737.838) (-740.302) [-738.747] (-736.989) * (-740.055) (-738.573) (-739.309) [-738.745] -- 0:00:31
434000 -- (-741.340) (-737.746) [-739.283] (-739.860) * [-738.321] (-740.453) (-738.597) (-742.906) -- 0:00:31
434500 -- (-739.774) (-739.652) (-743.209) [-737.121] * (-737.725) (-738.700) [-737.811] (-738.189) -- 0:00:31
435000 -- (-738.465) (-743.815) [-744.150] (-737.648) * [-737.963] (-740.044) (-740.614) (-738.528) -- 0:00:31
Average standard deviation of split frequencies: 0.012758
435500 -- [-743.222] (-746.864) (-741.050) (-739.319) * (-738.773) [-737.530] (-739.730) (-739.509) -- 0:00:31
436000 -- (-738.204) (-739.463) (-738.678) [-740.145] * (-738.194) (-743.479) [-740.305] (-737.284) -- 0:00:31
436500 -- (-738.926) [-738.625] (-740.261) (-739.332) * [-740.204] (-738.840) (-741.073) (-738.652) -- 0:00:30
437000 -- (-742.878) (-738.610) (-739.220) [-738.917] * (-739.563) (-738.460) [-739.573] (-744.093) -- 0:00:30
437500 -- [-741.314] (-740.145) (-741.998) (-738.281) * (-742.806) [-738.173] (-742.707) (-737.944) -- 0:00:30
438000 -- (-737.928) (-739.972) [-737.844] (-738.767) * (-739.993) (-742.598) [-742.942] (-739.505) -- 0:00:30
438500 -- (-737.649) (-739.711) [-738.017] (-739.171) * (-738.684) (-739.530) [-738.641] (-737.113) -- 0:00:30
439000 -- (-739.049) (-742.033) [-738.091] (-738.301) * [-738.197] (-742.273) (-739.464) (-737.270) -- 0:00:30
439500 -- (-739.808) [-738.812] (-741.012) (-739.979) * (-738.362) (-742.458) [-738.246] (-738.556) -- 0:00:30
440000 -- (-740.393) (-738.426) (-738.280) [-739.071] * [-737.482] (-739.947) (-738.963) (-743.686) -- 0:00:30
Average standard deviation of split frequencies: 0.013265
440500 -- (-738.460) (-737.822) (-741.908) [-738.286] * (-737.127) (-739.398) [-738.364] (-743.905) -- 0:00:30
441000 -- (-738.821) (-738.348) [-739.489] (-737.117) * (-740.772) (-739.436) [-737.756] (-740.920) -- 0:00:30
441500 -- [-740.651] (-740.979) (-738.942) (-737.118) * (-740.684) [-737.951] (-741.636) (-738.843) -- 0:00:30
442000 -- [-740.193] (-740.942) (-739.865) (-738.129) * (-742.387) (-738.381) (-741.550) [-740.595] -- 0:00:30
442500 -- (-738.562) (-741.265) (-738.582) [-739.222] * [-738.965] (-741.339) (-737.650) (-743.442) -- 0:00:30
443000 -- [-738.014] (-738.741) (-740.687) (-739.794) * [-738.003] (-740.851) (-739.498) (-740.898) -- 0:00:30
443500 -- (-739.884) (-739.094) (-738.280) [-740.763] * (-738.848) [-739.337] (-737.628) (-743.827) -- 0:00:30
444000 -- [-739.775] (-738.980) (-738.508) (-739.228) * (-737.523) (-738.283) (-737.459) [-739.360] -- 0:00:30
444500 -- (-743.668) [-739.761] (-738.378) (-739.701) * (-739.901) (-737.874) (-739.882) [-739.394] -- 0:00:29
445000 -- [-740.201] (-738.729) (-738.626) (-742.390) * [-738.166] (-739.249) (-741.822) (-742.257) -- 0:00:29
Average standard deviation of split frequencies: 0.012472
445500 -- [-738.688] (-738.993) (-745.159) (-739.722) * (-739.511) (-740.223) [-740.199] (-741.544) -- 0:00:29
446000 -- [-739.133] (-738.658) (-747.862) (-739.744) * (-738.427) (-738.015) [-739.734] (-737.262) -- 0:00:29
446500 -- (-739.716) [-737.855] (-738.523) (-742.170) * [-737.519] (-743.030) (-740.556) (-737.632) -- 0:00:30
447000 -- (-738.866) (-740.761) [-738.544] (-741.539) * [-738.788] (-741.874) (-740.082) (-739.653) -- 0:00:30
447500 -- (-739.363) (-738.902) (-739.993) [-740.854] * (-739.494) (-743.859) (-738.751) [-739.797] -- 0:00:30
448000 -- (-741.209) [-738.918] (-741.154) (-741.219) * [-737.071] (-737.171) (-739.772) (-739.103) -- 0:00:30
448500 -- (-738.508) [-737.201] (-739.677) (-741.580) * (-737.843) (-737.837) (-737.616) [-737.029] -- 0:00:30
449000 -- [-740.061] (-738.268) (-740.103) (-741.026) * [-737.862] (-738.308) (-739.028) (-740.521) -- 0:00:30
449500 -- (-742.260) [-738.164] (-737.750) (-737.382) * (-737.725) [-737.110] (-740.204) (-742.559) -- 0:00:30
450000 -- (-740.342) (-739.965) (-739.093) [-741.008] * [-740.543] (-739.417) (-749.283) (-738.391) -- 0:00:30
Average standard deviation of split frequencies: 0.013807
450500 -- (-739.643) (-743.078) (-737.225) [-737.091] * (-742.389) (-739.507) [-740.802] (-738.588) -- 0:00:30
451000 -- (-737.515) (-739.045) (-739.653) [-738.331] * [-741.340] (-740.806) (-737.730) (-739.322) -- 0:00:30
451500 -- (-737.284) (-738.637) [-738.424] (-744.692) * (-737.232) [-737.950] (-740.893) (-738.250) -- 0:00:30
452000 -- (-739.437) (-742.067) (-737.331) [-737.815] * (-738.533) [-737.206] (-739.603) (-741.110) -- 0:00:30
452500 -- (-739.271) (-743.968) [-740.653] (-740.963) * (-740.121) (-737.530) [-739.818] (-738.053) -- 0:00:30
453000 -- [-737.529] (-739.966) (-739.075) (-740.970) * (-740.385) (-738.033) [-740.360] (-737.873) -- 0:00:30
453500 -- [-740.336] (-738.266) (-740.830) (-740.956) * (-738.280) (-741.959) [-739.417] (-739.694) -- 0:00:30
454000 -- [-738.024] (-737.723) (-738.512) (-741.472) * [-738.280] (-739.456) (-739.454) (-738.786) -- 0:00:30
454500 -- (-739.859) (-741.925) [-738.454] (-737.841) * (-740.690) (-743.722) [-739.272] (-737.973) -- 0:00:30
455000 -- (-742.168) [-738.011] (-741.143) (-738.592) * (-741.353) (-742.140) [-737.227] (-738.394) -- 0:00:29
Average standard deviation of split frequencies: 0.014886
455500 -- [-742.280] (-740.599) (-741.230) (-737.979) * (-740.834) (-741.886) (-743.144) [-739.786] -- 0:00:29
456000 -- (-742.357) [-739.096] (-740.298) (-737.216) * (-739.149) (-741.561) [-737.340] (-737.870) -- 0:00:29
456500 -- (-737.605) (-741.852) [-742.399] (-738.359) * (-741.765) [-739.704] (-738.740) (-738.240) -- 0:00:29
457000 -- [-739.666] (-742.281) (-740.595) (-745.991) * [-740.514] (-738.743) (-737.538) (-743.108) -- 0:00:29
457500 -- (-737.730) (-738.832) (-742.833) [-738.747] * (-740.924) [-738.516] (-737.723) (-741.364) -- 0:00:29
458000 -- [-737.762] (-740.925) (-739.059) (-738.829) * (-740.280) [-737.640] (-738.368) (-740.885) -- 0:00:29
458500 -- [-742.565] (-743.398) (-738.301) (-739.207) * (-742.507) (-738.409) (-738.276) [-739.618] -- 0:00:29
459000 -- (-747.827) (-740.232) [-739.321] (-741.724) * (-741.188) [-737.927] (-740.494) (-738.803) -- 0:00:29
459500 -- (-740.089) [-741.258] (-738.030) (-739.532) * [-737.605] (-737.900) (-740.090) (-738.361) -- 0:00:29
460000 -- [-737.017] (-742.302) (-738.109) (-741.959) * [-738.725] (-737.519) (-742.753) (-738.106) -- 0:00:29
Average standard deviation of split frequencies: 0.016168
460500 -- (-737.185) (-739.401) [-740.879] (-738.761) * [-739.778] (-737.579) (-740.168) (-740.404) -- 0:00:29
461000 -- (-738.167) (-737.771) (-740.162) [-737.909] * (-738.593) (-739.694) [-739.099] (-737.411) -- 0:00:29
461500 -- [-740.244] (-737.610) (-741.500) (-739.204) * (-737.408) [-742.337] (-742.813) (-737.331) -- 0:00:29
462000 -- (-743.126) (-744.955) (-741.335) [-742.317] * [-738.898] (-739.250) (-740.177) (-737.939) -- 0:00:29
462500 -- (-741.540) [-738.835] (-739.857) (-741.739) * (-737.984) (-740.004) (-739.650) [-738.208] -- 0:00:29
463000 -- (-738.510) [-739.034] (-739.243) (-737.573) * (-737.740) (-740.755) [-739.125] (-743.055) -- 0:00:28
463500 -- (-738.116) (-738.810) [-737.399] (-742.519) * (-738.163) (-743.309) [-738.710] (-742.010) -- 0:00:28
464000 -- [-739.345] (-737.038) (-742.740) (-738.103) * (-738.308) (-739.727) (-740.271) [-738.786] -- 0:00:28
464500 -- (-737.917) (-737.474) [-738.327] (-741.827) * (-738.743) (-738.151) [-738.122] (-739.734) -- 0:00:28
465000 -- (-739.732) [-737.853] (-741.912) (-742.155) * (-737.221) [-740.436] (-737.830) (-740.086) -- 0:00:28
Average standard deviation of split frequencies: 0.017602
465500 -- (-739.085) [-740.124] (-740.577) (-740.014) * (-738.643) [-742.649] (-738.123) (-738.761) -- 0:00:29
466000 -- (-740.811) (-738.994) (-739.258) [-738.229] * (-738.296) (-738.321) [-738.600] (-737.975) -- 0:00:29
466500 -- [-738.748] (-739.992) (-740.026) (-740.664) * [-741.929] (-738.992) (-739.077) (-742.924) -- 0:00:29
467000 -- [-738.917] (-740.162) (-738.606) (-739.474) * (-739.133) [-740.483] (-739.301) (-738.514) -- 0:00:29
467500 -- (-737.958) [-738.374] (-737.040) (-737.553) * (-738.801) (-738.910) (-740.196) [-740.461] -- 0:00:29
468000 -- (-737.048) [-739.424] (-740.115) (-739.191) * (-738.646) (-737.539) (-740.735) [-740.017] -- 0:00:29
468500 -- (-737.025) [-739.461] (-739.308) (-739.730) * [-738.552] (-742.147) (-739.922) (-737.559) -- 0:00:29
469000 -- (-739.749) (-737.926) (-738.059) [-737.889] * (-742.565) [-737.269] (-737.225) (-739.368) -- 0:00:29
469500 -- (-738.717) [-737.811] (-738.450) (-737.859) * (-740.654) (-739.841) [-738.614] (-740.816) -- 0:00:29
470000 -- (-741.514) (-736.886) [-738.462] (-738.545) * (-740.109) [-741.458] (-738.619) (-739.135) -- 0:00:29
Average standard deviation of split frequencies: 0.016225
470500 -- (-737.439) (-738.253) (-739.500) [-738.933] * [-742.182] (-742.367) (-738.223) (-737.503) -- 0:00:29
471000 -- (-738.638) (-741.802) [-738.825] (-738.879) * (-737.768) (-745.413) [-739.810] (-742.165) -- 0:00:29
471500 -- (-739.366) (-748.855) (-737.224) [-739.936] * [-739.254] (-741.764) (-737.475) (-737.534) -- 0:00:29
472000 -- (-737.830) (-743.187) [-740.029] (-740.848) * [-739.385] (-741.262) (-738.772) (-741.860) -- 0:00:29
472500 -- (-737.864) [-738.179] (-742.265) (-737.044) * (-737.653) (-737.915) [-738.065] (-737.606) -- 0:00:29
473000 -- (-740.671) (-738.411) (-739.880) [-737.391] * (-737.980) (-739.314) (-740.722) [-741.992] -- 0:00:28
473500 -- [-737.640] (-741.984) (-739.008) (-738.196) * (-739.174) [-738.126] (-738.532) (-738.577) -- 0:00:28
474000 -- (-746.532) (-738.870) (-737.933) [-738.357] * (-740.363) (-739.735) (-739.246) [-739.215] -- 0:00:28
474500 -- [-738.286] (-737.551) (-741.268) (-738.978) * (-742.940) (-738.392) (-741.594) [-739.417] -- 0:00:28
475000 -- (-738.177) (-740.299) [-738.843] (-740.771) * (-742.076) (-740.172) (-738.970) [-738.950] -- 0:00:28
Average standard deviation of split frequencies: 0.016242
475500 -- (-738.435) (-736.993) (-738.630) [-741.403] * (-739.762) (-741.609) (-738.070) [-737.647] -- 0:00:28
476000 -- (-739.226) (-737.027) [-744.306] (-740.220) * (-739.690) [-739.986] (-739.150) (-740.994) -- 0:00:28
476500 -- (-741.628) (-737.590) [-738.972] (-738.426) * (-738.669) (-742.033) [-741.551] (-739.246) -- 0:00:28
477000 -- (-739.744) [-738.095] (-738.140) (-739.109) * (-740.171) (-740.326) (-743.220) [-738.008] -- 0:00:28
477500 -- [-739.263] (-741.849) (-738.133) (-739.359) * [-737.994] (-741.529) (-739.694) (-738.336) -- 0:00:28
478000 -- (-739.084) [-744.125] (-740.303) (-738.408) * (-742.205) (-741.608) (-740.820) [-737.273] -- 0:00:28
478500 -- (-740.557) (-740.569) (-740.727) [-744.027] * (-738.294) (-742.883) (-739.715) [-738.043] -- 0:00:28
479000 -- (-740.354) [-740.218] (-737.885) (-741.442) * (-737.208) (-740.752) [-741.223] (-739.985) -- 0:00:28
479500 -- (-744.362) (-737.631) [-738.584] (-739.847) * (-738.582) [-740.791] (-743.528) (-737.851) -- 0:00:28
480000 -- [-738.949] (-738.310) (-738.269) (-740.113) * (-739.091) (-741.722) [-738.081] (-739.355) -- 0:00:28
Average standard deviation of split frequencies: 0.016672
480500 -- [-739.982] (-740.289) (-740.513) (-739.026) * [-738.639] (-741.324) (-737.471) (-739.327) -- 0:00:28
481000 -- (-737.943) [-738.987] (-740.057) (-739.754) * [-738.750] (-741.493) (-739.861) (-741.516) -- 0:00:28
481500 -- [-737.890] (-739.659) (-740.615) (-741.647) * (-737.993) (-738.792) (-739.116) [-738.174] -- 0:00:27
482000 -- [-738.383] (-740.089) (-738.371) (-740.696) * (-738.067) (-741.357) (-738.624) [-739.446] -- 0:00:27
482500 -- (-738.499) (-742.984) (-740.934) [-739.049] * (-737.943) [-742.718] (-741.127) (-739.268) -- 0:00:27
483000 -- (-739.831) (-739.250) (-738.724) [-741.003] * [-737.369] (-739.560) (-741.248) (-739.777) -- 0:00:27
483500 -- (-740.624) [-740.179] (-738.989) (-744.545) * (-738.746) (-739.892) [-737.769] (-737.534) -- 0:00:27
484000 -- (-743.170) [-738.498] (-743.567) (-739.748) * (-737.842) (-741.213) (-738.645) [-740.120] -- 0:00:28
484500 -- [-741.043] (-742.462) (-738.183) (-737.494) * (-741.488) [-737.942] (-737.303) (-743.572) -- 0:00:28
485000 -- (-743.519) [-738.325] (-738.193) (-739.468) * (-741.090) (-737.973) [-742.135] (-742.834) -- 0:00:28
Average standard deviation of split frequencies: 0.017071
485500 -- [-737.355] (-740.703) (-743.958) (-739.706) * (-740.931) (-737.280) [-740.130] (-739.154) -- 0:00:28
486000 -- [-738.433] (-742.397) (-740.019) (-740.454) * (-739.311) [-736.950] (-739.168) (-738.625) -- 0:00:28
486500 -- [-739.843] (-740.457) (-739.821) (-741.178) * (-739.651) (-737.645) (-740.019) [-740.859] -- 0:00:28
487000 -- (-739.181) [-740.581] (-740.180) (-740.894) * (-741.080) (-742.539) (-742.611) [-738.927] -- 0:00:28
487500 -- (-738.566) [-737.853] (-738.457) (-739.243) * (-737.772) (-740.591) [-741.596] (-743.514) -- 0:00:28
488000 -- (-738.838) (-739.767) [-738.426] (-739.324) * (-744.428) (-738.276) [-737.951] (-743.438) -- 0:00:28
488500 -- (-740.251) (-739.045) (-738.757) [-743.645] * (-741.461) [-739.004] (-739.013) (-739.760) -- 0:00:28
489000 -- (-738.703) (-743.975) [-737.575] (-743.647) * (-738.487) [-738.548] (-738.876) (-741.077) -- 0:00:28
489500 -- (-737.328) (-739.534) [-738.311] (-742.014) * (-740.039) [-741.098] (-738.317) (-741.855) -- 0:00:28
490000 -- [-740.084] (-738.476) (-739.030) (-737.524) * (-747.370) (-743.754) (-743.880) [-737.245] -- 0:00:28
Average standard deviation of split frequencies: 0.014219
490500 -- (-738.571) (-743.111) (-737.826) [-739.216] * (-740.041) (-738.176) (-738.013) [-740.496] -- 0:00:28
491000 -- (-740.392) [-744.395] (-738.578) (-739.061) * (-737.754) (-744.137) [-738.213] (-738.262) -- 0:00:27
491500 -- (-741.476) (-742.887) (-738.977) [-739.707] * (-737.797) (-737.654) [-738.446] (-740.367) -- 0:00:27
492000 -- [-738.966] (-740.491) (-738.891) (-739.851) * (-738.954) [-738.712] (-737.572) (-737.981) -- 0:00:27
492500 -- (-739.770) (-738.592) [-738.661] (-740.050) * (-737.672) [-739.716] (-741.207) (-737.456) -- 0:00:27
493000 -- (-738.687) (-737.963) [-740.087] (-738.458) * (-737.098) (-739.452) [-739.149] (-737.485) -- 0:00:27
493500 -- (-738.395) (-739.343) (-739.134) [-738.375] * (-739.228) (-738.641) [-739.596] (-737.959) -- 0:00:27
494000 -- (-737.748) [-738.729] (-740.844) (-738.274) * (-737.926) [-737.882] (-745.322) (-739.441) -- 0:00:27
494500 -- (-738.487) [-739.220] (-740.460) (-738.657) * (-737.401) (-742.524) [-739.105] (-739.177) -- 0:00:27
495000 -- (-739.648) (-738.594) (-738.906) [-743.550] * (-737.824) (-739.413) (-738.293) [-738.529] -- 0:00:27
Average standard deviation of split frequencies: 0.014066
495500 -- (-740.371) [-740.810] (-742.811) (-741.591) * (-737.940) (-738.373) (-738.733) [-740.465] -- 0:00:27
496000 -- [-738.084] (-741.564) (-748.583) (-738.565) * (-738.866) (-738.393) (-740.508) [-737.411] -- 0:00:27
496500 -- (-740.398) (-739.063) [-738.600] (-737.550) * (-740.466) (-738.108) (-741.271) [-738.212] -- 0:00:27
497000 -- [-738.111] (-738.789) (-739.743) (-737.658) * (-737.740) (-743.505) (-740.958) [-738.090] -- 0:00:27
497500 -- [-738.707] (-740.243) (-739.541) (-737.658) * (-739.759) (-739.931) [-739.909] (-738.123) -- 0:00:27
498000 -- (-739.022) [-739.402] (-739.722) (-741.895) * [-739.965] (-738.454) (-741.754) (-738.684) -- 0:00:27
498500 -- [-740.688] (-739.005) (-737.630) (-737.955) * (-738.746) [-737.628] (-737.813) (-737.078) -- 0:00:27
499000 -- (-739.517) (-744.648) [-737.658] (-737.624) * (-737.798) (-739.697) [-739.538] (-738.376) -- 0:00:27
499500 -- [-738.547] (-741.092) (-739.918) (-743.759) * (-738.599) (-738.569) (-738.506) [-737.728] -- 0:00:27
500000 -- [-738.085] (-739.328) (-739.331) (-743.271) * [-739.082] (-739.921) (-738.881) (-739.455) -- 0:00:27
Average standard deviation of split frequencies: 0.014877
500500 -- (-740.116) (-740.180) [-738.094] (-743.388) * (-737.328) (-743.162) [-740.973] (-739.380) -- 0:00:26
501000 -- (-744.297) (-744.692) (-737.815) [-742.086] * (-737.406) (-740.080) (-739.653) [-739.266] -- 0:00:26
501500 -- [-740.408] (-738.811) (-739.346) (-740.133) * [-737.649] (-739.065) (-738.636) (-738.765) -- 0:00:26
502000 -- (-739.302) [-738.405] (-744.012) (-738.687) * (-743.907) [-741.110] (-740.890) (-737.093) -- 0:00:26
502500 -- (-738.759) [-741.218] (-738.787) (-738.693) * (-739.095) (-740.563) [-737.163] (-739.632) -- 0:00:27
503000 -- (-737.457) [-738.921] (-739.742) (-738.007) * (-742.608) (-738.249) [-738.022] (-739.495) -- 0:00:27
503500 -- (-739.908) [-744.120] (-737.836) (-740.566) * (-739.188) (-739.558) [-738.384] (-738.450) -- 0:00:27
504000 -- (-741.909) (-738.058) [-741.569] (-741.824) * [-737.939] (-739.167) (-742.479) (-738.152) -- 0:00:27
504500 -- [-741.216] (-740.671) (-738.070) (-741.411) * [-738.370] (-738.455) (-741.988) (-740.037) -- 0:00:27
505000 -- (-741.790) [-738.016] (-737.390) (-739.616) * (-738.411) (-738.661) [-740.553] (-738.729) -- 0:00:27
Average standard deviation of split frequencies: 0.016210
505500 -- [-737.793] (-740.627) (-738.938) (-740.358) * [-740.310] (-738.186) (-744.234) (-740.381) -- 0:00:27
506000 -- [-738.992] (-737.710) (-739.123) (-739.224) * (-738.831) (-738.106) (-741.628) [-739.599] -- 0:00:27
506500 -- [-740.842] (-739.084) (-737.791) (-739.747) * (-741.511) [-739.286] (-741.506) (-743.124) -- 0:00:27
507000 -- (-738.964) [-738.158] (-738.815) (-739.858) * (-738.761) (-743.624) (-738.529) [-738.700] -- 0:00:27
507500 -- (-741.418) [-740.765] (-741.289) (-738.029) * [-738.318] (-739.416) (-740.060) (-737.999) -- 0:00:27
508000 -- [-741.353] (-737.865) (-740.109) (-738.316) * (-738.187) [-740.226] (-738.169) (-745.519) -- 0:00:27
508500 -- (-740.781) (-739.918) [-741.065] (-738.514) * (-739.471) (-740.089) [-738.662] (-738.422) -- 0:00:27
509000 -- (-741.998) (-740.114) (-739.953) [-737.994] * [-739.193] (-740.612) (-738.612) (-740.411) -- 0:00:27
509500 -- (-737.704) [-740.969] (-738.575) (-741.475) * (-744.560) (-739.622) [-739.502] (-743.125) -- 0:00:26
510000 -- (-741.200) (-739.003) [-737.220] (-738.447) * (-739.595) [-745.690] (-738.791) (-741.360) -- 0:00:26
Average standard deviation of split frequencies: 0.016431
510500 -- (-737.657) (-739.432) (-739.512) [-739.282] * (-740.134) (-740.798) [-739.470] (-739.175) -- 0:00:26
511000 -- (-738.965) (-741.522) (-738.091) [-737.323] * (-739.294) (-740.101) (-740.499) [-741.152] -- 0:00:26
511500 -- [-738.299] (-737.578) (-737.677) (-738.093) * (-739.932) (-738.333) [-742.662] (-739.090) -- 0:00:26
512000 -- (-738.870) (-738.102) (-739.574) [-739.703] * (-740.829) (-737.202) [-738.984] (-740.712) -- 0:00:26
512500 -- [-742.824] (-743.712) (-739.265) (-738.200) * [-741.004] (-740.818) (-741.412) (-738.858) -- 0:00:26
513000 -- (-744.205) (-742.284) (-740.220) [-738.344] * (-738.042) (-746.195) (-739.232) [-742.065] -- 0:00:26
513500 -- (-740.769) (-740.300) [-738.347] (-739.390) * (-739.781) (-738.665) (-745.207) [-737.718] -- 0:00:26
514000 -- (-740.410) (-740.084) [-738.706] (-741.582) * (-739.930) [-741.690] (-738.476) (-738.280) -- 0:00:26
514500 -- (-738.452) (-737.866) [-738.952] (-741.087) * (-740.201) (-743.113) [-739.135] (-741.605) -- 0:00:26
515000 -- (-737.217) (-740.343) [-739.546] (-738.482) * (-738.320) [-738.757] (-740.366) (-742.050) -- 0:00:26
Average standard deviation of split frequencies: 0.016079
515500 -- (-738.556) [-737.924] (-737.939) (-742.061) * [-737.613] (-744.415) (-738.634) (-739.481) -- 0:00:26
516000 -- (-743.339) [-738.844] (-738.684) (-743.100) * [-738.087] (-736.857) (-739.230) (-739.278) -- 0:00:26
516500 -- [-737.616] (-737.569) (-738.294) (-740.132) * (-739.296) [-739.771] (-737.933) (-738.846) -- 0:00:26
517000 -- (-738.231) (-739.026) [-738.134] (-739.915) * (-742.047) (-737.667) [-738.273] (-740.778) -- 0:00:26
517500 -- (-737.362) [-738.071] (-740.921) (-741.817) * (-743.478) [-738.400] (-738.971) (-740.393) -- 0:00:26
518000 -- [-740.259] (-738.179) (-739.344) (-743.198) * (-746.001) [-739.280] (-739.674) (-737.436) -- 0:00:26
518500 -- (-739.687) (-739.617) (-738.077) [-738.218] * (-741.950) [-739.463] (-740.838) (-738.527) -- 0:00:26
519000 -- (-736.931) (-738.113) (-738.400) [-741.428] * (-739.201) (-738.399) [-738.316] (-739.368) -- 0:00:25
519500 -- [-737.225] (-738.978) (-737.577) (-741.267) * [-740.364] (-741.538) (-739.512) (-741.464) -- 0:00:25
520000 -- (-738.750) (-741.387) (-737.884) [-739.950] * (-737.915) [-739.126] (-738.305) (-739.732) -- 0:00:25
Average standard deviation of split frequencies: 0.016659
520500 -- (-738.956) (-741.452) [-737.968] (-739.332) * (-738.135) [-737.727] (-737.831) (-738.759) -- 0:00:25
521000 -- (-737.613) [-739.062] (-738.111) (-741.969) * [-738.257] (-737.730) (-740.281) (-739.316) -- 0:00:26
521500 -- (-738.224) [-739.049] (-739.427) (-738.548) * (-741.895) (-741.053) [-738.537] (-738.283) -- 0:00:26
522000 -- [-738.364] (-740.113) (-746.196) (-741.534) * (-738.309) (-740.816) [-739.334] (-742.169) -- 0:00:26
522500 -- (-738.397) (-739.017) (-743.533) [-738.448] * (-740.885) (-747.255) [-737.583] (-739.311) -- 0:00:26
523000 -- [-739.218] (-741.511) (-737.880) (-738.585) * [-738.652] (-738.646) (-744.706) (-743.674) -- 0:00:26
523500 -- [-738.514] (-738.353) (-737.988) (-740.859) * (-741.045) (-737.717) (-743.113) [-741.425] -- 0:00:26
524000 -- (-742.110) (-738.678) [-737.688] (-737.858) * (-741.725) [-739.549] (-738.972) (-741.814) -- 0:00:26
524500 -- (-740.715) [-737.796] (-738.094) (-739.502) * (-740.467) (-740.219) [-740.153] (-745.111) -- 0:00:26
525000 -- [-738.419] (-740.226) (-738.801) (-739.110) * (-739.480) [-739.795] (-739.629) (-740.556) -- 0:00:26
Average standard deviation of split frequencies: 0.016132
525500 -- (-740.877) (-743.772) (-743.871) [-739.105] * [-741.302] (-742.776) (-737.790) (-739.321) -- 0:00:26
526000 -- (-740.321) [-737.849] (-742.351) (-738.052) * (-740.179) (-737.525) [-738.554] (-739.638) -- 0:00:26
526500 -- (-739.012) (-739.459) [-741.870] (-736.942) * (-738.776) (-739.380) [-737.624] (-739.194) -- 0:00:26
527000 -- [-737.347] (-738.110) (-739.476) (-738.500) * (-740.715) [-738.115] (-737.478) (-737.452) -- 0:00:26
527500 -- (-740.617) (-739.917) [-739.588] (-739.077) * (-741.746) [-738.543] (-738.646) (-739.963) -- 0:00:25
528000 -- [-739.077] (-737.371) (-740.564) (-741.985) * (-741.105) (-740.033) (-738.703) [-737.443] -- 0:00:25
528500 -- (-739.522) (-739.157) [-741.339] (-740.610) * (-741.843) [-739.443] (-737.871) (-738.923) -- 0:00:25
529000 -- (-738.249) (-739.967) (-746.965) [-740.478] * [-740.202] (-737.813) (-737.332) (-739.568) -- 0:00:25
529500 -- (-743.472) (-738.293) (-737.396) [-737.209] * (-738.878) (-739.003) (-741.893) [-738.959] -- 0:00:25
530000 -- (-738.341) [-744.798] (-740.410) (-738.706) * (-739.230) (-739.504) [-738.787] (-737.793) -- 0:00:25
Average standard deviation of split frequencies: 0.016878
530500 -- (-741.157) (-741.033) (-741.848) [-739.105] * (-741.259) (-739.337) [-739.900] (-741.414) -- 0:00:25
531000 -- [-739.982] (-738.659) (-739.779) (-737.809) * (-741.070) (-736.979) [-739.888] (-739.772) -- 0:00:25
531500 -- (-739.076) (-739.638) [-739.597] (-738.837) * [-742.577] (-737.650) (-737.572) (-740.917) -- 0:00:25
532000 -- (-741.025) (-738.839) [-740.564] (-737.138) * [-739.033] (-739.499) (-739.927) (-740.780) -- 0:00:25
532500 -- [-739.999] (-741.351) (-740.548) (-737.229) * (-737.990) (-740.292) (-737.241) [-740.148] -- 0:00:25
533000 -- [-738.215] (-741.723) (-737.889) (-737.701) * [-738.658] (-743.154) (-737.925) (-739.565) -- 0:00:25
533500 -- (-738.315) [-738.367] (-737.683) (-739.163) * (-737.397) [-738.350] (-738.527) (-740.510) -- 0:00:25
534000 -- [-739.733] (-738.013) (-740.461) (-740.823) * (-736.972) (-737.157) [-742.538] (-739.010) -- 0:00:25
534500 -- (-740.145) (-740.227) (-741.215) [-738.941] * [-737.564] (-738.029) (-742.711) (-738.933) -- 0:00:25
535000 -- (-739.387) [-740.742] (-738.227) (-738.164) * (-738.073) (-739.913) [-736.881] (-739.650) -- 0:00:25
Average standard deviation of split frequencies: 0.017238
535500 -- [-737.382] (-738.139) (-742.033) (-740.745) * (-738.629) (-739.739) [-737.609] (-738.083) -- 0:00:25
536000 -- (-741.457) (-741.861) [-740.173] (-738.595) * (-738.141) [-737.601] (-737.194) (-737.133) -- 0:00:25
536500 -- (-739.348) [-739.340] (-741.094) (-741.503) * (-738.040) (-739.287) [-738.209] (-740.304) -- 0:00:25
537000 -- [-737.166] (-739.394) (-742.075) (-738.953) * [-740.475] (-737.722) (-739.540) (-739.040) -- 0:00:25
537500 -- (-737.220) (-739.315) (-740.139) [-737.447] * (-739.276) (-737.628) (-739.768) [-739.702] -- 0:00:24
538000 -- (-737.587) [-738.979] (-739.912) (-737.766) * [-738.102] (-737.148) (-739.211) (-741.043) -- 0:00:24
538500 -- (-737.976) (-737.446) (-740.085) [-739.696] * [-739.801] (-741.657) (-742.535) (-737.407) -- 0:00:24
539000 -- [-739.931] (-739.323) (-737.710) (-740.557) * (-738.333) (-740.667) [-737.597] (-741.199) -- 0:00:24
539500 -- [-738.778] (-738.170) (-740.449) (-738.045) * (-745.421) (-739.909) [-737.896] (-740.810) -- 0:00:25
540000 -- (-741.820) [-740.145] (-738.479) (-739.633) * (-743.940) (-744.309) [-738.146] (-740.567) -- 0:00:25
Average standard deviation of split frequencies: 0.017612
540500 -- [-741.310] (-738.597) (-742.032) (-746.843) * (-744.025) (-737.994) [-740.025] (-739.119) -- 0:00:25
541000 -- (-742.247) [-738.070] (-739.247) (-747.578) * (-739.470) (-737.632) (-738.287) [-737.420] -- 0:00:25
541500 -- (-743.074) (-738.546) (-740.834) [-745.231] * (-737.644) (-736.968) [-736.944] (-741.570) -- 0:00:25
542000 -- (-741.880) (-742.532) (-740.582) [-739.580] * (-737.051) [-742.309] (-739.632) (-739.271) -- 0:00:25
542500 -- (-739.570) (-744.341) [-745.747] (-738.533) * [-739.730] (-738.845) (-738.335) (-740.802) -- 0:00:25
543000 -- (-739.298) (-744.382) (-739.164) [-738.037] * (-740.662) (-740.529) (-741.579) [-740.166] -- 0:00:25
543500 -- (-739.749) (-742.709) (-740.721) [-739.153] * (-740.264) (-738.166) (-738.164) [-738.176] -- 0:00:25
544000 -- (-737.540) [-738.220] (-737.533) (-738.539) * (-742.136) [-738.519] (-737.254) (-742.932) -- 0:00:25
544500 -- [-738.014] (-738.964) (-739.372) (-737.629) * (-739.355) (-739.059) (-737.942) [-740.634] -- 0:00:25
545000 -- [-738.316] (-739.279) (-744.337) (-739.121) * [-742.893] (-738.415) (-738.478) (-738.902) -- 0:00:25
Average standard deviation of split frequencies: 0.017786
545500 -- (-739.918) (-738.038) [-740.852] (-739.852) * [-742.407] (-741.319) (-746.146) (-739.212) -- 0:00:24
546000 -- [-742.026] (-740.348) (-742.251) (-743.966) * (-740.011) (-741.044) [-740.205] (-738.817) -- 0:00:24
546500 -- (-739.674) [-738.705] (-743.817) (-743.176) * (-738.445) (-740.142) (-737.233) [-738.208] -- 0:00:24
547000 -- (-741.392) (-740.049) [-744.505] (-738.800) * (-738.909) (-739.211) [-737.701] (-740.334) -- 0:00:24
547500 -- (-738.738) (-740.209) [-738.594] (-740.252) * (-738.868) (-740.469) [-740.251] (-740.378) -- 0:00:24
548000 -- (-739.504) (-740.623) [-739.958] (-738.153) * (-738.453) [-740.351] (-740.152) (-740.043) -- 0:00:24
548500 -- (-739.689) [-740.513] (-740.607) (-742.119) * [-737.354] (-740.853) (-742.383) (-739.341) -- 0:00:24
549000 -- (-739.711) [-737.634] (-738.266) (-741.306) * (-737.881) [-738.104] (-740.594) (-739.285) -- 0:00:24
549500 -- [-739.635] (-738.434) (-740.255) (-737.450) * [-737.638] (-741.298) (-738.263) (-739.666) -- 0:00:24
550000 -- (-739.558) [-738.449] (-741.671) (-739.271) * [-738.247] (-739.194) (-741.544) (-739.327) -- 0:00:24
Average standard deviation of split frequencies: 0.017292
550500 -- (-739.154) (-739.470) (-741.808) [-738.641] * (-739.896) (-738.615) (-740.747) [-737.590] -- 0:00:24
551000 -- (-738.865) (-739.412) [-738.011] (-738.619) * (-738.616) (-737.150) [-739.523] (-738.984) -- 0:00:24
551500 -- [-737.623] (-741.545) (-740.179) (-738.916) * [-739.005] (-739.034) (-740.154) (-741.440) -- 0:00:24
552000 -- (-739.200) (-740.225) (-740.221) [-737.758] * (-741.655) [-740.834] (-737.247) (-739.360) -- 0:00:24
552500 -- (-739.893) [-738.185] (-739.783) (-738.572) * (-741.337) (-738.448) (-737.206) [-739.127] -- 0:00:24
553000 -- [-739.393] (-738.218) (-741.756) (-740.939) * (-745.952) (-737.126) (-737.977) [-740.570] -- 0:00:24
553500 -- (-738.219) [-737.318] (-740.056) (-737.455) * (-741.275) (-744.194) (-739.688) [-738.142] -- 0:00:24
554000 -- [-737.840] (-738.005) (-743.800) (-740.117) * [-741.774] (-740.560) (-739.400) (-738.728) -- 0:00:24
554500 -- [-739.068] (-737.699) (-740.083) (-738.810) * (-744.550) (-739.935) [-737.870] (-738.469) -- 0:00:24
555000 -- (-744.142) (-739.951) (-739.519) [-739.589] * (-742.145) (-742.620) (-737.806) [-737.676] -- 0:00:24
Average standard deviation of split frequencies: 0.016957
555500 -- (-738.140) [-741.561] (-746.793) (-738.820) * [-739.682] (-747.282) (-737.958) (-738.230) -- 0:00:24
556000 -- (-739.376) [-739.154] (-743.061) (-738.072) * [-738.613] (-740.650) (-737.848) (-741.049) -- 0:00:23
556500 -- (-739.322) (-738.654) (-738.628) [-739.904] * [-739.394] (-739.997) (-739.913) (-739.200) -- 0:00:23
557000 -- (-739.818) (-743.887) [-738.070] (-741.139) * [-737.234] (-742.599) (-741.291) (-741.462) -- 0:00:23
557500 -- (-738.585) (-743.958) [-738.953] (-742.265) * (-739.000) (-745.052) [-738.694] (-742.986) -- 0:00:23
558000 -- (-738.325) (-738.101) [-738.024] (-739.031) * (-740.178) [-741.963] (-739.151) (-737.697) -- 0:00:24
558500 -- (-738.109) (-739.279) (-737.015) [-743.378] * (-741.574) (-743.733) (-742.285) [-740.082] -- 0:00:24
559000 -- (-739.777) (-737.457) (-740.046) [-741.655] * (-741.114) (-742.316) (-747.289) [-739.531] -- 0:00:24
559500 -- (-738.191) (-740.493) [-738.370] (-743.984) * (-738.234) (-739.097) [-740.050] (-737.217) -- 0:00:24
560000 -- (-745.926) (-740.151) (-742.098) [-740.026] * (-737.619) (-737.674) (-748.222) [-737.967] -- 0:00:24
Average standard deviation of split frequencies: 0.015807
560500 -- [-737.757] (-743.145) (-737.304) (-738.822) * (-738.256) (-740.481) [-743.411] (-737.220) -- 0:00:24
561000 -- (-742.616) [-738.579] (-737.244) (-741.685) * (-740.851) (-738.832) [-740.032] (-741.475) -- 0:00:24
561500 -- (-738.950) [-737.589] (-737.669) (-739.489) * (-736.986) [-738.054] (-738.416) (-737.776) -- 0:00:24
562000 -- (-739.149) (-738.457) (-739.122) [-740.404] * (-738.377) [-737.821] (-741.818) (-740.083) -- 0:00:24
562500 -- [-737.549] (-739.270) (-740.040) (-737.642) * [-737.985] (-738.379) (-739.390) (-740.282) -- 0:00:24
563000 -- (-738.954) (-743.377) (-740.155) [-739.430] * [-738.054] (-737.114) (-739.942) (-738.272) -- 0:00:24
563500 -- [-739.187] (-739.656) (-746.080) (-744.195) * [-738.570] (-743.269) (-740.447) (-745.965) -- 0:00:24
564000 -- [-739.792] (-740.742) (-737.509) (-739.514) * (-740.723) (-739.710) (-743.905) [-741.544] -- 0:00:23
564500 -- (-738.188) (-740.416) (-740.608) [-741.305] * [-740.747] (-741.599) (-738.983) (-740.537) -- 0:00:23
565000 -- (-741.155) (-741.422) [-739.430] (-738.164) * (-737.669) [-739.080] (-740.193) (-739.569) -- 0:00:23
Average standard deviation of split frequencies: 0.015991
565500 -- [-738.570] (-739.814) (-746.325) (-739.698) * (-737.994) (-739.441) (-739.565) [-741.315] -- 0:00:23
566000 -- (-744.124) (-741.215) (-743.024) [-740.520] * (-737.906) (-737.693) [-741.850] (-738.964) -- 0:00:23
566500 -- (-739.104) [-739.077] (-737.764) (-739.539) * [-737.375] (-739.634) (-740.605) (-745.507) -- 0:00:23
567000 -- (-737.877) [-741.411] (-739.632) (-738.612) * [-740.066] (-738.958) (-740.802) (-740.237) -- 0:00:23
567500 -- [-738.104] (-743.865) (-739.764) (-737.912) * (-739.179) [-741.068] (-739.407) (-742.601) -- 0:00:23
568000 -- (-740.068) [-739.495] (-741.095) (-738.880) * [-737.202] (-739.904) (-741.762) (-743.431) -- 0:00:23
568500 -- (-741.875) (-738.111) (-741.042) [-740.212] * (-738.733) (-740.522) (-739.662) [-739.138] -- 0:00:23
569000 -- (-736.830) [-738.069] (-741.206) (-739.680) * [-738.697] (-741.429) (-740.435) (-741.524) -- 0:00:23
569500 -- (-738.677) (-737.179) [-742.249] (-739.347) * (-737.849) (-738.180) [-737.155] (-738.109) -- 0:00:23
570000 -- [-739.027] (-739.316) (-737.177) (-738.500) * (-739.551) (-739.693) (-739.758) [-739.623] -- 0:00:23
Average standard deviation of split frequencies: 0.015695
570500 -- (-737.536) (-737.425) (-738.223) [-738.435] * (-738.555) (-740.328) [-737.317] (-737.981) -- 0:00:23
571000 -- (-740.043) (-738.494) [-738.312] (-737.955) * (-738.610) (-738.740) (-738.755) [-737.998] -- 0:00:23
571500 -- (-737.348) (-741.334) [-737.909] (-738.257) * (-739.107) (-738.548) [-737.438] (-739.462) -- 0:00:23
572000 -- [-740.314] (-737.895) (-737.209) (-738.302) * [-740.413] (-743.821) (-740.635) (-738.935) -- 0:00:23
572500 -- (-740.949) (-743.831) (-737.130) [-739.566] * (-741.809) [-740.428] (-740.249) (-739.276) -- 0:00:23
573000 -- (-738.385) (-741.146) [-742.138] (-739.433) * (-737.307) (-740.150) [-739.821] (-739.054) -- 0:00:23
573500 -- (-738.171) (-739.944) [-739.934] (-738.242) * (-740.335) (-738.589) [-739.950] (-743.951) -- 0:00:23
574000 -- (-739.243) (-738.392) (-738.224) [-737.651] * (-747.399) (-740.068) (-743.387) [-740.997] -- 0:00:23
574500 -- (-742.531) (-737.569) [-739.467] (-744.334) * [-740.334] (-737.280) (-737.627) (-738.385) -- 0:00:22
575000 -- (-739.481) [-738.504] (-737.942) (-740.985) * (-740.353) (-737.603) [-738.057] (-740.205) -- 0:00:22
Average standard deviation of split frequencies: 0.015386
575500 -- [-739.897] (-738.818) (-739.247) (-739.274) * (-737.365) (-739.514) [-738.324] (-737.620) -- 0:00:22
576000 -- (-741.307) (-738.086) [-738.079] (-738.412) * [-737.073] (-743.110) (-737.454) (-738.196) -- 0:00:22
576500 -- (-739.344) (-738.028) (-739.271) [-738.065] * [-737.592] (-739.449) (-740.157) (-738.266) -- 0:00:23
577000 -- (-741.667) [-737.250] (-738.714) (-739.140) * (-741.894) [-739.295] (-739.546) (-740.447) -- 0:00:23
577500 -- (-740.799) (-740.138) [-737.544] (-741.707) * (-743.209) [-737.591] (-741.695) (-742.778) -- 0:00:23
578000 -- (-738.924) (-740.702) [-737.504] (-738.792) * [-742.056] (-737.888) (-741.028) (-738.022) -- 0:00:23
578500 -- (-739.903) (-740.501) (-740.099) [-737.696] * (-739.098) (-739.602) (-739.043) [-737.730] -- 0:00:23
579000 -- (-739.413) (-737.887) [-740.674] (-739.473) * [-739.306] (-740.380) (-742.369) (-739.730) -- 0:00:23
579500 -- (-739.374) [-739.274] (-738.825) (-739.395) * [-739.227] (-742.673) (-739.099) (-738.849) -- 0:00:23
580000 -- [-740.725] (-739.825) (-739.839) (-738.721) * (-738.783) (-739.047) [-738.878] (-738.112) -- 0:00:23
Average standard deviation of split frequencies: 0.015262
580500 -- (-738.705) [-740.350] (-743.286) (-743.023) * (-738.739) [-739.773] (-737.018) (-741.313) -- 0:00:23
581000 -- (-737.188) (-740.470) (-737.788) [-741.511] * [-740.765] (-739.744) (-739.755) (-739.382) -- 0:00:23
581500 -- (-739.791) (-740.723) (-738.107) [-742.111] * [-740.748] (-738.923) (-740.598) (-740.540) -- 0:00:23
582000 -- [-742.945] (-741.609) (-740.691) (-738.734) * (-743.467) [-739.615] (-739.168) (-743.545) -- 0:00:22
582500 -- (-737.193) (-737.560) (-739.029) [-737.544] * [-737.944] (-737.396) (-741.779) (-740.541) -- 0:00:22
583000 -- (-737.759) (-738.351) [-741.307] (-737.621) * (-739.598) (-739.866) [-743.442] (-739.701) -- 0:00:22
583500 -- (-738.100) (-742.964) (-742.683) [-738.153] * (-738.357) (-740.857) [-739.177] (-741.267) -- 0:00:22
584000 -- (-737.586) (-738.195) [-741.081] (-737.691) * (-738.329) [-738.264] (-738.207) (-739.221) -- 0:00:22
584500 -- (-740.856) (-739.103) [-738.108] (-740.036) * (-737.486) (-737.118) (-737.687) [-737.423] -- 0:00:22
585000 -- [-741.114] (-743.893) (-746.881) (-740.228) * (-737.436) (-738.299) [-738.046] (-737.292) -- 0:00:22
Average standard deviation of split frequencies: 0.015284
585500 -- (-738.680) [-738.018] (-746.438) (-738.321) * (-737.482) (-737.978) (-738.465) [-741.335] -- 0:00:22
586000 -- (-743.922) (-738.659) (-742.790) [-737.425] * (-737.794) (-737.809) (-738.980) [-739.638] -- 0:00:22
586500 -- (-738.870) (-738.763) (-740.682) [-737.371] * (-737.608) (-737.418) [-738.164] (-738.549) -- 0:00:22
587000 -- (-741.777) [-737.818] (-740.664) (-740.962) * (-736.926) (-737.669) (-737.168) [-738.994] -- 0:00:22
587500 -- (-740.143) [-740.845] (-740.044) (-737.987) * [-738.405] (-740.336) (-737.732) (-737.770) -- 0:00:22
588000 -- (-743.273) (-742.971) [-739.872] (-739.076) * [-740.445] (-739.356) (-738.582) (-738.425) -- 0:00:22
588500 -- (-738.975) [-738.119] (-740.391) (-741.627) * [-743.673] (-737.954) (-739.259) (-738.926) -- 0:00:22
589000 -- (-739.092) (-741.617) (-739.551) [-737.799] * [-745.184] (-737.802) (-740.570) (-739.431) -- 0:00:22
589500 -- [-739.995] (-739.979) (-738.257) (-737.729) * (-743.357) (-739.242) [-737.836] (-739.878) -- 0:00:22
590000 -- (-744.217) (-740.414) (-737.772) [-740.596] * (-738.339) [-736.969] (-738.996) (-742.164) -- 0:00:22
Average standard deviation of split frequencies: 0.015802
590500 -- (-737.626) (-739.925) [-737.270] (-739.047) * [-737.963] (-738.858) (-742.106) (-740.511) -- 0:00:22
591000 -- (-742.480) [-740.358] (-738.363) (-739.082) * [-738.418] (-740.282) (-740.308) (-742.066) -- 0:00:22
591500 -- (-739.795) [-741.752] (-737.538) (-737.622) * (-741.503) [-739.783] (-738.301) (-740.582) -- 0:00:22
592000 -- (-740.569) (-741.179) (-740.670) [-737.822] * (-742.829) [-742.777] (-740.721) (-737.300) -- 0:00:22
592500 -- (-738.417) [-739.670] (-738.144) (-739.960) * (-738.394) (-738.674) (-741.851) [-738.436] -- 0:00:22
593000 -- (-738.685) (-738.128) [-743.672] (-739.804) * (-737.936) [-738.740] (-741.193) (-742.362) -- 0:00:21
593500 -- (-739.626) (-742.644) (-740.097) [-739.766] * (-737.466) [-737.522] (-739.361) (-739.947) -- 0:00:21
594000 -- (-739.236) (-738.753) [-741.592] (-739.459) * (-740.131) (-740.473) [-738.724] (-739.528) -- 0:00:21
594500 -- [-738.315] (-739.165) (-739.679) (-737.351) * (-741.704) (-741.668) (-739.794) [-740.755] -- 0:00:21
595000 -- (-738.040) (-740.322) [-740.939] (-744.228) * (-740.912) (-744.790) (-738.994) [-739.461] -- 0:00:22
Average standard deviation of split frequencies: 0.015503
595500 -- (-740.048) (-739.016) (-737.966) [-738.413] * [-737.017] (-743.352) (-739.320) (-737.917) -- 0:00:22
596000 -- (-744.933) (-740.639) (-737.915) [-739.752] * [-737.427] (-744.356) (-738.906) (-739.354) -- 0:00:22
596500 -- [-737.409] (-742.571) (-738.131) (-740.871) * (-738.310) [-740.996] (-742.355) (-746.462) -- 0:00:22
597000 -- (-738.697) [-738.835] (-738.131) (-741.240) * (-737.930) (-741.705) [-740.266] (-738.648) -- 0:00:22
597500 -- (-739.237) [-739.950] (-739.416) (-737.705) * (-738.100) (-742.990) (-739.881) [-740.686] -- 0:00:22
598000 -- (-745.886) [-738.347] (-739.548) (-738.953) * (-739.219) (-740.785) (-744.636) [-738.472] -- 0:00:22
598500 -- (-737.883) [-737.070] (-741.778) (-737.917) * (-742.008) (-741.177) [-737.371] (-742.380) -- 0:00:22
599000 -- [-737.944] (-740.284) (-740.759) (-740.359) * (-739.979) (-738.690) [-740.319] (-738.440) -- 0:00:22
599500 -- (-738.445) [-740.770] (-743.766) (-738.046) * (-739.773) (-740.571) (-742.913) [-737.531] -- 0:00:22
600000 -- [-738.247] (-738.458) (-739.799) (-739.388) * (-741.953) (-739.026) (-741.862) [-737.520] -- 0:00:22
Average standard deviation of split frequencies: 0.014440
600500 -- (-742.055) (-738.601) [-741.592] (-741.498) * (-739.991) [-743.618] (-738.435) (-738.448) -- 0:00:21
601000 -- (-740.011) (-738.780) (-737.542) [-746.697] * (-739.763) (-738.008) (-742.264) [-738.690] -- 0:00:21
601500 -- (-745.182) [-737.674] (-739.597) (-737.558) * (-738.278) (-743.753) (-739.628) [-737.132] -- 0:00:21
602000 -- [-738.266] (-739.045) (-739.168) (-740.459) * (-737.234) (-740.226) (-740.367) [-738.341] -- 0:00:21
602500 -- (-739.093) [-739.391] (-740.994) (-740.276) * (-738.140) (-737.452) (-740.740) [-740.385] -- 0:00:21
603000 -- [-738.665] (-739.372) (-742.033) (-740.187) * [-739.637] (-738.685) (-740.812) (-741.452) -- 0:00:21
603500 -- [-739.717] (-740.498) (-740.785) (-740.178) * (-738.457) (-740.354) [-737.708] (-739.626) -- 0:00:21
604000 -- (-740.364) [-740.813] (-744.196) (-737.719) * [-739.524] (-741.163) (-737.894) (-740.722) -- 0:00:21
604500 -- [-741.527] (-737.516) (-739.760) (-738.063) * [-740.009] (-741.000) (-739.258) (-741.048) -- 0:00:21
605000 -- (-740.287) (-738.785) (-737.748) [-741.170] * (-748.415) (-739.693) [-737.467] (-738.825) -- 0:00:21
Average standard deviation of split frequencies: 0.014002
605500 -- (-739.244) (-740.684) (-740.985) [-748.039] * [-737.612] (-738.583) (-738.315) (-740.411) -- 0:00:21
606000 -- (-737.271) (-739.127) [-741.234] (-748.713) * (-739.970) [-737.304] (-740.675) (-738.016) -- 0:00:21
606500 -- (-737.679) (-741.251) [-738.959] (-744.776) * (-739.641) [-737.617] (-740.230) (-738.242) -- 0:00:21
607000 -- [-739.421] (-740.418) (-737.512) (-737.748) * (-739.236) (-738.687) (-738.165) [-744.519] -- 0:00:21
607500 -- (-741.055) (-741.087) [-738.612] (-737.982) * (-740.343) (-740.835) [-738.956] (-738.420) -- 0:00:21
608000 -- (-740.626) (-737.799) (-740.490) [-738.199] * [-737.978] (-739.740) (-739.435) (-740.116) -- 0:00:21
608500 -- (-739.990) [-740.038] (-741.217) (-738.502) * (-738.619) [-739.428] (-737.638) (-738.413) -- 0:00:21
609000 -- (-738.305) [-738.271] (-739.075) (-739.535) * (-738.006) (-740.848) (-737.553) [-737.325] -- 0:00:21
609500 -- (-740.849) [-739.196] (-739.197) (-737.142) * (-737.407) [-738.518] (-739.339) (-740.543) -- 0:00:21
610000 -- (-739.781) [-738.844] (-740.280) (-737.915) * [-739.925] (-737.573) (-740.016) (-741.420) -- 0:00:21
Average standard deviation of split frequencies: 0.014204
610500 -- (-740.572) (-740.804) [-740.557] (-739.023) * (-738.820) (-737.925) [-737.664] (-738.799) -- 0:00:21
611000 -- (-737.819) (-737.328) [-741.764] (-740.190) * [-739.807] (-737.608) (-742.185) (-742.565) -- 0:00:21
611500 -- (-737.886) [-737.007] (-740.696) (-740.038) * [-739.612] (-740.275) (-737.807) (-741.356) -- 0:00:20
612000 -- (-740.441) (-737.142) [-740.897] (-740.565) * (-738.353) [-738.107] (-741.034) (-739.622) -- 0:00:20
612500 -- (-742.797) (-737.071) (-739.700) [-742.451] * (-738.455) (-738.436) (-741.293) [-741.238] -- 0:00:20
613000 -- (-739.465) (-737.928) [-741.717] (-738.785) * (-739.308) [-737.378] (-740.275) (-741.301) -- 0:00:20
613500 -- [-740.187] (-739.868) (-741.871) (-739.778) * (-738.887) (-741.827) [-739.628] (-738.905) -- 0:00:21
614000 -- (-738.384) (-742.358) [-740.649] (-738.572) * (-738.835) [-738.174] (-740.892) (-738.376) -- 0:00:21
614500 -- (-737.884) (-738.745) (-740.243) [-740.430] * (-739.241) (-737.316) [-739.171] (-740.564) -- 0:00:21
615000 -- (-738.945) [-737.899] (-743.543) (-739.414) * [-739.473] (-737.789) (-740.397) (-740.864) -- 0:00:21
Average standard deviation of split frequencies: 0.013622
615500 -- (-740.672) (-739.537) (-742.859) [-737.659] * (-740.404) [-737.619] (-737.691) (-739.092) -- 0:00:21
616000 -- (-739.209) (-740.222) [-738.837] (-740.437) * [-738.804] (-739.156) (-737.829) (-740.023) -- 0:00:21
616500 -- (-738.226) [-740.420] (-740.201) (-739.755) * (-739.076) (-738.689) (-737.641) [-737.942] -- 0:00:21
617000 -- (-737.346) [-739.757] (-738.906) (-740.534) * [-742.214] (-740.355) (-738.593) (-739.223) -- 0:00:21
617500 -- [-737.369] (-737.578) (-741.259) (-738.306) * (-741.922) (-738.797) (-738.085) [-738.022] -- 0:00:21
618000 -- (-742.861) [-738.353] (-738.937) (-738.141) * (-740.871) [-738.267] (-738.519) (-741.955) -- 0:00:21
618500 -- [-741.348] (-744.391) (-738.521) (-738.483) * (-739.196) (-737.603) (-742.587) [-737.312] -- 0:00:20
619000 -- [-739.546] (-737.607) (-739.430) (-739.621) * [-737.380] (-739.873) (-741.144) (-741.991) -- 0:00:20
619500 -- (-742.318) [-738.330] (-742.242) (-741.514) * (-739.240) (-738.746) [-737.784] (-738.559) -- 0:00:20
620000 -- (-738.029) [-737.891] (-739.970) (-740.553) * (-738.683) (-738.668) (-739.734) [-738.809] -- 0:00:20
Average standard deviation of split frequencies: 0.012760
620500 -- (-738.661) (-737.483) [-740.305] (-739.759) * (-740.380) (-741.022) [-745.961] (-741.187) -- 0:00:20
621000 -- (-739.047) (-738.793) (-737.890) [-740.890] * (-742.883) [-740.333] (-742.235) (-739.844) -- 0:00:20
621500 -- (-739.306) (-741.634) (-739.916) [-737.083] * (-740.341) [-740.236] (-742.544) (-737.942) -- 0:00:20
622000 -- (-741.242) (-740.646) (-742.770) [-740.404] * (-739.390) [-740.971] (-743.847) (-738.169) -- 0:00:20
622500 -- (-738.278) [-740.185] (-739.070) (-738.817) * (-739.393) [-741.478] (-737.756) (-740.249) -- 0:00:20
623000 -- [-738.695] (-740.985) (-737.981) (-737.613) * (-737.362) (-743.318) (-740.111) [-738.575] -- 0:00:20
623500 -- [-742.497] (-738.898) (-738.494) (-739.034) * (-743.247) (-738.932) [-738.851] (-738.307) -- 0:00:20
624000 -- (-738.679) (-740.019) [-740.960] (-737.199) * [-740.325] (-743.057) (-739.582) (-741.626) -- 0:00:20
624500 -- [-742.195] (-740.797) (-741.320) (-738.289) * (-739.169) (-740.125) (-739.229) [-738.040] -- 0:00:20
625000 -- (-738.689) (-740.938) [-738.195] (-739.051) * (-739.654) [-742.758] (-740.579) (-738.415) -- 0:00:20
Average standard deviation of split frequencies: 0.012952
625500 -- (-740.083) (-740.044) (-738.766) [-739.051] * (-742.555) (-742.599) [-738.854] (-739.450) -- 0:00:20
626000 -- [-739.881] (-741.176) (-739.583) (-745.690) * (-738.501) [-741.856] (-737.677) (-737.708) -- 0:00:20
626500 -- (-740.041) (-738.400) [-737.694] (-739.006) * (-739.180) (-741.709) [-738.348] (-738.517) -- 0:00:20
627000 -- (-743.614) (-738.816) [-737.808] (-739.734) * (-738.440) (-742.193) (-737.245) [-739.372] -- 0:00:20
627500 -- (-742.822) (-738.736) [-738.803] (-739.082) * (-740.763) (-742.111) [-738.595] (-737.974) -- 0:00:20
628000 -- (-741.160) (-738.919) (-736.925) [-738.467] * [-739.620] (-740.633) (-739.151) (-738.283) -- 0:00:20
628500 -- [-741.175] (-739.111) (-737.537) (-738.846) * (-740.710) (-740.613) [-737.726] (-746.646) -- 0:00:20
629000 -- (-742.070) (-737.840) [-741.951] (-737.991) * (-741.185) (-738.946) [-738.425] (-738.871) -- 0:00:20
629500 -- [-737.782] (-736.916) (-739.777) (-738.537) * [-740.656] (-742.657) (-741.717) (-742.406) -- 0:00:20
630000 -- (-737.835) (-742.951) (-739.727) [-738.894] * (-738.984) (-743.939) (-737.070) [-745.244] -- 0:00:19
Average standard deviation of split frequencies: 0.013305
630500 -- [-738.650] (-741.549) (-740.532) (-739.942) * (-737.882) (-738.864) [-739.399] (-741.775) -- 0:00:19
631000 -- [-737.687] (-742.044) (-740.690) (-739.065) * (-739.398) [-739.419] (-740.372) (-739.809) -- 0:00:19
631500 -- [-737.008] (-739.585) (-740.972) (-738.603) * (-738.721) (-738.441) [-738.727] (-737.342) -- 0:00:19
632000 -- (-738.722) (-738.804) [-743.536] (-738.906) * (-737.161) (-738.966) [-738.185] (-739.556) -- 0:00:20
632500 -- [-740.133] (-737.847) (-739.127) (-745.989) * (-739.358) (-739.389) (-739.751) [-741.616] -- 0:00:20
633000 -- (-738.415) [-739.865] (-737.935) (-742.602) * (-741.158) [-741.930] (-737.650) (-740.504) -- 0:00:20
633500 -- (-738.738) [-738.476] (-739.858) (-738.178) * (-740.733) (-740.474) [-738.349] (-741.408) -- 0:00:20
634000 -- (-741.016) (-741.317) [-742.105] (-740.472) * (-739.491) (-741.908) (-737.155) [-739.460] -- 0:00:20
634500 -- (-740.986) [-740.802] (-738.893) (-740.217) * (-739.845) (-737.635) [-737.823] (-738.888) -- 0:00:20
635000 -- (-738.449) (-742.582) [-742.075] (-737.320) * (-741.014) (-744.836) (-737.311) [-737.544] -- 0:00:20
Average standard deviation of split frequencies: 0.013193
635500 -- [-738.266] (-739.572) (-738.689) (-738.665) * [-738.220] (-737.988) (-741.976) (-739.575) -- 0:00:20
636000 -- (-738.103) (-744.097) [-737.780] (-737.993) * (-749.829) (-739.211) (-738.210) [-737.763] -- 0:00:20
636500 -- [-739.511] (-742.398) (-737.256) (-751.659) * (-742.905) (-738.288) [-739.213] (-738.089) -- 0:00:19
637000 -- [-739.154] (-739.907) (-739.307) (-743.130) * (-737.897) (-739.613) [-739.085] (-739.424) -- 0:00:19
637500 -- (-741.179) (-738.555) (-740.315) [-740.935] * (-742.474) (-738.660) (-739.736) [-737.336] -- 0:00:19
638000 -- (-738.154) (-741.897) (-741.484) [-742.284] * (-737.903) (-740.552) [-738.805] (-739.704) -- 0:00:19
638500 -- [-739.946] (-739.446) (-739.706) (-740.371) * (-739.318) [-741.933] (-738.376) (-740.224) -- 0:00:19
639000 -- (-743.568) (-739.033) (-741.187) [-738.299] * (-738.856) (-741.142) [-737.241] (-737.528) -- 0:00:19
639500 -- [-737.746] (-742.961) (-741.202) (-738.937) * (-739.899) (-739.463) (-740.154) [-737.836] -- 0:00:19
640000 -- (-738.446) (-740.799) (-742.745) [-740.910] * (-742.256) (-741.973) [-741.178] (-747.572) -- 0:00:19
Average standard deviation of split frequencies: 0.013686
640500 -- [-741.535] (-737.902) (-740.339) (-738.115) * (-741.006) [-742.873] (-740.119) (-746.466) -- 0:00:19
641000 -- (-739.013) (-741.352) (-745.115) [-738.858] * (-741.619) [-737.212] (-739.387) (-739.657) -- 0:00:19
641500 -- (-739.128) (-737.762) [-737.296] (-739.478) * (-740.380) (-739.749) [-739.998] (-738.445) -- 0:00:19
642000 -- (-739.576) [-738.889] (-737.616) (-738.520) * [-738.418] (-741.334) (-740.126) (-738.497) -- 0:00:19
642500 -- (-739.124) [-738.804] (-738.421) (-739.825) * (-741.735) (-737.865) (-738.797) [-738.612] -- 0:00:19
643000 -- [-739.141] (-737.993) (-740.110) (-743.996) * (-741.105) [-738.661] (-741.944) (-738.158) -- 0:00:19
643500 -- (-739.975) (-739.331) [-740.432] (-740.010) * (-740.545) [-739.569] (-738.745) (-738.415) -- 0:00:19
644000 -- [-740.648] (-739.922) (-737.989) (-741.154) * (-739.622) (-738.225) [-743.309] (-736.860) -- 0:00:19
644500 -- (-740.499) (-740.816) [-739.000] (-737.666) * (-738.842) [-738.896] (-741.938) (-739.191) -- 0:00:19
645000 -- (-738.665) (-737.506) [-741.265] (-740.447) * [-738.581] (-738.875) (-738.416) (-737.330) -- 0:00:19
Average standard deviation of split frequencies: 0.014303
645500 -- (-740.564) [-739.628] (-738.511) (-737.085) * [-737.085] (-743.958) (-738.561) (-738.012) -- 0:00:19
646000 -- (-740.804) (-737.435) [-739.393] (-737.408) * (-737.119) [-739.985] (-737.793) (-746.030) -- 0:00:19
646500 -- (-741.988) [-737.541] (-738.259) (-737.942) * (-738.108) (-740.478) [-737.486] (-739.273) -- 0:00:19
647000 -- (-740.451) (-738.757) [-738.520] (-738.738) * (-738.275) (-742.110) (-741.902) [-739.977] -- 0:00:19
647500 -- (-739.426) (-738.537) [-737.898] (-737.957) * (-737.821) (-741.810) (-737.790) [-738.590] -- 0:00:19
648000 -- [-738.445] (-738.975) (-737.580) (-737.413) * (-739.561) (-741.227) (-737.896) [-739.435] -- 0:00:19
648500 -- (-738.624) (-739.773) (-742.240) [-738.366] * (-738.421) [-741.257] (-737.230) (-740.917) -- 0:00:18
649000 -- (-738.341) (-742.503) (-739.612) [-739.680] * (-739.392) (-739.766) (-738.163) [-741.199] -- 0:00:18
649500 -- (-739.554) [-747.312] (-743.031) (-743.517) * (-740.658) [-741.442] (-741.018) (-740.674) -- 0:00:18
650000 -- (-737.919) (-738.818) [-738.225] (-746.937) * (-740.415) (-738.647) [-740.964] (-738.428) -- 0:00:18
Average standard deviation of split frequencies: 0.013331
650500 -- (-737.493) [-740.422] (-739.800) (-738.561) * (-740.983) [-739.217] (-737.305) (-738.969) -- 0:00:19
651000 -- (-737.014) [-739.809] (-739.224) (-737.838) * (-740.169) [-741.156] (-742.011) (-738.359) -- 0:00:19
651500 -- [-744.227] (-740.574) (-740.890) (-737.860) * [-737.228] (-749.154) (-739.557) (-743.613) -- 0:00:19
652000 -- (-739.755) [-738.106] (-740.567) (-741.728) * (-738.437) (-742.576) [-738.832] (-737.592) -- 0:00:19
652500 -- [-742.765] (-739.068) (-738.757) (-740.629) * (-740.418) (-741.591) (-741.631) [-737.582] -- 0:00:19
653000 -- (-741.910) [-738.765] (-737.716) (-740.482) * (-737.741) (-740.006) [-738.290] (-738.090) -- 0:00:19
653500 -- (-741.143) (-738.574) (-739.257) [-737.819] * (-737.986) [-737.559] (-739.610) (-738.306) -- 0:00:19
654000 -- [-739.479] (-738.653) (-738.780) (-740.909) * (-743.728) (-737.625) [-740.771] (-738.000) -- 0:00:19
654500 -- [-739.891] (-737.545) (-739.950) (-738.031) * (-740.181) [-739.465] (-738.744) (-738.718) -- 0:00:19
655000 -- (-739.980) [-740.859] (-740.808) (-738.144) * [-744.496] (-738.084) (-738.043) (-742.002) -- 0:00:18
Average standard deviation of split frequencies: 0.012935
655500 -- [-740.775] (-738.608) (-740.630) (-738.459) * (-741.909) (-742.396) (-741.054) [-738.226] -- 0:00:18
656000 -- [-738.859] (-739.585) (-738.424) (-739.857) * [-741.176] (-738.752) (-741.299) (-738.795) -- 0:00:18
656500 -- (-741.163) [-739.459] (-741.653) (-737.218) * [-740.834] (-740.694) (-738.828) (-741.411) -- 0:00:18
657000 -- [-740.156] (-739.723) (-739.113) (-741.307) * (-739.643) (-742.344) [-741.297] (-742.231) -- 0:00:18
657500 -- [-738.761] (-737.973) (-740.938) (-738.254) * (-737.825) (-738.165) (-739.994) [-739.030] -- 0:00:18
658000 -- (-738.627) (-740.790) (-744.020) [-738.371] * (-740.731) [-737.223] (-741.249) (-736.972) -- 0:00:18
658500 -- (-740.454) [-740.713] (-748.153) (-740.546) * (-738.664) [-737.517] (-738.053) (-739.606) -- 0:00:18
659000 -- (-740.023) (-739.016) (-738.454) [-739.979] * (-738.794) (-737.899) (-739.686) [-740.948] -- 0:00:18
659500 -- (-740.661) (-738.421) [-738.341] (-739.362) * (-738.760) [-737.390] (-738.961) (-742.831) -- 0:00:18
660000 -- (-738.004) (-740.549) [-738.989] (-738.205) * (-740.360) [-738.018] (-737.742) (-741.454) -- 0:00:18
Average standard deviation of split frequencies: 0.013557
660500 -- (-739.097) (-740.600) [-738.941] (-737.221) * (-737.951) (-741.211) [-738.074] (-739.221) -- 0:00:18
661000 -- (-737.711) (-738.204) [-738.515] (-737.910) * (-737.865) [-737.128] (-737.648) (-737.762) -- 0:00:18
661500 -- (-738.885) [-740.511] (-737.693) (-740.993) * (-738.314) [-739.466] (-740.348) (-737.828) -- 0:00:18
662000 -- (-738.607) (-739.563) (-738.474) [-738.181] * (-738.745) [-740.614] (-738.060) (-739.967) -- 0:00:18
662500 -- (-739.236) (-737.853) [-740.020] (-739.171) * (-738.007) (-743.704) [-738.855] (-740.192) -- 0:00:18
663000 -- (-739.171) (-739.403) (-737.078) [-738.626] * (-739.917) (-743.128) [-738.642] (-738.907) -- 0:00:18
663500 -- (-738.457) (-738.728) (-737.748) [-737.513] * [-738.847] (-738.156) (-737.854) (-736.903) -- 0:00:18
664000 -- (-738.508) (-737.401) [-737.491] (-740.224) * (-738.393) (-739.259) (-739.042) [-737.684] -- 0:00:18
664500 -- (-739.100) (-738.736) (-737.391) [-741.604] * [-740.484] (-739.317) (-738.424) (-740.794) -- 0:00:18
665000 -- (-738.643) (-737.864) (-740.951) [-738.664] * (-739.284) (-742.051) (-741.315) [-740.188] -- 0:00:18
Average standard deviation of split frequencies: 0.013165
665500 -- (-738.160) (-740.580) (-739.883) [-737.745] * (-741.182) (-738.264) (-740.603) [-737.101] -- 0:00:18
666000 -- (-739.361) [-738.898] (-740.176) (-739.155) * [-738.815] (-739.213) (-737.712) (-740.533) -- 0:00:18
666500 -- (-737.926) (-741.199) (-740.340) [-740.550] * (-741.437) (-739.054) (-741.598) [-739.087] -- 0:00:18
667000 -- (-738.091) [-739.009] (-742.479) (-743.188) * (-738.717) [-738.356] (-737.924) (-738.871) -- 0:00:17
667500 -- (-738.346) (-739.290) (-739.372) [-737.267] * (-740.236) (-740.575) (-742.404) [-738.137] -- 0:00:17
668000 -- (-738.496) (-741.040) [-737.942] (-737.811) * (-737.691) (-739.906) (-740.578) [-742.918] -- 0:00:17
668500 -- (-739.926) [-739.804] (-741.579) (-737.553) * [-737.635] (-741.667) (-740.657) (-741.545) -- 0:00:17
669000 -- (-741.296) (-742.202) (-741.609) [-737.818] * (-737.786) [-739.153] (-738.370) (-740.767) -- 0:00:18
669500 -- (-739.513) (-738.132) (-737.722) [-737.712] * (-738.736) [-740.123] (-738.938) (-742.060) -- 0:00:18
670000 -- [-738.396] (-738.639) (-738.706) (-739.506) * [-739.034] (-740.491) (-741.072) (-740.709) -- 0:00:18
Average standard deviation of split frequencies: 0.013917
670500 -- (-741.032) [-738.021] (-738.326) (-739.301) * (-739.777) (-743.419) (-739.111) [-737.363] -- 0:00:18
671000 -- [-740.510] (-739.297) (-741.697) (-740.752) * (-737.449) (-737.582) (-738.539) [-737.777] -- 0:00:18
671500 -- [-743.325] (-739.290) (-737.899) (-739.033) * [-743.636] (-738.152) (-737.938) (-739.852) -- 0:00:18
672000 -- [-742.175] (-740.125) (-739.844) (-737.998) * (-739.319) (-737.200) (-737.283) [-738.502] -- 0:00:18
672500 -- [-740.462] (-740.892) (-738.427) (-739.426) * (-739.169) (-737.337) (-737.922) [-738.460] -- 0:00:18
673000 -- (-742.656) [-742.791] (-738.377) (-740.334) * (-737.288) (-742.871) (-738.888) [-738.214] -- 0:00:17
673500 -- (-743.873) (-737.930) (-740.044) [-738.953] * [-739.411] (-737.890) (-740.705) (-740.511) -- 0:00:17
674000 -- (-743.641) [-739.065] (-739.901) (-737.772) * (-741.098) (-738.995) (-745.002) [-738.378] -- 0:00:17
674500 -- (-741.434) (-740.713) (-741.642) [-737.139] * (-738.663) (-737.926) [-738.719] (-739.123) -- 0:00:17
675000 -- (-742.373) (-737.342) [-737.957] (-738.130) * (-740.414) (-737.178) (-740.027) [-738.210] -- 0:00:17
Average standard deviation of split frequencies: 0.014226
675500 -- [-741.521] (-737.634) (-743.101) (-741.066) * (-742.151) (-737.716) (-739.960) [-739.066] -- 0:00:17
676000 -- (-739.532) (-740.534) [-739.498] (-738.399) * (-743.439) (-738.456) (-739.530) [-737.878] -- 0:00:17
676500 -- (-739.423) (-741.922) [-738.444] (-738.498) * (-741.175) (-739.251) [-737.589] (-738.698) -- 0:00:17
677000 -- (-741.062) (-739.689) (-740.758) [-741.054] * (-740.873) (-740.720) (-739.925) [-738.963] -- 0:00:17
677500 -- (-737.933) [-738.343] (-738.167) (-738.677) * [-739.135] (-740.632) (-738.637) (-738.667) -- 0:00:17
678000 -- [-739.658] (-738.350) (-738.656) (-738.470) * [-739.837] (-739.448) (-739.959) (-738.544) -- 0:00:17
678500 -- (-741.310) (-738.078) [-737.534] (-740.344) * [-739.041] (-743.989) (-738.335) (-738.539) -- 0:00:17
679000 -- (-738.086) (-738.924) (-738.339) [-738.320] * (-742.565) (-739.227) (-739.350) [-737.890] -- 0:00:17
679500 -- (-741.483) (-739.234) [-738.133] (-739.459) * (-737.421) [-738.271] (-739.986) (-739.551) -- 0:00:17
680000 -- [-738.659] (-740.243) (-738.079) (-738.424) * (-740.210) (-738.280) (-739.822) [-739.311] -- 0:00:17
Average standard deviation of split frequencies: 0.013851
680500 -- (-741.127) (-739.462) (-741.141) [-737.845] * (-739.200) (-739.496) (-739.487) [-739.342] -- 0:00:17
681000 -- [-739.147] (-739.266) (-741.239) (-740.029) * (-738.565) (-740.445) (-739.710) [-742.536] -- 0:00:17
681500 -- (-742.574) (-740.613) [-738.856] (-738.689) * (-739.409) [-740.952] (-737.878) (-740.433) -- 0:00:17
682000 -- (-740.391) (-738.757) [-738.115] (-737.697) * (-743.261) (-737.934) (-737.967) [-741.379] -- 0:00:17
682500 -- (-741.524) [-738.877] (-738.724) (-738.256) * (-742.606) [-737.970] (-740.346) (-741.608) -- 0:00:17
683000 -- (-740.089) (-738.448) (-737.305) [-738.494] * [-737.434] (-741.768) (-741.019) (-738.914) -- 0:00:17
683500 -- (-738.790) [-738.813] (-738.840) (-741.002) * [-743.769] (-744.639) (-737.862) (-740.010) -- 0:00:17
684000 -- (-738.470) [-738.642] (-743.601) (-739.479) * (-738.877) [-742.580] (-738.009) (-738.599) -- 0:00:17
684500 -- [-737.954] (-742.162) (-741.496) (-737.688) * [-739.252] (-741.439) (-745.294) (-739.025) -- 0:00:17
685000 -- [-740.020] (-740.283) (-737.011) (-740.991) * (-739.492) (-739.886) (-746.376) [-744.252] -- 0:00:17
Average standard deviation of split frequencies: 0.014018
685500 -- (-746.100) [-738.082] (-741.056) (-741.487) * [-737.623] (-738.992) (-742.041) (-741.335) -- 0:00:16
686000 -- (-740.863) [-741.763] (-740.300) (-742.958) * [-737.867] (-737.022) (-739.445) (-747.794) -- 0:00:16
686500 -- (-738.002) [-739.828] (-739.629) (-739.929) * (-738.729) [-740.918] (-742.690) (-740.298) -- 0:00:16
687000 -- [-737.893] (-737.303) (-737.679) (-737.009) * (-740.618) (-737.981) (-739.146) [-738.447] -- 0:00:16
687500 -- (-738.835) (-737.813) (-738.805) [-738.234] * (-743.879) (-739.997) (-737.338) [-738.846] -- 0:00:16
688000 -- [-740.540] (-739.330) (-739.148) (-737.462) * (-740.443) [-738.675] (-741.350) (-737.529) -- 0:00:17
688500 -- (-740.523) [-738.036] (-738.842) (-739.265) * (-741.659) (-739.594) [-739.705] (-737.731) -- 0:00:17
689000 -- [-737.311] (-739.877) (-738.194) (-738.565) * [-736.917] (-737.951) (-740.070) (-743.392) -- 0:00:17
689500 -- [-737.960] (-738.850) (-737.012) (-743.340) * (-739.557) (-739.004) [-739.078] (-737.830) -- 0:00:17
690000 -- (-740.767) (-739.204) (-743.043) [-738.424] * [-738.281] (-739.648) (-739.652) (-739.890) -- 0:00:17
Average standard deviation of split frequencies: 0.013378
690500 -- (-742.242) (-739.987) (-737.196) [-738.045] * (-740.882) (-739.822) [-739.012] (-743.992) -- 0:00:17
691000 -- (-739.956) [-739.901] (-738.579) (-738.316) * (-739.587) (-740.071) (-738.869) [-737.796] -- 0:00:16
691500 -- [-737.100] (-743.975) (-739.602) (-741.957) * (-738.493) (-740.344) (-739.308) [-738.316] -- 0:00:16
692000 -- (-738.006) [-739.931] (-737.883) (-739.485) * [-737.871] (-742.760) (-737.974) (-739.819) -- 0:00:16
692500 -- (-737.558) [-738.209] (-740.061) (-745.816) * [-737.787] (-743.499) (-737.242) (-737.255) -- 0:00:16
693000 -- (-740.664) (-740.296) (-738.503) [-741.144] * [-739.255] (-738.958) (-740.871) (-737.785) -- 0:00:16
693500 -- [-739.816] (-740.820) (-740.118) (-738.757) * [-737.471] (-738.636) (-741.646) (-737.756) -- 0:00:16
694000 -- (-739.652) [-743.912] (-739.277) (-739.015) * [-736.800] (-741.138) (-738.578) (-738.378) -- 0:00:16
694500 -- (-739.387) (-740.804) [-743.120] (-741.441) * [-738.526] (-737.534) (-738.211) (-739.389) -- 0:00:16
695000 -- (-739.196) (-740.796) [-739.294] (-740.976) * (-740.375) (-739.793) (-739.963) [-739.505] -- 0:00:16
Average standard deviation of split frequencies: 0.013411
695500 -- (-747.465) [-740.269] (-738.044) (-744.457) * (-746.140) [-744.472] (-738.233) (-739.865) -- 0:00:16
696000 -- (-744.216) (-739.056) (-739.325) [-738.668] * (-742.448) (-741.985) [-737.810] (-742.483) -- 0:00:16
696500 -- [-740.508] (-740.953) (-740.781) (-738.730) * (-744.757) [-741.376] (-740.563) (-738.336) -- 0:00:16
697000 -- (-738.822) [-737.756] (-738.813) (-739.478) * (-742.666) [-741.644] (-738.302) (-738.620) -- 0:00:16
697500 -- (-741.214) [-737.551] (-739.497) (-740.976) * [-739.306] (-739.003) (-740.598) (-737.425) -- 0:00:16
698000 -- (-739.379) (-737.469) (-739.802) [-737.494] * (-738.145) [-739.538] (-740.108) (-738.415) -- 0:00:16
698500 -- [-738.575] (-737.331) (-739.069) (-740.921) * (-741.263) (-738.500) [-748.009] (-740.332) -- 0:00:16
699000 -- (-737.397) (-737.764) [-737.836] (-738.472) * (-737.395) (-737.178) [-739.422] (-742.234) -- 0:00:16
699500 -- (-739.240) [-739.754] (-737.875) (-740.015) * (-738.500) (-738.077) (-742.849) [-739.437] -- 0:00:16
700000 -- (-738.477) [-736.948] (-738.000) (-740.679) * (-739.450) [-739.115] (-742.995) (-739.677) -- 0:00:16
Average standard deviation of split frequencies: 0.013052
700500 -- (-739.744) [-737.630] (-738.505) (-743.439) * [-737.502] (-740.683) (-740.762) (-740.912) -- 0:00:16
701000 -- (-738.668) [-738.155] (-738.713) (-739.513) * [-742.803] (-739.349) (-741.401) (-738.739) -- 0:00:16
701500 -- [-739.265] (-737.681) (-738.582) (-739.965) * (-745.152) (-740.436) (-738.012) [-738.769] -- 0:00:16
702000 -- (-740.240) [-737.404] (-743.642) (-737.342) * (-739.489) (-740.397) (-742.806) [-737.223] -- 0:00:16
702500 -- (-737.469) (-738.010) (-739.663) [-739.449] * [-741.004] (-742.406) (-741.974) (-738.719) -- 0:00:16
703000 -- (-739.606) (-738.066) [-738.352] (-740.423) * (-737.444) (-739.808) (-746.788) [-741.842] -- 0:00:16
703500 -- (-741.203) (-737.671) (-740.382) [-743.364] * (-739.842) (-740.579) [-741.175] (-740.969) -- 0:00:16
704000 -- (-737.055) [-739.222] (-738.987) (-739.243) * (-739.540) (-745.162) [-739.668] (-741.207) -- 0:00:15
704500 -- [-739.699] (-738.979) (-737.597) (-741.516) * (-740.291) (-739.274) [-736.999] (-741.513) -- 0:00:15
705000 -- (-745.882) [-740.075] (-739.425) (-738.892) * (-739.749) (-742.937) (-740.678) [-737.423] -- 0:00:15
Average standard deviation of split frequencies: 0.013354
705500 -- (-745.076) (-737.710) [-739.839] (-739.477) * (-740.814) [-738.672] (-738.774) (-739.274) -- 0:00:15
706000 -- (-745.456) (-738.568) (-737.629) [-738.224] * [-740.406] (-741.292) (-739.402) (-743.730) -- 0:00:15
706500 -- (-737.513) [-738.045] (-737.239) (-737.614) * (-737.472) (-742.958) (-739.091) [-737.966] -- 0:00:16
707000 -- (-739.532) [-740.148] (-737.568) (-742.448) * (-737.574) (-742.211) [-739.090] (-740.056) -- 0:00:16
707500 -- [-738.413] (-738.703) (-740.728) (-739.159) * [-739.532] (-737.933) (-738.433) (-740.921) -- 0:00:16
708000 -- (-738.265) [-739.494] (-741.678) (-743.196) * (-738.043) [-738.919] (-737.220) (-743.214) -- 0:00:16
708500 -- [-742.564] (-748.098) (-740.318) (-741.571) * (-740.262) [-740.641] (-738.897) (-740.709) -- 0:00:16
709000 -- (-741.983) (-745.377) [-743.036] (-740.492) * (-740.460) [-739.146] (-742.480) (-741.475) -- 0:00:16
709500 -- (-740.510) (-743.290) (-738.217) [-738.295] * [-738.903] (-739.321) (-739.377) (-741.469) -- 0:00:15
710000 -- (-738.334) (-741.982) [-738.582] (-738.130) * (-739.812) (-740.699) [-739.883] (-740.341) -- 0:00:15
Average standard deviation of split frequencies: 0.012869
710500 -- (-738.743) (-742.816) [-740.159] (-738.193) * (-737.204) (-741.830) [-740.728] (-739.259) -- 0:00:15
711000 -- [-738.044] (-740.573) (-738.024) (-738.807) * (-737.400) [-738.344] (-740.951) (-737.479) -- 0:00:15
711500 -- (-738.964) (-738.371) (-737.899) [-740.171] * (-737.722) (-737.592) (-740.054) [-739.313] -- 0:00:15
712000 -- (-739.346) (-739.605) [-738.033] (-736.912) * (-738.318) [-738.728] (-737.543) (-738.646) -- 0:00:15
712500 -- [-740.034] (-742.078) (-738.230) (-737.191) * (-740.124) (-738.834) [-741.572] (-743.202) -- 0:00:15
713000 -- (-740.449) (-744.132) (-738.787) [-740.421] * (-742.192) (-741.790) (-738.249) [-739.071] -- 0:00:15
713500 -- (-740.499) (-744.218) [-739.847] (-739.660) * (-739.319) (-740.713) [-738.066] (-737.775) -- 0:00:15
714000 -- (-741.941) (-737.923) (-738.481) [-739.948] * (-739.989) [-739.314] (-738.438) (-740.794) -- 0:00:15
714500 -- (-741.981) [-740.838] (-737.587) (-739.794) * (-739.205) (-740.363) (-738.936) [-737.617] -- 0:00:15
715000 -- (-737.043) [-740.179] (-737.268) (-740.247) * (-737.844) (-741.262) (-737.950) [-740.617] -- 0:00:15
Average standard deviation of split frequencies: 0.012904
715500 -- (-739.466) (-742.676) (-739.519) [-737.918] * (-737.639) (-738.831) [-738.820] (-738.637) -- 0:00:15
716000 -- [-739.876] (-740.153) (-737.500) (-741.206) * [-737.559] (-738.049) (-738.785) (-739.079) -- 0:00:15
716500 -- (-737.962) [-742.203] (-738.413) (-738.671) * (-739.730) (-740.482) [-737.847] (-741.410) -- 0:00:15
717000 -- (-739.417) [-737.725] (-737.750) (-742.359) * (-738.710) (-742.988) [-741.553] (-741.903) -- 0:00:15
717500 -- [-739.986] (-737.992) (-738.283) (-738.448) * (-738.036) (-738.795) [-741.178] (-737.936) -- 0:00:15
718000 -- (-739.742) (-737.864) [-738.944] (-738.673) * (-738.007) (-739.794) (-742.054) [-738.051] -- 0:00:15
718500 -- (-739.148) (-737.407) (-737.208) [-740.396] * (-738.607) (-738.713) [-739.684] (-737.132) -- 0:00:15
719000 -- [-739.658] (-737.805) (-737.011) (-738.402) * (-738.023) (-738.939) (-739.545) [-738.225] -- 0:00:15
719500 -- (-741.474) (-739.289) [-739.481] (-739.499) * (-738.087) (-740.521) [-740.604] (-740.699) -- 0:00:15
720000 -- (-738.803) (-739.084) [-737.482] (-741.352) * (-739.310) [-740.177] (-744.158) (-740.698) -- 0:00:15
Average standard deviation of split frequencies: 0.012559
720500 -- (-740.409) (-740.419) (-737.947) [-738.395] * (-737.825) [-743.250] (-743.809) (-739.438) -- 0:00:15
721000 -- (-740.784) [-737.957] (-738.508) (-740.021) * [-739.868] (-743.178) (-737.744) (-738.186) -- 0:00:15
721500 -- (-741.626) [-739.482] (-741.617) (-738.977) * [-738.148] (-740.432) (-738.723) (-738.695) -- 0:00:15
722000 -- [-740.567] (-739.981) (-742.747) (-738.301) * (-744.486) [-738.192] (-740.014) (-739.162) -- 0:00:15
722500 -- (-741.901) [-737.972] (-738.292) (-738.562) * (-737.089) (-737.527) (-740.152) [-737.399] -- 0:00:14
723000 -- (-738.323) (-741.931) [-738.367] (-738.088) * [-737.624] (-736.958) (-740.055) (-737.867) -- 0:00:14
723500 -- (-738.261) (-740.764) [-739.311] (-740.716) * (-738.090) (-740.757) [-738.117] (-742.386) -- 0:00:14
724000 -- (-737.711) (-738.212) [-739.628] (-737.890) * [-740.666] (-738.472) (-737.904) (-740.904) -- 0:00:14
724500 -- [-738.828] (-742.359) (-737.153) (-738.808) * [-738.427] (-739.171) (-738.393) (-743.082) -- 0:00:14
725000 -- (-739.039) (-740.378) [-739.576] (-738.222) * [-738.828] (-737.507) (-737.459) (-740.684) -- 0:00:15
Average standard deviation of split frequencies: 0.011688
725500 -- (-741.091) (-738.717) (-737.899) [-741.087] * (-738.519) (-742.668) [-738.235] (-737.903) -- 0:00:15
726000 -- (-738.918) [-738.836] (-738.333) (-740.612) * (-739.456) (-741.897) [-738.161] (-738.769) -- 0:00:15
726500 -- (-740.194) (-737.079) (-738.566) [-740.698] * (-737.730) (-745.234) [-738.406] (-738.565) -- 0:00:15
727000 -- [-737.703] (-738.614) (-740.719) (-741.326) * (-738.821) (-739.695) (-738.983) [-737.962] -- 0:00:15
727500 -- [-740.875] (-741.933) (-737.799) (-737.544) * [-738.851] (-738.216) (-739.601) (-738.278) -- 0:00:14
728000 -- (-739.238) (-739.522) [-738.227] (-738.576) * (-738.462) (-738.510) (-740.193) [-737.848] -- 0:00:14
728500 -- (-740.943) [-738.033] (-744.690) (-740.499) * [-737.397] (-738.983) (-739.553) (-738.100) -- 0:00:14
729000 -- [-743.667] (-742.559) (-738.738) (-738.749) * [-741.455] (-741.204) (-742.818) (-740.156) -- 0:00:14
729500 -- (-739.876) [-738.939] (-739.069) (-739.598) * [-740.622] (-743.295) (-741.649) (-738.055) -- 0:00:14
730000 -- (-740.680) [-740.155] (-738.401) (-738.386) * (-739.551) (-743.667) (-740.757) [-738.615] -- 0:00:14
Average standard deviation of split frequencies: 0.011484
730500 -- (-742.586) [-740.016] (-741.262) (-739.778) * [-737.826] (-740.276) (-738.053) (-744.866) -- 0:00:14
731000 -- [-739.425] (-739.826) (-738.343) (-740.222) * (-739.675) [-740.601] (-741.544) (-743.942) -- 0:00:14
731500 -- [-738.403] (-741.101) (-739.336) (-739.894) * [-739.968] (-738.202) (-739.747) (-741.108) -- 0:00:14
732000 -- [-737.793] (-740.819) (-737.177) (-741.083) * (-744.007) (-738.080) (-737.600) [-737.168] -- 0:00:14
732500 -- (-739.555) (-742.999) (-739.646) [-739.777] * (-738.396) [-739.330] (-740.451) (-739.290) -- 0:00:14
733000 -- (-741.642) [-741.989] (-739.285) (-746.239) * (-739.939) [-739.136] (-740.967) (-740.744) -- 0:00:14
733500 -- (-742.316) (-739.090) [-741.641] (-746.481) * (-740.442) [-738.545] (-740.624) (-738.655) -- 0:00:14
734000 -- (-737.613) [-745.687] (-739.075) (-738.847) * (-738.793) (-742.962) [-739.393] (-738.525) -- 0:00:14
734500 -- (-743.926) (-739.049) (-739.451) [-740.489] * [-738.606] (-738.655) (-739.351) (-738.514) -- 0:00:14
735000 -- (-737.567) [-738.089] (-737.430) (-738.279) * (-740.713) [-739.836] (-739.327) (-739.028) -- 0:00:14
Average standard deviation of split frequencies: 0.011785
735500 -- (-738.256) (-740.082) [-739.214] (-738.457) * [-737.821] (-740.381) (-739.319) (-737.832) -- 0:00:14
736000 -- [-738.101] (-738.550) (-740.194) (-739.481) * (-743.479) [-740.436] (-739.333) (-737.532) -- 0:00:14
736500 -- [-738.698] (-738.247) (-737.313) (-747.559) * (-742.284) [-739.687] (-739.274) (-738.667) -- 0:00:14
737000 -- (-739.048) [-738.517] (-737.852) (-738.765) * (-739.806) [-740.874] (-739.211) (-737.462) -- 0:00:14
737500 -- (-738.303) [-741.090] (-742.981) (-739.712) * (-740.433) (-738.037) (-742.971) [-738.112] -- 0:00:14
738000 -- (-738.926) (-738.984) [-742.208] (-741.557) * (-739.526) [-738.060] (-737.481) (-737.369) -- 0:00:14
738500 -- [-740.766] (-737.789) (-750.503) (-739.347) * (-736.930) (-739.036) [-738.771] (-737.382) -- 0:00:14
739000 -- (-740.922) [-737.393] (-741.606) (-739.031) * [-739.348] (-738.970) (-740.630) (-737.372) -- 0:00:14
739500 -- (-737.058) (-738.649) (-738.928) [-740.054] * (-739.490) (-739.911) (-740.029) [-737.476] -- 0:00:14
740000 -- (-739.841) (-738.994) [-739.367] (-741.282) * (-738.612) (-741.263) (-739.274) [-737.349] -- 0:00:14
Average standard deviation of split frequencies: 0.011965
740500 -- (-742.906) (-739.532) [-740.898] (-737.025) * [-739.858] (-738.605) (-737.794) (-737.387) -- 0:00:14
741000 -- (-741.326) (-737.473) (-741.631) [-737.549] * [-741.559] (-738.450) (-738.481) (-737.670) -- 0:00:13
741500 -- (-738.624) [-737.434] (-739.618) (-739.325) * (-738.264) (-737.349) (-742.372) [-737.195] -- 0:00:13
742000 -- (-738.537) (-738.048) [-738.115] (-741.032) * (-739.340) [-738.343] (-743.122) (-743.855) -- 0:00:13
742500 -- (-739.328) (-738.953) [-739.253] (-740.841) * (-741.602) [-740.238] (-743.540) (-740.990) -- 0:00:13
743000 -- [-739.065] (-738.450) (-738.776) (-739.431) * (-739.192) (-741.930) (-742.129) [-741.332] -- 0:00:13
743500 -- (-738.276) (-739.473) (-738.168) [-738.456] * (-739.765) (-740.240) (-743.128) [-738.922] -- 0:00:14
744000 -- (-737.533) (-740.384) [-738.562] (-738.610) * (-738.899) (-739.400) (-740.157) [-738.652] -- 0:00:14
744500 -- (-737.266) [-737.444] (-738.134) (-739.222) * (-738.873) [-737.951] (-738.241) (-738.230) -- 0:00:14
745000 -- [-737.925] (-737.603) (-740.173) (-739.413) * (-739.304) (-739.589) (-737.243) [-738.162] -- 0:00:14
Average standard deviation of split frequencies: 0.011627
745500 -- (-738.318) (-741.040) [-737.415] (-737.252) * (-740.538) (-740.903) (-737.947) [-740.310] -- 0:00:13
746000 -- [-737.774] (-739.158) (-737.404) (-741.154) * (-739.747) [-741.114] (-737.645) (-739.508) -- 0:00:13
746500 -- (-738.640) [-737.192] (-742.861) (-741.283) * (-739.371) (-738.090) (-739.101) [-740.370] -- 0:00:13
747000 -- [-737.732] (-737.607) (-740.635) (-741.365) * (-739.326) (-738.800) (-739.067) [-738.318] -- 0:00:13
747500 -- (-739.026) (-737.376) [-739.424] (-737.550) * (-739.838) [-739.830] (-738.184) (-737.463) -- 0:00:13
748000 -- (-739.534) [-739.247] (-741.584) (-738.067) * [-741.505] (-738.837) (-739.734) (-737.937) -- 0:00:13
748500 -- (-738.259) (-740.148) [-739.326] (-738.663) * (-740.292) (-739.323) (-737.904) [-737.385] -- 0:00:13
749000 -- (-737.863) (-737.918) (-742.942) [-739.565] * (-739.120) (-737.988) [-738.167] (-737.566) -- 0:00:13
749500 -- [-739.643] (-737.583) (-742.500) (-739.859) * (-737.599) (-738.656) (-738.637) [-737.885] -- 0:00:13
750000 -- (-737.400) [-740.506] (-743.967) (-738.704) * [-737.322] (-739.322) (-738.739) (-737.920) -- 0:00:13
Average standard deviation of split frequencies: 0.011680
750500 -- (-742.239) (-741.269) [-739.524] (-741.685) * [-738.667] (-744.224) (-739.467) (-740.264) -- 0:00:13
751000 -- (-745.188) [-739.260] (-738.059) (-741.356) * (-738.493) [-739.355] (-739.720) (-739.063) -- 0:00:13
751500 -- (-743.910) (-738.122) (-741.796) [-738.622] * (-740.499) (-739.355) (-740.963) [-737.488] -- 0:00:13
752000 -- (-739.955) [-740.856] (-742.156) (-744.136) * (-741.676) (-739.300) [-738.162] (-737.883) -- 0:00:13
752500 -- (-737.564) [-737.652] (-741.247) (-738.787) * (-738.145) [-740.472] (-738.613) (-737.215) -- 0:00:13
753000 -- (-737.863) (-737.092) [-739.989] (-737.816) * [-738.713] (-738.972) (-745.713) (-738.973) -- 0:00:13
753500 -- (-737.705) (-739.098) (-740.179) [-737.238] * (-738.549) [-739.059] (-737.659) (-737.686) -- 0:00:13
754000 -- [-737.657] (-738.671) (-740.993) (-739.498) * (-741.671) [-739.437] (-739.481) (-739.000) -- 0:00:13
754500 -- (-739.440) [-738.844] (-738.173) (-738.699) * (-744.959) (-738.629) (-742.899) [-738.602] -- 0:00:13
755000 -- (-741.147) [-741.287] (-738.797) (-742.230) * (-737.988) (-740.959) (-740.287) [-737.340] -- 0:00:13
Average standard deviation of split frequencies: 0.011349
755500 -- (-740.439) (-739.838) [-741.552] (-738.069) * (-738.831) [-738.244] (-740.835) (-738.200) -- 0:00:13
756000 -- (-741.406) [-740.408] (-744.397) (-741.781) * (-741.068) (-739.549) (-742.907) [-738.336] -- 0:00:13
756500 -- (-738.689) (-739.100) [-738.478] (-737.078) * (-740.759) (-741.723) [-738.632] (-737.892) -- 0:00:13
757000 -- (-740.875) (-741.819) (-739.674) [-742.760] * (-739.611) [-739.772] (-739.050) (-739.481) -- 0:00:13
757500 -- (-742.258) (-738.227) [-739.676] (-739.874) * (-740.069) (-738.194) [-739.690] (-738.150) -- 0:00:13
758000 -- (-740.076) (-743.832) (-740.963) [-739.626] * (-740.985) (-740.431) (-740.732) [-740.576] -- 0:00:13
758500 -- (-740.899) (-737.651) (-739.906) [-741.662] * (-740.556) [-738.570] (-741.445) (-739.632) -- 0:00:13
759000 -- (-737.889) [-737.395] (-742.316) (-740.115) * (-738.535) [-738.573] (-738.642) (-739.766) -- 0:00:13
759500 -- (-738.202) [-738.013] (-741.983) (-738.309) * (-738.550) (-738.869) (-738.386) [-740.863] -- 0:00:12
760000 -- (-738.660) (-739.439) (-739.387) [-740.358] * (-737.261) (-738.723) [-741.522] (-743.071) -- 0:00:12
Average standard deviation of split frequencies: 0.011775
760500 -- [-738.659] (-738.972) (-742.782) (-739.476) * (-739.060) [-740.737] (-741.396) (-740.756) -- 0:00:12
761000 -- [-739.072] (-738.973) (-742.513) (-739.630) * (-740.694) [-737.097] (-739.632) (-742.211) -- 0:00:12
761500 -- (-739.622) [-738.183] (-740.177) (-740.811) * (-738.813) (-737.723) [-742.180] (-741.870) -- 0:00:12
762000 -- (-740.325) [-738.181] (-742.336) (-739.736) * (-743.266) [-737.085] (-739.144) (-737.733) -- 0:00:12
762500 -- (-739.771) (-744.004) [-741.128] (-743.466) * [-743.362] (-739.203) (-738.921) (-738.350) -- 0:00:13
763000 -- (-738.799) (-747.752) [-739.222] (-746.552) * (-739.141) (-740.366) [-738.366] (-744.301) -- 0:00:13
763500 -- (-738.586) (-738.552) [-738.307] (-739.991) * [-738.709] (-740.477) (-739.112) (-739.708) -- 0:00:13
764000 -- (-737.624) (-740.792) [-739.112] (-740.261) * [-739.048] (-738.764) (-737.461) (-739.752) -- 0:00:12
764500 -- [-739.431] (-743.713) (-740.265) (-740.658) * (-739.446) [-737.671] (-737.954) (-740.813) -- 0:00:12
765000 -- (-742.280) [-741.473] (-737.612) (-737.424) * [-741.389] (-738.057) (-740.548) (-738.718) -- 0:00:12
Average standard deviation of split frequencies: 0.011570
765500 -- [-740.459] (-740.198) (-737.211) (-738.254) * (-737.616) [-738.766] (-739.930) (-737.644) -- 0:00:12
766000 -- (-743.141) (-739.879) (-738.392) [-741.100] * (-739.633) (-737.098) [-738.014] (-740.289) -- 0:00:12
766500 -- (-737.650) [-739.353] (-739.983) (-740.189) * (-742.083) (-737.320) [-738.596] (-737.441) -- 0:00:12
767000 -- (-738.744) (-738.274) [-739.577] (-738.012) * [-738.253] (-738.158) (-738.736) (-743.652) -- 0:00:12
767500 -- (-740.403) (-742.487) [-738.683] (-738.622) * (-737.353) (-742.729) (-740.010) [-740.727] -- 0:00:12
768000 -- (-739.223) (-737.614) [-737.979] (-739.116) * [-737.669] (-738.940) (-741.727) (-739.441) -- 0:00:12
768500 -- (-738.941) (-738.454) (-738.547) [-739.034] * (-737.452) (-741.880) (-741.002) [-738.623] -- 0:00:12
769000 -- (-743.142) (-737.396) [-737.592] (-739.634) * (-740.175) (-739.848) (-737.820) [-738.181] -- 0:00:12
769500 -- (-738.500) (-740.821) [-739.907] (-742.557) * (-739.639) (-738.308) [-740.241] (-738.545) -- 0:00:12
770000 -- [-738.936] (-739.889) (-738.189) (-740.620) * (-739.629) (-738.771) (-742.284) [-741.600] -- 0:00:12
Average standard deviation of split frequencies: 0.012356
770500 -- (-738.316) (-740.892) [-741.725] (-737.823) * (-741.536) [-742.202] (-744.007) (-738.216) -- 0:00:12
771000 -- (-737.648) (-739.025) (-737.464) [-742.208] * (-740.468) (-738.378) [-741.038] (-738.594) -- 0:00:12
771500 -- [-737.751] (-742.313) (-737.498) (-744.610) * (-738.460) [-738.252] (-742.860) (-738.439) -- 0:00:12
772000 -- (-739.111) (-738.554) (-743.090) [-740.992] * [-738.404] (-738.326) (-744.114) (-738.832) -- 0:00:12
772500 -- [-737.752] (-742.557) (-739.923) (-741.729) * (-740.335) [-739.937] (-742.234) (-740.069) -- 0:00:12
773000 -- [-740.419] (-741.001) (-740.193) (-737.540) * [-738.160] (-739.403) (-744.909) (-738.387) -- 0:00:12
773500 -- (-739.143) (-739.424) [-738.832] (-738.337) * (-738.085) (-737.536) (-744.866) [-740.985] -- 0:00:12
774000 -- (-740.856) [-740.465] (-739.049) (-738.797) * [-740.171] (-739.680) (-738.786) (-739.814) -- 0:00:12
774500 -- (-738.831) (-739.339) (-739.219) [-741.291] * [-741.501] (-741.282) (-740.431) (-737.583) -- 0:00:12
775000 -- (-739.474) [-739.381] (-741.540) (-740.501) * (-739.681) (-740.358) (-740.302) [-737.594] -- 0:00:12
Average standard deviation of split frequencies: 0.011907
775500 -- (-738.451) (-738.435) [-738.161] (-738.891) * (-746.743) [-741.853] (-743.660) (-737.311) -- 0:00:12
776000 -- (-742.140) [-739.190] (-741.848) (-738.545) * (-739.390) [-737.683] (-739.641) (-737.865) -- 0:00:12
776500 -- (-738.977) (-740.231) [-740.462] (-739.280) * [-739.328] (-738.555) (-740.490) (-742.555) -- 0:00:12
777000 -- (-738.350) (-743.449) [-744.494] (-741.166) * (-741.751) [-738.455] (-739.017) (-741.377) -- 0:00:12
777500 -- (-742.235) [-739.747] (-753.697) (-744.183) * (-739.060) (-738.721) (-737.426) [-738.533] -- 0:00:12
778000 -- (-742.055) [-738.710] (-738.486) (-741.388) * [-738.833] (-737.014) (-738.562) (-737.400) -- 0:00:11
778500 -- (-738.730) [-738.856] (-740.725) (-739.301) * (-742.370) (-737.120) (-737.536) [-738.029] -- 0:00:11
779000 -- (-737.623) (-738.510) (-737.542) [-739.753] * (-740.022) (-738.113) [-739.536] (-737.735) -- 0:00:11
779500 -- (-739.331) (-742.578) (-739.489) [-741.452] * (-742.513) (-742.462) (-739.752) [-738.570] -- 0:00:11
780000 -- (-743.605) (-741.931) (-739.335) [-738.713] * [-738.707] (-741.973) (-739.625) (-738.825) -- 0:00:11
Average standard deviation of split frequencies: 0.012319
780500 -- (-742.159) (-739.141) [-742.477] (-739.157) * (-739.711) (-738.899) [-737.610] (-738.720) -- 0:00:11
781000 -- [-742.054] (-740.808) (-743.019) (-739.613) * (-742.876) [-739.452] (-737.828) (-741.837) -- 0:00:12
781500 -- (-740.038) (-738.671) [-743.751] (-738.318) * [-739.117] (-737.991) (-738.106) (-739.776) -- 0:00:12
782000 -- (-739.760) (-739.240) (-742.092) [-740.229] * (-739.435) (-738.693) (-737.034) [-737.906] -- 0:00:11
782500 -- (-737.434) [-741.907] (-739.569) (-738.348) * (-739.742) (-740.818) [-741.885] (-738.331) -- 0:00:11
783000 -- [-737.408] (-741.150) (-738.505) (-737.787) * (-740.491) (-740.669) (-739.739) [-739.459] -- 0:00:11
783500 -- (-737.409) (-736.966) [-739.769] (-739.508) * (-744.381) (-737.745) (-739.746) [-739.337] -- 0:00:11
784000 -- (-738.732) (-737.379) [-739.201] (-737.748) * (-745.624) (-737.397) [-740.185] (-738.350) -- 0:00:11
784500 -- (-738.629) (-740.042) [-739.611] (-737.803) * (-738.340) (-737.394) [-740.233] (-740.240) -- 0:00:11
785000 -- (-742.451) [-738.279] (-741.232) (-737.626) * (-739.340) (-749.452) (-737.724) [-738.455] -- 0:00:11
Average standard deviation of split frequencies: 0.011875
785500 -- (-742.450) (-742.599) (-742.586) [-739.556] * (-738.712) [-740.530] (-738.089) (-738.907) -- 0:00:11
786000 -- (-742.334) (-738.030) (-737.606) [-738.846] * (-739.553) (-740.147) (-737.425) [-739.483] -- 0:00:11
786500 -- (-738.846) (-738.910) (-738.334) [-740.062] * [-740.308] (-739.064) (-738.360) (-739.135) -- 0:00:11
787000 -- [-737.975] (-741.358) (-740.878) (-739.123) * (-739.717) (-738.332) [-740.796] (-738.622) -- 0:00:11
787500 -- (-740.041) (-738.630) [-740.933] (-740.498) * [-738.579] (-739.605) (-738.465) (-738.656) -- 0:00:11
788000 -- (-738.470) (-738.221) [-740.310] (-737.326) * [-739.348] (-738.516) (-739.709) (-738.265) -- 0:00:11
788500 -- (-737.955) (-740.707) (-741.658) [-737.778] * (-738.877) (-738.906) [-740.752] (-739.297) -- 0:00:11
789000 -- (-737.668) [-738.105] (-739.232) (-742.146) * [-738.323] (-739.370) (-737.815) (-741.774) -- 0:00:11
789500 -- (-738.311) [-739.350] (-739.473) (-738.408) * (-738.714) (-739.534) [-740.249] (-737.263) -- 0:00:11
790000 -- (-739.027) (-739.009) (-739.722) [-740.280] * (-739.076) (-740.431) [-738.377] (-739.176) -- 0:00:11
Average standard deviation of split frequencies: 0.011805
790500 -- (-737.494) (-739.304) (-739.503) [-739.025] * [-738.682] (-738.339) (-738.043) (-738.202) -- 0:00:11
791000 -- [-737.330] (-740.888) (-737.461) (-737.496) * (-740.753) (-740.393) [-738.030] (-739.153) -- 0:00:11
791500 -- (-739.122) (-740.883) [-737.185] (-737.220) * [-739.562] (-739.144) (-738.737) (-746.117) -- 0:00:11
792000 -- (-739.754) (-741.414) (-737.270) [-740.128] * (-739.410) (-740.469) (-742.443) [-737.764] -- 0:00:11
792500 -- (-739.969) (-741.399) [-737.269] (-741.706) * (-739.423) (-737.556) (-739.320) [-741.213] -- 0:00:11
793000 -- (-740.227) [-738.201] (-738.284) (-739.710) * (-739.029) (-740.347) [-740.549] (-742.698) -- 0:00:11
793500 -- (-743.356) (-738.091) [-740.584] (-740.986) * (-737.520) (-737.327) (-741.391) [-738.756] -- 0:00:11
794000 -- (-744.012) [-740.014] (-739.041) (-737.512) * [-737.302] (-740.391) (-737.851) (-739.069) -- 0:00:11
794500 -- (-741.789) (-738.776) (-738.132) [-738.281] * [-738.855] (-739.532) (-739.336) (-739.611) -- 0:00:11
795000 -- (-740.733) [-737.978] (-737.750) (-739.235) * (-742.977) (-737.582) [-738.748] (-739.767) -- 0:00:11
Average standard deviation of split frequencies: 0.011844
795500 -- (-741.017) (-738.778) (-742.544) [-741.517] * (-737.749) (-738.653) (-739.134) [-738.961] -- 0:00:11
796000 -- (-738.585) (-742.695) [-739.930] (-737.969) * (-740.343) [-740.465] (-741.116) (-739.466) -- 0:00:11
796500 -- (-739.128) (-740.486) [-739.646] (-739.563) * (-740.063) (-740.915) (-741.082) [-738.143] -- 0:00:10
797000 -- (-738.074) [-738.680] (-740.351) (-738.282) * (-739.515) (-737.712) (-737.193) [-743.248] -- 0:00:10
797500 -- (-738.089) (-739.372) (-740.695) [-738.264] * (-738.799) (-740.731) [-737.985] (-739.555) -- 0:00:10
798000 -- [-738.860] (-738.850) (-737.727) (-739.302) * (-738.366) (-746.020) [-738.585] (-739.406) -- 0:00:10
798500 -- (-739.446) (-740.674) [-739.221] (-741.125) * [-741.259] (-740.610) (-738.054) (-738.982) -- 0:00:10
799000 -- (-738.742) [-739.576] (-738.438) (-741.104) * (-738.311) (-739.439) [-738.657] (-737.339) -- 0:00:10
799500 -- [-738.389] (-738.623) (-739.639) (-739.066) * [-738.000] (-742.295) (-738.960) (-738.718) -- 0:00:11
800000 -- (-740.341) [-739.349] (-739.169) (-740.105) * (-737.727) [-740.146] (-743.073) (-739.581) -- 0:00:11
Average standard deviation of split frequencies: 0.012129
800500 -- (-741.071) [-737.749] (-738.120) (-741.450) * (-739.806) (-737.261) (-748.077) [-738.971] -- 0:00:10
801000 -- (-738.154) (-738.201) (-738.420) [-740.066] * (-741.801) (-737.842) [-737.706] (-738.929) -- 0:00:10
801500 -- (-737.898) [-738.109] (-738.845) (-739.255) * [-738.665] (-737.967) (-737.141) (-740.271) -- 0:00:10
802000 -- [-738.760] (-738.275) (-738.068) (-742.401) * [-742.326] (-744.379) (-740.123) (-739.166) -- 0:00:10
802500 -- (-738.791) (-737.745) (-738.200) [-739.036] * [-740.640] (-738.598) (-737.615) (-737.254) -- 0:00:10
803000 -- (-742.321) (-737.078) [-738.694] (-737.527) * (-740.057) (-738.094) (-738.005) [-737.623] -- 0:00:10
803500 -- (-740.209) (-740.307) [-741.816] (-741.996) * (-738.708) (-740.359) (-740.344) [-737.717] -- 0:00:10
804000 -- (-740.471) [-738.584] (-744.740) (-739.980) * (-739.011) [-738.267] (-739.523) (-737.396) -- 0:00:10
804500 -- (-740.135) [-737.116] (-739.100) (-740.452) * (-741.437) [-737.332] (-737.110) (-737.457) -- 0:00:10
805000 -- (-737.146) (-739.922) (-740.090) [-742.099] * (-743.782) [-738.464] (-738.654) (-740.872) -- 0:00:10
Average standard deviation of split frequencies: 0.011580
805500 -- (-739.288) (-737.782) [-738.243] (-739.598) * [-737.911] (-738.537) (-737.322) (-739.998) -- 0:00:10
806000 -- (-738.461) (-740.660) [-739.484] (-739.220) * [-739.847] (-739.345) (-737.214) (-741.355) -- 0:00:10
806500 -- (-737.989) [-737.895] (-742.167) (-743.334) * (-741.888) [-739.856] (-737.917) (-738.962) -- 0:00:10
807000 -- [-739.049] (-739.159) (-744.888) (-744.571) * [-739.438] (-739.169) (-738.192) (-739.319) -- 0:00:10
807500 -- (-741.640) (-737.098) (-746.966) [-737.925] * (-738.713) (-737.186) (-739.117) [-738.661] -- 0:00:10
808000 -- (-739.544) (-742.185) [-741.077] (-743.097) * (-739.635) (-738.640) (-743.212) [-740.372] -- 0:00:10
808500 -- [-738.681] (-743.064) (-738.153) (-743.985) * (-739.012) (-738.889) [-740.734] (-739.083) -- 0:00:10
809000 -- [-737.631] (-738.842) (-742.703) (-739.979) * (-738.479) (-742.015) [-738.281] (-738.108) -- 0:00:10
809500 -- (-737.634) (-739.677) [-737.410] (-739.229) * (-737.723) [-738.958] (-737.864) (-739.504) -- 0:00:10
810000 -- [-737.378] (-738.428) (-740.145) (-741.493) * (-738.299) [-737.552] (-737.964) (-741.563) -- 0:00:10
Average standard deviation of split frequencies: 0.011397
810500 -- (-739.090) [-738.399] (-740.469) (-742.129) * (-739.117) (-739.561) (-738.959) [-739.691] -- 0:00:10
811000 -- (-741.965) (-740.768) [-739.091] (-740.100) * (-739.732) [-739.537] (-739.583) (-737.517) -- 0:00:10
811500 -- (-744.961) [-739.100] (-739.845) (-743.079) * (-739.122) (-741.140) (-737.267) [-737.708] -- 0:00:10
812000 -- (-740.787) (-737.547) [-738.768] (-739.619) * [-738.676] (-739.654) (-737.259) (-737.175) -- 0:00:10
812500 -- (-740.690) [-737.788] (-740.707) (-737.947) * [-738.780] (-737.623) (-739.932) (-738.988) -- 0:00:10
813000 -- (-744.405) (-741.041) (-738.279) [-737.851] * (-739.683) (-740.135) (-738.487) [-741.032] -- 0:00:10
813500 -- [-740.189] (-740.378) (-738.811) (-737.907) * (-739.040) (-739.292) (-739.976) [-739.794] -- 0:00:10
814000 -- (-737.026) [-739.164] (-738.732) (-737.437) * (-738.683) [-738.290] (-740.697) (-738.930) -- 0:00:10
814500 -- (-738.103) (-742.345) (-738.727) [-738.543] * (-742.129) [-738.131] (-741.987) (-739.018) -- 0:00:10
815000 -- (-738.499) [-740.782] (-737.091) (-737.610) * (-737.255) (-738.351) [-741.899] (-737.466) -- 0:00:09
Average standard deviation of split frequencies: 0.011554
815500 -- [-737.722] (-741.547) (-741.403) (-738.616) * (-738.726) (-739.478) [-740.746] (-737.462) -- 0:00:09
816000 -- [-739.184] (-739.260) (-742.392) (-739.585) * [-738.453] (-739.690) (-741.854) (-737.417) -- 0:00:09
816500 -- (-739.076) [-738.932] (-739.570) (-738.682) * (-739.579) [-740.133] (-742.796) (-737.540) -- 0:00:09
817000 -- (-738.910) (-740.358) (-738.642) [-741.085] * (-738.957) (-738.630) [-737.665] (-737.187) -- 0:00:09
817500 -- (-740.058) [-740.609] (-737.781) (-739.112) * (-738.331) (-737.581) [-737.670] (-743.721) -- 0:00:09
818000 -- (-738.284) [-739.174] (-742.488) (-740.022) * (-738.099) (-738.979) (-739.977) [-739.990] -- 0:00:10
818500 -- (-740.311) [-737.955] (-737.339) (-739.413) * (-737.509) [-738.823] (-742.398) (-739.418) -- 0:00:09
819000 -- (-743.776) (-740.188) (-737.886) [-738.765] * (-742.054) (-738.018) (-738.284) [-738.920] -- 0:00:09
819500 -- (-738.578) (-738.357) (-739.469) [-739.355] * (-738.232) (-740.399) (-739.366) [-740.778] -- 0:00:09
820000 -- (-738.627) (-739.632) (-737.956) [-737.881] * (-737.974) (-737.995) (-740.342) [-739.826] -- 0:00:09
Average standard deviation of split frequencies: 0.012063
820500 -- (-739.029) (-740.068) [-739.088] (-740.867) * (-738.089) (-740.796) [-737.707] (-741.940) -- 0:00:09
821000 -- [-739.875] (-741.087) (-739.054) (-741.885) * (-739.443) (-739.941) [-738.460] (-737.937) -- 0:00:09
821500 -- (-737.969) (-740.579) (-737.421) [-738.660] * (-737.415) (-740.468) [-740.161] (-738.700) -- 0:00:09
822000 -- (-739.531) (-737.544) (-741.337) [-738.068] * (-740.533) (-737.377) (-741.431) [-739.611] -- 0:00:09
822500 -- (-738.597) (-742.283) [-739.398] (-738.471) * [-737.838] (-738.168) (-738.144) (-739.998) -- 0:00:09
823000 -- [-737.406] (-740.350) (-739.470) (-740.317) * (-737.950) [-737.424] (-744.200) (-739.799) -- 0:00:09
823500 -- (-737.199) [-737.392] (-737.306) (-740.302) * (-738.568) [-738.116] (-741.542) (-737.213) -- 0:00:09
824000 -- (-740.067) (-739.598) (-738.602) [-738.430] * (-739.250) (-738.891) [-740.104] (-740.184) -- 0:00:09
824500 -- (-739.825) (-740.299) (-738.538) [-737.933] * (-737.611) (-738.816) [-738.882] (-740.230) -- 0:00:09
825000 -- (-737.610) (-739.068) (-737.547) [-740.203] * (-741.204) (-739.034) [-738.071] (-742.046) -- 0:00:09
Average standard deviation of split frequencies: 0.011985
825500 -- (-737.072) [-739.775] (-737.313) (-741.598) * (-741.640) (-738.016) (-739.458) [-744.542] -- 0:00:09
826000 -- (-741.281) (-738.534) (-738.885) [-743.509] * (-738.638) [-740.558] (-738.101) (-742.745) -- 0:00:09
826500 -- (-738.981) (-738.844) (-742.837) [-737.838] * (-738.806) (-737.524) (-738.048) [-737.233] -- 0:00:09
827000 -- [-738.197] (-737.622) (-740.368) (-740.748) * [-739.017] (-738.821) (-737.638) (-739.639) -- 0:00:09
827500 -- (-740.316) (-741.248) (-739.985) [-737.917] * (-738.440) (-740.895) [-737.080] (-737.686) -- 0:00:09
828000 -- (-743.272) (-739.774) (-738.811) [-736.968] * (-739.230) (-738.899) [-737.032] (-737.660) -- 0:00:09
828500 -- [-737.143] (-738.366) (-737.725) (-737.732) * [-740.465] (-740.508) (-737.390) (-737.561) -- 0:00:09
829000 -- (-737.586) (-741.610) [-737.901] (-739.649) * [-739.708] (-737.875) (-740.748) (-737.162) -- 0:00:09
829500 -- (-738.827) (-738.581) (-737.830) [-738.218] * (-739.423) (-738.408) [-740.130] (-738.507) -- 0:00:09
830000 -- (-740.722) (-740.516) [-738.603] (-755.422) * (-740.260) (-740.882) (-737.299) [-739.011] -- 0:00:09
Average standard deviation of split frequencies: 0.011350
830500 -- (-738.570) (-737.508) [-739.138] (-739.300) * (-739.825) [-739.917] (-739.413) (-738.146) -- 0:00:09
831000 -- (-739.454) (-737.079) [-739.218] (-738.057) * [-740.764] (-739.776) (-738.402) (-740.002) -- 0:00:09
831500 -- (-739.112) (-738.027) [-742.385] (-740.450) * (-741.332) [-738.247] (-740.679) (-742.126) -- 0:00:09
832000 -- [-738.242] (-737.547) (-738.666) (-737.964) * [-741.780] (-738.083) (-742.233) (-737.719) -- 0:00:09
832500 -- (-744.195) [-739.384] (-741.050) (-739.578) * (-743.028) (-738.520) (-744.422) [-737.347] -- 0:00:09
833000 -- [-742.380] (-740.591) (-741.512) (-738.963) * (-738.820) (-739.620) [-740.006] (-737.800) -- 0:00:09
833500 -- (-738.411) (-739.988) (-739.230) [-737.123] * (-739.568) (-737.822) [-738.599] (-739.351) -- 0:00:08
834000 -- (-737.822) (-738.137) [-739.098] (-738.097) * (-740.472) [-739.187] (-737.787) (-740.700) -- 0:00:08
834500 -- (-737.743) (-739.208) (-740.281) [-737.833] * [-739.815] (-740.556) (-738.415) (-738.660) -- 0:00:08
835000 -- [-737.703] (-738.593) (-738.878) (-738.355) * [-737.589] (-740.225) (-740.169) (-736.840) -- 0:00:08
Average standard deviation of split frequencies: 0.011842
835500 -- (-741.136) (-737.927) [-738.910] (-737.214) * (-739.159) (-742.212) (-740.521) [-740.253] -- 0:00:08
836000 -- (-742.006) (-739.708) (-743.027) [-737.257] * [-738.507] (-738.284) (-741.134) (-741.808) -- 0:00:08
836500 -- (-742.864) [-736.974] (-739.346) (-742.266) * (-742.821) [-742.247] (-739.145) (-740.178) -- 0:00:08
837000 -- (-743.293) (-739.620) [-739.868] (-741.156) * (-740.183) [-740.708] (-738.713) (-741.180) -- 0:00:08
837500 -- (-740.025) (-739.125) (-739.084) [-739.903] * (-739.991) [-738.793] (-739.304) (-740.183) -- 0:00:08
838000 -- (-741.613) (-737.992) [-739.336] (-739.835) * (-740.756) (-744.028) (-740.630) [-737.804] -- 0:00:08
838500 -- (-742.825) [-740.270] (-739.591) (-741.915) * (-738.222) (-740.135) [-737.217] (-741.057) -- 0:00:08
839000 -- (-740.454) [-738.432] (-739.652) (-738.947) * (-739.854) (-742.999) (-737.098) [-741.924] -- 0:00:08
839500 -- (-738.135) (-738.272) [-741.340] (-740.616) * (-738.908) (-738.249) [-738.522] (-738.371) -- 0:00:08
840000 -- (-738.285) (-740.325) (-739.500) [-738.585] * (-739.057) (-737.591) [-739.553] (-738.726) -- 0:00:08
Average standard deviation of split frequencies: 0.012000
840500 -- [-740.386] (-742.125) (-739.121) (-740.053) * (-740.170) (-739.440) [-739.399] (-737.525) -- 0:00:08
841000 -- (-743.210) [-737.950] (-739.292) (-739.482) * (-740.170) (-741.285) [-740.155] (-740.019) -- 0:00:08
841500 -- (-743.626) [-739.052] (-740.199) (-739.207) * [-738.027] (-739.232) (-740.349) (-737.510) -- 0:00:08
842000 -- (-740.876) [-740.980] (-738.782) (-740.352) * (-738.867) (-742.676) (-738.660) [-737.304] -- 0:00:08
842500 -- [-737.465] (-738.100) (-741.227) (-739.690) * [-737.799] (-744.928) (-738.376) (-739.646) -- 0:00:08
843000 -- [-738.540] (-737.987) (-740.841) (-740.210) * (-740.425) (-740.022) [-738.373] (-740.781) -- 0:00:08
843500 -- (-744.199) [-737.437] (-742.060) (-738.080) * (-740.425) [-741.755] (-739.042) (-738.502) -- 0:00:08
844000 -- (-743.071) [-738.566] (-739.303) (-738.825) * (-738.309) (-738.104) [-737.716] (-739.001) -- 0:00:08
844500 -- (-746.361) [-740.328] (-740.494) (-747.903) * (-738.013) [-737.796] (-738.147) (-739.032) -- 0:00:08
845000 -- (-737.884) [-738.083] (-739.379) (-741.389) * [-738.306] (-739.234) (-738.665) (-738.764) -- 0:00:08
Average standard deviation of split frequencies: 0.011924
845500 -- [-739.191] (-739.888) (-739.036) (-737.321) * [-739.411] (-738.964) (-738.831) (-737.661) -- 0:00:08
846000 -- (-739.712) (-737.708) (-737.767) [-740.257] * (-741.568) (-738.476) (-739.077) [-738.837] -- 0:00:08
846500 -- (-744.082) (-737.750) (-737.871) [-738.561] * [-742.624] (-744.497) (-739.741) (-740.258) -- 0:00:08
847000 -- (-743.922) (-737.727) [-739.967] (-737.748) * (-737.808) (-740.171) (-737.262) [-738.700] -- 0:00:08
847500 -- (-737.785) (-737.772) [-739.991] (-738.335) * [-741.546] (-738.829) (-744.109) (-739.110) -- 0:00:08
848000 -- (-738.661) (-738.681) [-737.302] (-739.586) * (-742.835) [-741.352] (-745.113) (-742.482) -- 0:00:08
848500 -- [-737.712] (-744.839) (-739.451) (-741.089) * (-741.721) (-741.038) [-737.741] (-739.569) -- 0:00:08
849000 -- [-738.158] (-737.643) (-739.133) (-739.663) * (-744.147) [-739.030] (-739.521) (-737.041) -- 0:00:08
849500 -- (-740.585) [-738.362] (-740.641) (-743.614) * (-739.990) (-737.994) [-740.226] (-738.577) -- 0:00:08
850000 -- [-738.653] (-739.012) (-738.800) (-741.382) * [-743.106] (-739.650) (-741.852) (-739.175) -- 0:00:08
Average standard deviation of split frequencies: 0.011859
850500 -- [-738.116] (-744.855) (-742.479) (-741.673) * (-743.703) [-740.721] (-740.077) (-739.910) -- 0:00:08
851000 -- [-743.907] (-740.433) (-741.149) (-738.088) * (-742.819) (-738.096) (-740.086) [-739.015] -- 0:00:08
851500 -- (-738.554) (-738.059) [-742.201] (-738.586) * (-737.006) (-737.509) (-737.613) [-739.768] -- 0:00:08
852000 -- (-739.041) (-737.414) [-738.924] (-738.725) * (-737.334) (-739.546) (-740.553) [-737.741] -- 0:00:07
852500 -- (-739.259) (-740.758) [-740.417] (-740.880) * (-739.616) (-739.349) [-743.868] (-742.174) -- 0:00:07
853000 -- [-738.168] (-737.360) (-740.468) (-737.479) * (-740.851) [-739.169] (-738.238) (-738.342) -- 0:00:07
853500 -- [-740.042] (-740.666) (-739.024) (-740.291) * (-742.792) [-738.337] (-738.970) (-741.613) -- 0:00:07
854000 -- [-740.661] (-738.144) (-738.824) (-739.524) * (-741.156) (-737.629) (-739.819) [-739.637] -- 0:00:07
854500 -- [-738.987] (-738.442) (-740.977) (-745.191) * (-743.835) (-742.725) (-740.493) [-741.815] -- 0:00:07
855000 -- (-738.209) [-738.983] (-741.474) (-741.015) * (-740.745) [-740.790] (-739.932) (-741.131) -- 0:00:07
Average standard deviation of split frequencies: 0.011675
855500 -- [-740.111] (-738.672) (-741.749) (-744.215) * (-738.690) (-743.806) (-738.805) [-740.209] -- 0:00:07
856000 -- (-737.652) [-738.642] (-740.659) (-740.091) * (-738.397) (-739.487) [-738.275] (-739.859) -- 0:00:07
856500 -- (-738.157) [-738.030] (-738.884) (-738.484) * [-738.304] (-737.822) (-741.617) (-739.547) -- 0:00:07
857000 -- (-738.908) (-737.358) (-739.992) [-739.069] * (-738.550) [-738.393] (-738.922) (-738.958) -- 0:00:07
857500 -- (-739.357) [-737.167] (-742.190) (-742.211) * [-740.314] (-738.534) (-738.391) (-738.367) -- 0:00:07
858000 -- (-740.128) [-737.495] (-738.815) (-739.243) * (-743.857) (-740.167) [-737.236] (-740.031) -- 0:00:07
858500 -- (-742.672) [-737.165] (-738.850) (-738.509) * (-738.194) [-739.811] (-737.521) (-742.025) -- 0:00:07
859000 -- (-739.522) [-737.170] (-738.343) (-738.932) * (-739.158) [-740.268] (-737.691) (-741.373) -- 0:00:07
859500 -- (-740.159) (-741.565) [-738.855] (-738.469) * [-739.738] (-739.361) (-737.391) (-738.447) -- 0:00:07
860000 -- (-738.067) (-737.265) [-740.734] (-738.617) * (-739.653) (-740.664) (-739.169) [-738.061] -- 0:00:07
Average standard deviation of split frequencies: 0.011173
860500 -- [-738.054] (-740.422) (-738.716) (-737.696) * (-740.070) (-737.067) (-738.965) [-737.570] -- 0:00:07
861000 -- (-737.552) (-741.596) (-741.654) [-738.050] * (-737.583) (-738.893) (-737.107) [-742.264] -- 0:00:07
861500 -- (-740.509) (-739.192) [-740.024] (-744.092) * (-743.809) [-741.488] (-736.987) (-742.660) -- 0:00:07
862000 -- (-744.000) [-737.914] (-738.848) (-741.514) * (-742.699) [-742.116] (-738.442) (-739.397) -- 0:00:07
862500 -- (-738.013) [-737.406] (-738.369) (-737.472) * (-737.586) (-738.585) [-738.233] (-740.523) -- 0:00:07
863000 -- (-738.181) (-740.516) [-738.050] (-739.636) * (-739.566) (-740.422) [-738.148] (-737.970) -- 0:00:07
863500 -- (-739.263) (-737.824) [-737.509] (-741.597) * (-740.179) (-738.271) [-738.621] (-738.787) -- 0:00:07
864000 -- (-741.004) (-739.657) [-739.229] (-743.135) * (-745.034) (-739.916) (-737.879) [-738.611] -- 0:00:07
864500 -- (-737.356) (-741.106) [-742.484] (-742.547) * (-737.470) (-740.247) (-738.979) [-737.124] -- 0:00:07
865000 -- (-739.274) (-737.062) (-737.631) [-738.663] * [-738.506] (-740.218) (-737.420) (-738.737) -- 0:00:07
Average standard deviation of split frequencies: 0.009907
865500 -- (-740.423) (-738.555) (-738.945) [-738.815] * (-738.766) [-742.763] (-737.315) (-740.232) -- 0:00:07
866000 -- (-739.434) [-738.027] (-742.097) (-742.457) * (-737.806) [-739.842] (-737.555) (-737.465) -- 0:00:07
866500 -- [-737.906] (-737.345) (-740.844) (-740.461) * [-739.346] (-742.315) (-738.270) (-737.602) -- 0:00:07
867000 -- (-739.438) (-738.381) (-744.121) [-739.846] * (-739.937) (-740.044) (-738.508) [-738.164] -- 0:00:07
867500 -- (-737.728) (-742.257) [-738.832] (-742.475) * (-738.641) (-739.265) (-740.043) [-738.426] -- 0:00:07
868000 -- (-738.354) [-741.529] (-738.453) (-739.280) * (-739.138) (-740.739) (-738.556) [-739.594] -- 0:00:07
868500 -- (-740.660) (-743.265) [-739.183] (-741.134) * (-738.219) (-738.362) (-739.048) [-738.951] -- 0:00:07
869000 -- [-740.202] (-739.666) (-742.248) (-738.075) * (-737.953) (-738.708) (-739.230) [-738.731] -- 0:00:07
869500 -- (-737.433) (-738.727) [-740.174] (-739.794) * [-737.065] (-740.008) (-739.827) (-739.271) -- 0:00:07
870000 -- (-739.100) (-743.208) [-741.374] (-743.278) * (-738.295) (-739.661) [-739.903] (-737.865) -- 0:00:07
Average standard deviation of split frequencies: 0.010504
870500 -- (-739.272) [-742.073] (-741.521) (-739.059) * (-737.565) (-738.205) [-742.244] (-737.290) -- 0:00:06
871000 -- (-738.058) [-740.146] (-738.432) (-739.051) * (-741.169) (-739.920) (-740.264) [-745.067] -- 0:00:06
871500 -- (-740.282) [-738.521] (-743.804) (-737.875) * (-742.158) (-740.131) [-738.577] (-743.295) -- 0:00:06
872000 -- [-738.834] (-743.757) (-740.228) (-740.234) * (-741.191) [-745.011] (-741.121) (-738.431) -- 0:00:06
872500 -- (-740.676) [-742.868] (-738.481) (-739.649) * (-738.150) (-740.618) [-738.864] (-740.439) -- 0:00:06
873000 -- [-739.719] (-741.791) (-739.719) (-739.165) * (-740.111) (-738.343) [-739.375] (-745.881) -- 0:00:06
873500 -- (-741.698) (-740.327) [-738.128] (-740.218) * (-740.953) (-737.843) (-739.958) [-740.056] -- 0:00:06
874000 -- (-740.735) (-740.253) [-738.601] (-739.102) * [-739.080] (-740.471) (-739.632) (-738.723) -- 0:00:06
874500 -- (-739.490) [-739.474] (-739.676) (-738.475) * (-739.668) (-740.338) [-738.132] (-740.305) -- 0:00:06
875000 -- (-741.951) (-737.243) (-738.882) [-737.815] * (-741.763) (-743.285) (-741.974) [-740.118] -- 0:00:06
Average standard deviation of split frequencies: 0.010225
875500 -- (-741.989) (-741.434) (-738.441) [-739.143] * (-738.470) (-748.403) [-737.175] (-740.914) -- 0:00:06
876000 -- (-745.221) (-739.416) [-736.981] (-742.152) * (-742.832) (-739.877) (-738.526) [-737.651] -- 0:00:06
876500 -- (-739.220) (-739.032) [-743.197] (-737.043) * (-738.013) (-739.268) (-739.265) [-739.387] -- 0:00:06
877000 -- [-737.726] (-742.846) (-742.589) (-738.173) * (-741.055) (-743.504) [-739.909] (-738.453) -- 0:00:06
877500 -- (-738.037) (-740.026) (-737.498) [-737.967] * (-737.469) [-738.279] (-742.817) (-738.589) -- 0:00:06
878000 -- (-744.929) [-739.763] (-738.936) (-745.325) * [-737.963] (-738.279) (-740.125) (-740.045) -- 0:00:06
878500 -- (-738.211) (-741.152) (-740.820) [-742.536] * (-737.817) (-738.437) [-739.681] (-738.552) -- 0:00:06
879000 -- [-739.499] (-741.822) (-741.700) (-741.887) * (-738.355) (-738.784) [-738.557] (-739.004) -- 0:00:06
879500 -- (-742.199) (-739.634) (-739.925) [-738.384] * (-740.275) [-740.420] (-738.107) (-738.144) -- 0:00:06
880000 -- (-737.665) (-738.516) (-741.454) [-743.438] * [-737.636] (-738.561) (-739.455) (-737.932) -- 0:00:06
Average standard deviation of split frequencies: 0.010599
880500 -- (-738.333) (-737.902) [-740.414] (-745.404) * (-738.053) (-741.414) [-741.174] (-737.944) -- 0:00:06
881000 -- (-738.447) (-741.564) (-739.612) [-738.065] * [-739.725] (-738.175) (-743.399) (-737.507) -- 0:00:06
881500 -- (-737.841) [-738.024] (-738.698) (-738.090) * (-741.676) (-738.539) [-739.688] (-738.156) -- 0:00:06
882000 -- (-738.009) [-740.400] (-738.499) (-739.313) * [-738.942] (-740.389) (-740.020) (-738.706) -- 0:00:06
882500 -- (-739.107) (-739.961) [-737.745] (-738.418) * (-739.380) [-741.615] (-739.885) (-737.558) -- 0:00:06
883000 -- (-741.793) (-737.636) (-737.307) [-738.193] * (-738.205) [-741.840] (-739.071) (-743.453) -- 0:00:06
883500 -- (-738.444) (-740.100) [-737.293] (-739.716) * [-738.449] (-741.747) (-739.323) (-741.986) -- 0:00:06
884000 -- [-740.512] (-739.453) (-739.407) (-743.133) * (-738.894) [-740.138] (-739.612) (-738.275) -- 0:00:06
884500 -- [-742.508] (-743.059) (-738.214) (-741.960) * (-739.272) (-742.885) (-738.570) [-739.417] -- 0:00:06
885000 -- (-743.994) (-742.395) (-738.343) [-740.801] * (-741.935) (-740.635) [-737.746] (-737.807) -- 0:00:06
Average standard deviation of split frequencies: 0.010003
885500 -- [-737.363] (-742.611) (-740.402) (-737.929) * (-741.821) (-740.601) [-739.037] (-740.171) -- 0:00:06
886000 -- (-741.305) [-738.274] (-738.291) (-740.657) * (-740.152) (-741.690) (-737.704) [-742.725] -- 0:00:06
886500 -- (-742.750) (-740.361) [-738.976] (-740.028) * (-739.571) [-738.140] (-739.581) (-739.160) -- 0:00:06
887000 -- [-742.192] (-739.963) (-740.253) (-743.488) * (-738.947) (-738.947) [-737.707] (-739.611) -- 0:00:06
887500 -- (-738.835) [-739.246] (-740.784) (-738.682) * (-738.161) (-738.439) [-737.503] (-738.848) -- 0:00:06
888000 -- (-738.061) (-738.300) [-737.481] (-741.447) * (-737.133) [-737.920] (-742.240) (-741.282) -- 0:00:06
888500 -- (-737.957) (-737.750) (-739.787) [-739.066] * (-738.312) (-737.566) [-741.313] (-742.268) -- 0:00:06
889000 -- (-738.757) (-744.019) (-739.996) [-740.948] * (-738.312) [-738.235] (-739.845) (-740.343) -- 0:00:05
889500 -- (-738.925) (-739.846) [-738.172] (-741.360) * [-738.679] (-743.203) (-739.175) (-738.738) -- 0:00:05
890000 -- (-739.896) [-738.992] (-738.007) (-738.748) * (-738.292) (-739.970) [-740.222] (-739.682) -- 0:00:05
Average standard deviation of split frequencies: 0.009739
890500 -- (-738.203) (-739.518) [-738.441] (-738.258) * (-740.541) [-743.313] (-738.998) (-741.908) -- 0:00:05
891000 -- (-738.753) (-740.199) (-738.424) [-739.601] * (-738.441) (-737.495) (-739.804) [-741.949] -- 0:00:05
891500 -- (-739.045) [-740.043] (-739.627) (-740.958) * (-738.130) (-738.948) [-740.180] (-741.038) -- 0:00:05
892000 -- (-740.093) [-741.901] (-739.827) (-737.880) * (-738.883) [-737.383] (-738.934) (-739.685) -- 0:00:05
892500 -- [-739.644] (-745.285) (-738.473) (-738.465) * (-738.816) [-737.494] (-738.798) (-740.026) -- 0:00:05
893000 -- [-739.714] (-739.083) (-737.357) (-741.236) * (-740.204) [-739.233] (-739.966) (-739.017) -- 0:00:05
893500 -- (-738.278) (-738.676) (-739.742) [-739.306] * [-738.787] (-737.948) (-737.725) (-741.850) -- 0:00:05
894000 -- (-738.982) [-743.909] (-738.956) (-743.272) * [-741.299] (-737.302) (-739.828) (-739.023) -- 0:00:05
894500 -- (-739.702) [-738.086] (-739.311) (-741.802) * (-738.694) (-737.885) [-737.664] (-738.285) -- 0:00:05
895000 -- (-741.450) (-737.368) [-741.010] (-738.267) * (-740.087) (-737.315) (-741.215) [-738.377] -- 0:00:05
Average standard deviation of split frequencies: 0.009260
895500 -- [-738.317] (-739.692) (-744.189) (-739.949) * (-738.901) [-738.194] (-738.856) (-739.229) -- 0:00:05
896000 -- (-738.223) (-738.754) (-742.156) [-737.796] * (-738.428) (-737.237) [-738.489] (-738.245) -- 0:00:05
896500 -- (-738.984) (-738.638) (-738.060) [-740.729] * [-737.796] (-737.050) (-743.528) (-737.454) -- 0:00:05
897000 -- (-738.446) (-737.942) [-738.448] (-738.675) * (-740.676) [-738.039] (-740.522) (-739.564) -- 0:00:05
897500 -- [-737.010] (-737.644) (-738.536) (-739.962) * (-737.958) (-740.609) [-737.649] (-738.334) -- 0:00:05
898000 -- [-737.540] (-737.993) (-739.531) (-740.274) * [-737.670] (-737.584) (-740.685) (-741.512) -- 0:00:05
898500 -- (-741.568) [-738.144] (-737.435) (-738.642) * [-738.979] (-738.034) (-740.491) (-738.039) -- 0:00:05
899000 -- (-739.872) (-737.368) (-741.654) [-739.970] * (-741.962) (-737.780) (-742.658) [-738.284] -- 0:00:05
899500 -- (-738.563) [-739.657] (-739.977) (-745.302) * (-740.162) (-739.119) (-741.795) [-740.286] -- 0:00:05
900000 -- (-741.305) (-738.552) [-740.567] (-739.247) * [-740.038] (-738.784) (-745.021) (-739.474) -- 0:00:05
Average standard deviation of split frequencies: 0.009212
900500 -- (-741.058) (-737.786) (-738.101) [-739.350] * (-737.065) [-741.130] (-742.078) (-738.413) -- 0:00:05
901000 -- [-740.354] (-738.211) (-737.653) (-740.358) * (-737.880) [-738.883] (-740.190) (-738.068) -- 0:00:05
901500 -- [-741.087] (-740.486) (-738.616) (-738.010) * [-739.431] (-741.403) (-744.557) (-739.782) -- 0:00:05
902000 -- (-739.053) (-739.309) [-737.274] (-737.370) * [-739.352] (-739.414) (-739.709) (-737.357) -- 0:00:05
902500 -- (-738.393) (-740.882) (-737.621) [-737.436] * [-739.170] (-739.926) (-742.233) (-739.563) -- 0:00:05
903000 -- (-740.430) [-738.201] (-738.668) (-738.085) * (-737.671) (-740.505) [-741.108] (-740.439) -- 0:00:05
903500 -- (-743.476) [-740.887] (-742.103) (-739.641) * (-737.612) [-743.540] (-740.003) (-739.768) -- 0:00:05
904000 -- (-739.027) [-737.914] (-742.946) (-738.825) * (-738.546) (-739.490) [-739.268] (-741.239) -- 0:00:05
904500 -- (-743.024) (-740.509) (-738.973) [-738.064] * (-739.978) (-738.679) [-738.831] (-741.029) -- 0:00:05
905000 -- (-741.049) (-740.606) (-737.801) [-739.035] * [-738.239] (-740.608) (-739.846) (-740.716) -- 0:00:05
Average standard deviation of split frequencies: 0.009262
905500 -- (-738.415) (-738.672) [-738.694] (-737.206) * (-737.726) (-739.140) (-738.088) [-739.170] -- 0:00:05
906000 -- (-738.086) [-738.781] (-737.916) (-739.783) * (-738.522) (-740.784) [-737.856] (-739.225) -- 0:00:05
906500 -- [-738.022] (-737.466) (-738.026) (-738.017) * (-739.208) (-740.115) [-738.661] (-738.809) -- 0:00:05
907000 -- (-738.362) [-739.886] (-737.951) (-737.776) * (-737.479) (-740.626) [-738.762] (-738.701) -- 0:00:05
907500 -- (-742.384) [-739.025] (-737.681) (-739.041) * (-739.327) [-738.985] (-740.337) (-739.581) -- 0:00:04
908000 -- (-739.979) (-744.599) [-737.485] (-740.132) * (-741.850) [-737.649] (-739.742) (-743.538) -- 0:00:04
908500 -- (-740.478) (-742.669) [-738.233] (-739.009) * (-739.222) [-737.931] (-738.184) (-738.050) -- 0:00:04
909000 -- (-743.672) [-737.923] (-737.773) (-738.532) * (-741.555) (-737.602) [-739.603] (-738.581) -- 0:00:04
909500 -- (-737.260) [-737.694] (-737.166) (-738.799) * (-744.860) [-738.105] (-741.579) (-738.444) -- 0:00:04
910000 -- (-737.575) (-741.807) (-738.725) [-737.309] * (-739.535) (-738.453) [-743.705] (-738.477) -- 0:00:04
Average standard deviation of split frequencies: 0.009628
910500 -- (-740.465) [-737.724] (-739.392) (-738.278) * [-740.870] (-737.998) (-742.705) (-742.698) -- 0:00:04
911000 -- (-740.492) (-740.443) [-739.477] (-738.292) * (-738.806) (-737.441) (-739.930) [-740.441] -- 0:00:04
911500 -- (-742.948) [-740.462] (-739.815) (-738.505) * (-740.861) (-737.814) (-739.339) [-736.870] -- 0:00:04
912000 -- (-741.445) (-736.930) [-740.551] (-739.737) * (-739.908) (-737.309) (-739.189) [-738.451] -- 0:00:04
912500 -- (-738.985) [-738.004] (-738.163) (-745.401) * (-741.947) (-739.779) [-738.798] (-740.093) -- 0:00:04
913000 -- [-740.643] (-738.850) (-741.369) (-740.897) * [-740.236] (-740.665) (-737.701) (-739.636) -- 0:00:04
913500 -- (-742.213) [-742.850] (-738.570) (-741.309) * (-743.251) [-738.401] (-741.400) (-741.627) -- 0:00:04
914000 -- (-740.368) [-741.550] (-741.641) (-740.427) * (-742.819) [-738.478] (-738.440) (-741.188) -- 0:00:04
914500 -- (-738.408) [-737.176] (-748.660) (-739.880) * [-740.387] (-737.011) (-737.290) (-740.527) -- 0:00:04
915000 -- (-738.363) (-737.343) [-738.735] (-740.229) * [-738.129] (-739.717) (-738.981) (-739.376) -- 0:00:04
Average standard deviation of split frequencies: 0.009778
915500 -- (-738.300) [-741.362] (-738.750) (-738.435) * [-737.364] (-744.018) (-739.065) (-737.521) -- 0:00:04
916000 -- [-739.924] (-738.587) (-739.232) (-737.560) * (-738.493) [-739.679] (-739.296) (-741.264) -- 0:00:04
916500 -- (-740.195) [-738.003] (-739.344) (-738.090) * [-738.007] (-740.955) (-739.914) (-737.472) -- 0:00:04
917000 -- [-738.856] (-742.922) (-739.676) (-740.707) * [-740.031] (-738.739) (-740.824) (-740.752) -- 0:00:04
917500 -- [-738.007] (-738.498) (-743.341) (-737.954) * (-738.972) (-737.433) [-739.412] (-737.219) -- 0:00:04
918000 -- [-737.940] (-741.108) (-738.463) (-738.183) * (-739.138) [-736.787] (-742.785) (-738.754) -- 0:00:04
918500 -- (-740.882) [-739.200] (-739.188) (-738.925) * [-741.055] (-737.599) (-738.410) (-742.177) -- 0:00:04
919000 -- [-738.571] (-741.972) (-739.609) (-738.037) * [-741.254] (-738.120) (-739.242) (-741.960) -- 0:00:04
919500 -- (-737.895) (-740.632) [-737.690] (-737.108) * (-741.136) (-738.004) (-742.623) [-737.110] -- 0:00:04
920000 -- (-738.620) (-738.139) (-738.093) [-740.140] * (-739.278) [-741.301] (-738.655) (-743.511) -- 0:00:04
Average standard deviation of split frequencies: 0.009728
920500 -- (-741.697) [-737.389] (-740.691) (-746.018) * (-739.070) (-737.301) [-737.545] (-738.355) -- 0:00:04
921000 -- (-741.353) (-741.131) [-739.398] (-738.248) * (-737.280) (-739.629) (-739.302) [-739.067] -- 0:00:04
921500 -- (-737.257) (-737.658) (-737.956) [-737.863] * (-738.735) [-739.120] (-737.177) (-743.784) -- 0:00:04
922000 -- (-738.922) (-742.113) (-738.676) [-737.917] * [-737.883] (-739.712) (-741.654) (-741.328) -- 0:00:04
922500 -- (-738.173) (-740.431) [-738.136] (-739.138) * (-739.209) (-738.897) (-739.194) [-741.530] -- 0:00:04
923000 -- (-743.831) (-740.571) [-739.661] (-737.976) * (-739.704) (-737.877) (-739.149) [-739.937] -- 0:00:04
923500 -- (-739.984) (-738.520) [-738.914] (-738.458) * (-737.642) (-742.355) (-739.816) [-740.507] -- 0:00:04
924000 -- (-739.750) [-738.993] (-739.456) (-739.207) * (-738.032) [-738.453] (-739.592) (-737.816) -- 0:00:04
924500 -- [-740.557] (-737.906) (-739.458) (-738.114) * (-739.762) [-741.874] (-741.290) (-744.099) -- 0:00:04
925000 -- (-740.228) (-741.477) (-739.856) [-737.117] * (-737.662) (-740.930) (-739.863) [-739.778] -- 0:00:04
Average standard deviation of split frequencies: 0.009265
925500 -- (-740.914) [-741.891] (-739.492) (-737.197) * (-739.372) (-742.935) [-741.792] (-740.076) -- 0:00:04
926000 -- (-738.548) (-741.782) [-739.405] (-739.980) * [-742.625] (-741.474) (-739.693) (-742.927) -- 0:00:03
926500 -- (-738.872) (-739.044) (-739.988) [-737.868] * (-738.357) (-746.463) (-738.775) [-740.684] -- 0:00:03
927000 -- [-739.669] (-737.944) (-739.065) (-738.956) * [-738.727] (-743.395) (-739.443) (-739.261) -- 0:00:03
927500 -- (-737.883) (-738.343) [-737.901] (-738.315) * (-738.501) (-737.085) [-739.450] (-738.495) -- 0:00:03
928000 -- (-737.998) (-737.597) (-738.669) [-739.685] * (-742.600) (-739.947) [-737.722] (-740.055) -- 0:00:03
928500 -- (-745.157) [-738.922] (-737.668) (-738.973) * [-742.126] (-743.692) (-741.845) (-739.920) -- 0:00:03
929000 -- (-738.651) (-741.810) (-737.475) [-739.047] * (-739.819) (-742.901) [-741.525] (-741.579) -- 0:00:03
929500 -- [-744.050] (-741.778) (-740.228) (-740.301) * (-740.451) (-739.053) [-737.445] (-738.648) -- 0:00:03
930000 -- [-742.864] (-739.293) (-740.754) (-746.030) * (-741.779) (-739.927) [-737.424] (-737.688) -- 0:00:03
Average standard deviation of split frequencies: 0.009421
930500 -- (-738.976) (-739.306) (-738.410) [-739.442] * (-750.749) (-738.969) [-741.689] (-739.086) -- 0:00:03
931000 -- (-739.835) (-741.654) [-740.415] (-740.228) * (-740.998) (-741.588) [-737.982] (-738.506) -- 0:00:03
931500 -- (-737.795) [-742.101] (-738.678) (-745.128) * (-738.502) [-741.477] (-738.348) (-741.503) -- 0:00:03
932000 -- [-737.062] (-743.144) (-741.639) (-751.528) * (-738.093) (-741.808) [-738.348] (-739.080) -- 0:00:03
932500 -- (-738.167) (-739.584) [-737.766] (-745.222) * (-738.490) (-737.479) [-741.007] (-740.006) -- 0:00:03
933000 -- (-740.305) (-739.187) [-741.313] (-744.275) * (-737.459) (-739.842) [-739.171] (-739.718) -- 0:00:03
933500 -- [-737.967] (-739.652) (-740.127) (-737.902) * (-739.081) (-743.986) (-740.109) [-737.902] -- 0:00:03
934000 -- (-739.143) (-740.064) (-739.566) [-737.638] * [-746.695] (-739.680) (-740.270) (-737.255) -- 0:00:03
934500 -- [-738.590] (-738.227) (-744.661) (-739.499) * (-740.635) (-739.502) (-740.566) [-737.202] -- 0:00:03
935000 -- (-739.332) [-738.115] (-741.052) (-737.369) * (-738.377) [-738.825] (-741.000) (-738.500) -- 0:00:03
Average standard deviation of split frequencies: 0.009065
935500 -- (-739.915) [-737.311] (-742.706) (-737.772) * (-737.818) (-739.638) [-739.523] (-742.209) -- 0:00:03
936000 -- (-738.162) (-739.364) [-739.851] (-741.387) * (-738.167) (-739.045) (-739.914) [-740.359] -- 0:00:03
936500 -- (-738.050) [-738.541] (-739.768) (-737.716) * (-739.052) [-738.460] (-738.861) (-740.973) -- 0:00:03
937000 -- [-738.160] (-738.650) (-741.452) (-739.569) * (-738.316) (-739.027) (-737.767) [-741.111] -- 0:00:03
937500 -- (-739.121) [-737.753] (-739.318) (-739.311) * (-740.049) [-742.316] (-738.712) (-738.366) -- 0:00:03
938000 -- (-739.606) (-741.223) (-739.253) [-738.279] * [-738.397] (-737.886) (-739.072) (-737.724) -- 0:00:03
938500 -- (-740.553) [-739.199] (-739.069) (-738.005) * (-739.018) (-737.314) [-739.089] (-741.106) -- 0:00:03
939000 -- [-738.287] (-743.264) (-739.763) (-741.163) * (-745.558) [-740.088] (-738.745) (-738.587) -- 0:00:03
939500 -- [-739.629] (-739.511) (-738.115) (-739.560) * (-739.598) (-739.124) [-739.737] (-738.410) -- 0:00:03
940000 -- (-741.188) (-742.709) (-740.164) [-738.337] * (-738.179) [-742.994] (-739.728) (-740.536) -- 0:00:03
Average standard deviation of split frequencies: 0.009421
940500 -- (-741.075) (-737.303) [-738.184] (-738.178) * (-739.052) (-737.407) (-737.954) [-740.687] -- 0:00:03
941000 -- (-745.289) (-739.343) (-739.532) [-738.873] * (-738.982) (-739.223) [-738.141] (-740.981) -- 0:00:03
941500 -- (-740.093) [-739.327] (-738.787) (-739.325) * (-737.402) (-737.803) [-739.951] (-737.124) -- 0:00:03
942000 -- (-738.390) (-738.488) [-737.184] (-740.655) * [-737.251] (-743.454) (-738.511) (-737.490) -- 0:00:03
942500 -- (-737.941) (-741.009) [-740.782] (-739.064) * (-741.108) (-750.422) (-740.027) [-738.982] -- 0:00:03
943000 -- (-738.232) (-740.288) (-738.353) [-738.810] * (-747.264) [-741.663] (-738.496) (-738.498) -- 0:00:03
943500 -- (-740.698) (-742.591) (-739.310) [-738.824] * (-741.120) (-738.517) [-739.221] (-738.348) -- 0:00:03
944000 -- (-737.650) [-741.514] (-742.050) (-739.359) * (-739.036) (-737.015) (-738.311) [-738.426] -- 0:00:03
944500 -- (-737.851) [-737.471] (-746.539) (-740.369) * (-737.655) (-737.329) (-738.389) [-738.771] -- 0:00:02
945000 -- [-737.678] (-740.150) (-738.883) (-739.803) * (-739.191) [-739.402] (-743.035) (-738.280) -- 0:00:02
Average standard deviation of split frequencies: 0.009368
945500 -- (-737.730) (-739.489) (-737.273) [-740.999] * (-740.433) (-739.035) (-739.984) [-737.303] -- 0:00:02
946000 -- [-739.971] (-736.944) (-739.971) (-737.912) * (-739.117) [-738.630] (-740.653) (-737.769) -- 0:00:02
946500 -- (-738.765) (-736.825) (-740.737) [-738.258] * [-739.781] (-742.068) (-736.959) (-738.615) -- 0:00:02
947000 -- (-740.579) [-738.324] (-738.854) (-739.744) * (-741.629) [-740.858] (-742.781) (-742.041) -- 0:00:02
947500 -- [-741.779] (-738.960) (-740.649) (-741.985) * [-739.977] (-741.414) (-741.890) (-741.700) -- 0:00:02
948000 -- (-742.742) [-737.580] (-740.441) (-743.964) * [-739.139] (-740.762) (-740.630) (-739.779) -- 0:00:02
948500 -- (-741.460) [-738.602] (-739.161) (-742.741) * [-741.881] (-739.536) (-738.634) (-738.837) -- 0:00:02
949000 -- (-737.749) (-738.821) (-742.520) [-744.293] * (-742.092) [-738.230] (-737.998) (-739.409) -- 0:00:02
949500 -- [-737.637] (-737.682) (-738.337) (-737.513) * (-737.236) (-738.690) [-739.160] (-741.886) -- 0:00:02
950000 -- (-737.434) [-738.698] (-739.041) (-742.660) * [-741.937] (-739.747) (-739.238) (-744.559) -- 0:00:02
Average standard deviation of split frequencies: 0.009322
950500 -- (-737.004) (-738.272) (-739.649) [-737.026] * (-739.651) [-739.750] (-739.178) (-744.012) -- 0:00:02
951000 -- [-740.473] (-737.772) (-743.339) (-737.913) * (-737.672) (-739.900) (-739.174) [-737.623] -- 0:00:02
951500 -- (-738.255) (-738.827) (-741.407) [-737.791] * (-737.062) (-745.233) (-740.301) [-738.028] -- 0:00:02
952000 -- (-738.859) (-739.322) [-738.816] (-739.489) * [-737.052] (-738.836) (-740.472) (-737.816) -- 0:00:02
952500 -- (-737.514) [-741.285] (-738.741) (-741.556) * (-739.433) [-739.532] (-737.855) (-738.533) -- 0:00:02
953000 -- (-739.746) [-738.560] (-736.892) (-738.470) * (-740.692) (-741.818) (-738.720) [-737.780] -- 0:00:02
953500 -- [-738.613] (-739.041) (-737.118) (-740.486) * (-741.301) (-737.794) [-738.552] (-737.091) -- 0:00:02
954000 -- (-738.107) [-742.956] (-737.970) (-738.201) * (-745.445) [-737.848] (-741.893) (-741.422) -- 0:00:02
954500 -- (-737.666) [-741.804] (-739.351) (-738.773) * [-738.821] (-739.034) (-745.309) (-738.699) -- 0:00:02
955000 -- (-739.689) (-745.067) [-739.263] (-739.401) * (-738.219) [-739.973] (-741.667) (-741.445) -- 0:00:02
Average standard deviation of split frequencies: 0.008876
955500 -- (-738.842) [-740.243] (-739.338) (-740.669) * [-738.489] (-740.102) (-740.623) (-740.229) -- 0:00:02
956000 -- (-741.702) (-738.412) (-739.656) [-742.162] * (-739.607) (-740.440) [-740.849] (-738.001) -- 0:00:02
956500 -- (-741.435) (-739.002) [-738.570] (-743.358) * [-738.454] (-738.880) (-738.057) (-737.353) -- 0:00:02
957000 -- [-739.188] (-738.279) (-739.892) (-738.576) * (-737.289) (-738.256) [-738.403] (-737.198) -- 0:00:02
957500 -- (-745.095) [-738.821] (-740.785) (-741.059) * (-742.224) [-740.221] (-737.902) (-744.082) -- 0:00:02
958000 -- [-738.127] (-740.106) (-739.906) (-742.193) * (-740.089) [-737.778] (-738.910) (-739.145) -- 0:00:02
958500 -- (-742.550) (-741.332) [-738.415] (-739.175) * (-740.125) (-738.327) (-737.974) [-738.917] -- 0:00:02
959000 -- (-738.104) (-739.757) (-740.824) [-739.729] * (-738.275) (-738.863) (-737.421) [-738.395] -- 0:00:02
959500 -- (-739.273) [-740.260] (-738.518) (-740.395) * [-737.566] (-741.368) (-739.016) (-739.436) -- 0:00:02
960000 -- [-740.555] (-744.032) (-739.539) (-743.029) * (-739.817) (-740.282) [-739.816] (-739.679) -- 0:00:02
Average standard deviation of split frequencies: 0.008833
960500 -- (-741.703) (-738.726) [-737.657] (-739.681) * (-738.320) (-739.692) (-740.214) [-742.214] -- 0:00:02
961000 -- (-740.695) (-739.746) (-738.819) [-738.759] * (-738.597) (-740.208) (-744.014) [-738.504] -- 0:00:02
961500 -- (-740.537) (-741.586) (-737.382) [-737.265] * (-741.033) (-742.188) (-743.441) [-737.691] -- 0:00:02
962000 -- (-746.895) (-739.730) [-737.954] (-738.283) * (-738.099) (-742.465) [-745.033] (-740.463) -- 0:00:02
962500 -- [-741.590] (-739.232) (-740.495) (-739.769) * (-737.515) (-739.422) [-741.516] (-738.203) -- 0:00:02
963000 -- (-737.789) (-740.994) (-742.360) [-740.150] * [-738.071] (-738.787) (-739.897) (-739.963) -- 0:00:01
963500 -- (-739.352) (-739.888) [-740.326] (-739.482) * (-738.210) [-738.453] (-741.565) (-738.300) -- 0:00:01
964000 -- (-741.042) [-739.300] (-741.030) (-739.558) * (-739.022) (-739.637) (-740.715) [-738.135] -- 0:00:01
964500 -- [-741.438] (-739.861) (-740.733) (-739.850) * (-739.591) [-737.835] (-740.493) (-737.338) -- 0:00:01
965000 -- (-738.819) (-741.390) (-737.326) [-738.817] * [-740.450] (-737.599) (-744.307) (-737.585) -- 0:00:01
Average standard deviation of split frequencies: 0.008979
965500 -- (-739.046) (-743.567) [-737.767] (-738.322) * (-738.676) (-741.250) [-738.006] (-739.048) -- 0:00:01
966000 -- [-738.288] (-740.324) (-737.516) (-740.057) * (-737.854) (-741.635) [-738.066] (-741.455) -- 0:00:01
966500 -- (-742.492) (-740.672) [-738.114] (-738.301) * (-742.240) [-743.494] (-742.063) (-738.466) -- 0:00:01
967000 -- [-741.061] (-739.052) (-739.378) (-741.546) * (-741.361) (-739.700) [-741.137] (-739.594) -- 0:00:01
967500 -- (-741.421) (-740.244) (-741.696) [-738.727] * (-739.665) (-737.919) (-739.704) [-740.580] -- 0:00:01
968000 -- [-741.038] (-739.281) (-738.371) (-745.302) * [-739.101] (-741.141) (-740.098) (-740.054) -- 0:00:01
968500 -- (-739.307) (-738.565) [-740.197] (-737.633) * (-741.442) (-739.733) [-744.128] (-739.749) -- 0:00:01
969000 -- [-739.860] (-738.828) (-740.584) (-737.693) * [-740.215] (-738.291) (-740.265) (-739.996) -- 0:00:01
969500 -- (-745.524) (-737.870) (-741.860) [-740.576] * (-738.974) (-739.341) [-738.028] (-737.898) -- 0:00:01
970000 -- (-738.100) [-738.230] (-741.304) (-743.042) * (-739.477) (-741.818) [-738.193] (-739.897) -- 0:00:01
Average standard deviation of split frequencies: 0.009227
970500 -- (-739.257) [-737.535] (-740.584) (-738.010) * (-737.846) (-737.306) [-739.048] (-738.389) -- 0:00:01
971000 -- (-737.382) (-738.899) [-741.121] (-739.503) * [-737.608] (-737.937) (-740.521) (-744.723) -- 0:00:01
971500 -- (-737.026) [-739.971] (-741.715) (-745.948) * (-740.102) [-741.607] (-739.493) (-739.984) -- 0:00:01
972000 -- (-737.045) (-738.687) [-738.218] (-739.951) * (-741.276) (-740.182) (-741.437) [-740.096] -- 0:00:01
972500 -- (-738.274) [-741.889] (-738.275) (-742.390) * (-738.369) [-739.295] (-739.391) (-739.777) -- 0:00:01
973000 -- [-738.458] (-742.551) (-740.638) (-741.234) * (-737.955) [-739.041] (-741.893) (-739.799) -- 0:00:01
973500 -- (-738.000) (-743.178) (-739.271) [-739.009] * (-737.887) (-741.027) [-741.252] (-737.105) -- 0:00:01
974000 -- (-739.354) (-740.891) (-740.794) [-737.304] * (-737.370) (-738.986) (-738.787) [-738.777] -- 0:00:01
974500 -- [-738.425] (-739.970) (-739.066) (-742.792) * [-740.012] (-741.992) (-738.411) (-739.829) -- 0:00:01
975000 -- (-743.992) (-738.294) [-739.450] (-740.258) * (-738.123) (-740.426) [-738.866] (-740.993) -- 0:00:01
Average standard deviation of split frequencies: 0.009274
975500 -- [-739.143] (-740.826) (-741.602) (-738.195) * [-738.871] (-746.389) (-739.017) (-738.224) -- 0:00:01
976000 -- (-738.462) [-741.204] (-738.876) (-743.784) * [-738.982] (-741.001) (-738.073) (-738.941) -- 0:00:01
976500 -- (-737.158) (-740.490) [-739.657] (-742.622) * (-738.682) [-739.288] (-738.888) (-739.037) -- 0:00:01
977000 -- (-737.761) (-741.212) [-739.776] (-743.666) * [-740.528] (-739.829) (-739.765) (-739.190) -- 0:00:01
977500 -- (-739.902) [-739.115] (-738.283) (-738.301) * (-737.310) (-740.984) [-739.966] (-741.017) -- 0:00:01
978000 -- (-742.146) (-740.189) [-738.105] (-737.676) * [-738.295] (-739.560) (-738.835) (-739.346) -- 0:00:01
978500 -- (-737.929) (-738.188) [-738.978] (-740.945) * (-737.396) (-739.341) (-738.908) [-738.309] -- 0:00:01
979000 -- (-739.859) (-739.736) [-739.286] (-738.578) * (-738.343) [-738.136] (-740.099) (-738.192) -- 0:00:01
979500 -- (-739.657) (-740.099) (-739.405) [-738.854] * [-737.935] (-737.526) (-740.099) (-738.649) -- 0:00:01
980000 -- (-738.594) (-737.154) [-740.221] (-742.016) * [-737.348] (-739.014) (-737.607) (-737.275) -- 0:00:01
Average standard deviation of split frequencies: 0.009614
980500 -- (-738.841) (-739.018) [-738.806] (-742.740) * (-738.530) (-742.155) [-737.642] (-738.222) -- 0:00:01
981000 -- (-739.185) [-742.463] (-740.681) (-738.761) * (-737.869) (-743.660) (-739.778) [-737.980] -- 0:00:01
981500 -- (-739.346) (-739.022) (-738.953) [-742.638] * (-738.434) (-738.845) (-737.233) [-741.110] -- 0:00:00
982000 -- (-739.583) (-742.245) [-738.256] (-742.664) * [-740.762] (-739.871) (-737.233) (-737.581) -- 0:00:00
982500 -- (-737.309) [-738.579] (-738.242) (-738.948) * (-738.069) (-737.488) (-737.233) [-737.573] -- 0:00:00
983000 -- (-736.918) [-737.545] (-738.165) (-737.536) * (-739.298) [-739.519] (-741.683) (-738.364) -- 0:00:00
983500 -- [-739.054] (-737.699) (-739.991) (-739.941) * (-741.540) [-740.012] (-743.491) (-738.318) -- 0:00:00
984000 -- (-738.882) [-737.514] (-738.925) (-738.574) * (-740.532) [-738.691] (-738.556) (-738.176) -- 0:00:00
984500 -- [-737.989] (-737.519) (-738.406) (-741.140) * (-743.428) (-737.948) (-739.095) [-737.074] -- 0:00:00
985000 -- [-740.640] (-739.465) (-740.258) (-742.056) * [-738.092] (-738.980) (-740.024) (-738.142) -- 0:00:00
Average standard deviation of split frequencies: 0.009944
985500 -- [-737.320] (-739.605) (-738.061) (-743.131) * [-737.000] (-741.245) (-742.737) (-737.356) -- 0:00:00
986000 -- (-739.908) (-738.824) (-739.623) [-740.171] * (-738.623) (-738.137) [-740.394] (-737.447) -- 0:00:00
986500 -- (-737.628) (-741.940) (-739.833) [-740.386] * [-739.938] (-737.725) (-739.257) (-737.582) -- 0:00:00
987000 -- [-738.001] (-741.177) (-738.435) (-737.908) * (-738.059) [-737.644] (-740.962) (-737.255) -- 0:00:00
987500 -- (-738.074) (-737.759) [-737.717] (-738.388) * (-738.533) [-738.337] (-741.297) (-741.917) -- 0:00:00
988000 -- [-738.356] (-739.521) (-739.813) (-738.313) * (-738.062) (-742.102) (-738.706) [-737.480] -- 0:00:00
988500 -- [-738.153] (-738.280) (-739.580) (-738.126) * (-737.622) (-740.932) (-743.544) [-738.599] -- 0:00:00
989000 -- (-738.668) (-738.460) [-738.940] (-739.269) * (-738.422) (-737.805) (-744.583) [-739.657] -- 0:00:00
989500 -- (-739.209) (-739.480) [-738.299] (-737.661) * (-740.169) (-737.864) [-737.721] (-740.817) -- 0:00:00
990000 -- (-738.300) [-737.731] (-738.421) (-737.463) * (-740.159) [-738.065] (-739.110) (-742.689) -- 0:00:00
Average standard deviation of split frequencies: 0.009898
990500 -- (-738.198) (-738.186) [-738.862] (-737.492) * (-740.329) (-738.192) (-737.205) [-737.700] -- 0:00:00
991000 -- (-739.021) (-738.501) (-740.765) [-740.727] * (-738.163) (-738.866) [-738.025] (-739.783) -- 0:00:00
991500 -- [-739.908] (-739.599) (-740.080) (-739.711) * [-737.892] (-738.040) (-741.852) (-744.513) -- 0:00:00
992000 -- (-738.588) (-738.746) [-740.993] (-739.666) * (-739.562) (-740.489) [-740.021] (-740.580) -- 0:00:00
992500 -- (-739.760) (-740.148) (-748.101) [-738.492] * (-742.566) (-742.504) [-741.304] (-739.127) -- 0:00:00
993000 -- (-737.420) (-741.316) [-738.287] (-741.817) * (-737.322) [-739.671] (-743.007) (-740.554) -- 0:00:00
993500 -- [-737.784] (-739.998) (-738.184) (-738.354) * [-737.126] (-738.905) (-742.820) (-737.447) -- 0:00:00
994000 -- (-740.166) [-739.824] (-738.493) (-739.489) * [-739.069] (-740.559) (-740.803) (-738.463) -- 0:00:00
994500 -- (-740.141) [-743.306] (-738.045) (-741.093) * (-741.936) (-743.521) [-739.174] (-739.699) -- 0:00:00
995000 -- (-745.315) (-739.132) [-739.901] (-737.352) * (-740.931) (-741.546) [-742.881] (-743.603) -- 0:00:00
Average standard deviation of split frequencies: 0.009750
995500 -- (-742.458) (-741.562) (-740.881) [-738.177] * (-737.318) (-738.436) [-739.585] (-741.230) -- 0:00:00
996000 -- (-740.128) (-739.968) [-738.719] (-738.331) * (-739.186) (-739.409) [-739.820] (-743.078) -- 0:00:00
996500 -- (-737.973) (-737.970) (-740.277) [-739.766] * (-740.399) (-742.731) [-738.347] (-738.927) -- 0:00:00
997000 -- (-737.759) (-741.180) (-738.096) [-738.463] * [-743.379] (-740.346) (-738.020) (-740.735) -- 0:00:00
997500 -- (-738.094) (-740.166) [-740.889] (-737.527) * (-738.626) (-741.209) [-737.028] (-740.837) -- 0:00:00
998000 -- (-741.275) (-741.529) (-741.786) [-738.849] * (-737.720) [-740.904] (-738.560) (-740.813) -- 0:00:00
998500 -- (-745.791) (-738.749) [-741.621] (-742.333) * [-737.488] (-739.818) (-741.719) (-739.030) -- 0:00:00
999000 -- (-740.891) (-739.855) [-740.208] (-738.175) * (-739.132) [-739.211] (-739.707) (-741.355) -- 0:00:00
999500 -- (-741.480) (-747.232) [-737.187] (-738.956) * (-740.307) (-740.821) (-737.848) [-740.566] -- 0:00:00
1000000 -- (-737.779) (-739.016) [-736.967] (-739.095) * (-739.482) [-738.056] (-737.186) (-739.982) -- 0:00:00
Average standard deviation of split frequencies: 0.009893
Analysis completed in 54 seconds
Analysis used 52.63 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -736.77
Likelihood of best state for "cold" chain of run 2 was -736.77
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.8 % ( 30 %) Dirichlet(Pi{all})
32.8 % ( 31 %) Slider(Pi{all})
78.3 % ( 53 %) Multiplier(Alpha{1,2})
78.3 % ( 62 %) Multiplier(Alpha{3})
23.3 % ( 34 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
98.3 % ( 99 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
85.0 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 30 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
31.5 % ( 31 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.9 % ( 27 %) Dirichlet(Pi{all})
32.3 % ( 31 %) Slider(Pi{all})
78.4 % ( 50 %) Multiplier(Alpha{1,2})
77.7 % ( 54 %) Multiplier(Alpha{3})
23.7 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
98.3 % (100 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
85.2 % ( 79 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
31.4 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.53
2 | 166779 0.84 0.69
3 | 166472 166263 0.85
4 | 166373 166924 167189
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.67 0.54
2 | 166954 0.84 0.70
3 | 166305 165940 0.85
4 | 167181 166775 166845
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -738.47
| 2 |
| 2 1 |
| 2 2 2 |
| 2 1 1 111 1 |
| 1 1 2 2 1 2 21 2 2 2 |
| 2 1 2 2 22 1 11 1 1 2|
| 2 2 2 1 2 2 2 2 2 1 1 1 2 2 2 2 2 1|
|2 1 1 * 22 2 2 * 2 21 21 1 1 |
| 2 * 1 1 1 1 * 12 2 1 1 1 2 1 |
|112 1 11 2 2 2 2 2 * 2 |
| 1 2 1 11 1 2 |
| 1 1 |
| 1 1 2 2 |
| 1 1 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -740.19
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -738.55 -741.99
2 -738.45 -743.25
--------------------------------------
TOTAL -738.49 -742.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.699620 0.070222 0.218391 1.209717 0.662556 1405.43 1453.22 1.000
r(A<->C){all} 0.167493 0.020951 0.000424 0.462585 0.124939 190.69 228.26 1.003
r(A<->G){all} 0.163548 0.019990 0.000054 0.462380 0.122722 167.59 189.47 1.001
r(A<->T){all} 0.168043 0.020112 0.000135 0.458560 0.130684 189.76 257.06 1.000
r(C<->G){all} 0.177677 0.021336 0.000038 0.467690 0.144266 163.54 257.34 1.000
r(C<->T){all} 0.164997 0.020843 0.000072 0.457211 0.120740 172.70 212.10 1.002
r(G<->T){all} 0.158243 0.018373 0.000009 0.427983 0.122321 279.50 300.89 1.000
pi(A){all} 0.212969 0.000309 0.180432 0.248976 0.212752 1142.23 1261.24 1.000
pi(C){all} 0.307320 0.000396 0.268487 0.344905 0.307275 1235.89 1316.62 1.002
pi(G){all} 0.293507 0.000401 0.255125 0.333940 0.293696 1180.96 1307.25 1.000
pi(T){all} 0.186204 0.000277 0.154793 0.218666 0.185417 1234.84 1367.92 1.002
alpha{1,2} 0.422802 0.240335 0.000231 1.392820 0.252505 1322.11 1347.68 1.000
alpha{3} 0.456241 0.235051 0.000220 1.392285 0.305538 1109.92 1141.21 1.000
pinvar{all} 0.996958 0.000013 0.990220 1.000000 0.998158 1152.70 1326.85 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- .***.
7 -- .*..*
8 -- .*.**
9 -- ..*.*
10 -- ..**.
11 -- .**.*
12 -- .*.*.
13 -- ..***
14 -- ...**
15 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 628 0.209194 0.016959 0.197202 0.221186 2
7 625 0.208195 0.019315 0.194537 0.221852 2
8 625 0.208195 0.005182 0.204530 0.211859 2
9 609 0.202865 0.001413 0.201865 0.203864 2
10 604 0.201199 0.015075 0.190540 0.211859 2
11 598 0.199201 0.020728 0.184544 0.213857 2
12 589 0.196203 0.008009 0.190540 0.201865 2
13 584 0.194537 0.002827 0.192538 0.196536 2
14 574 0.191206 0.006595 0.186542 0.195869 2
15 568 0.189207 0.002827 0.187209 0.191206 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100515 0.010415 0.000061 0.299948 0.069945 1.001 2
length{all}[2] 0.101203 0.010688 0.000010 0.313717 0.069076 1.000 2
length{all}[3] 0.099338 0.010080 0.000037 0.294739 0.068187 1.000 2
length{all}[4] 0.098043 0.009386 0.000030 0.291620 0.068576 1.000 2
length{all}[5] 0.101320 0.009882 0.000011 0.300082 0.071581 1.000 2
length{all}[6] 0.095456 0.008666 0.000058 0.285664 0.069312 0.999 2
length{all}[7] 0.102658 0.011006 0.000153 0.311370 0.070390 0.999 2
length{all}[8] 0.098508 0.008886 0.000120 0.286785 0.072898 1.002 2
length{all}[9] 0.104546 0.011659 0.000098 0.305869 0.073747 1.000 2
length{all}[10] 0.105847 0.011027 0.000036 0.320230 0.074322 0.998 2
length{all}[11] 0.105105 0.010389 0.000065 0.302561 0.077596 0.998 2
length{all}[12] 0.092316 0.009708 0.000238 0.279429 0.064425 1.000 2
length{all}[13] 0.098092 0.010724 0.000553 0.286061 0.064721 0.998 2
length{all}[14] 0.094929 0.009629 0.000426 0.281649 0.064326 0.998 2
length{all}[15] 0.098104 0.009356 0.000167 0.296715 0.072119 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009893
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
+------------------------------------------------------------------------ C3 (3)
|
|------------------------------------------------------------------------ C4 (4)
|
\------------------------------------------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
+--------------------------------------------------------------------- C3 (3)
|
|--------------------------------------------------------------------- C4 (4)
|
\------------------------------------------------------------------------ C5 (5)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (15 trees sampled):
50 % credible set contains 7 trees
90 % credible set contains 14 trees
95 % credible set contains 15 trees
99 % credible set contains 15 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 5 ls = 540
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
Compressing, 50 patterns at 180 / 180 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 50 patterns at 180 / 180 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
48800 bytes for conP
4400 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.098327 0.101724 0.081828 0.086538 0.036395 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -791.844595
Iterating by ming2
Initial: fx= 791.844595
x= 0.09833 0.10172 0.08183 0.08654 0.03639 0.30000 1.30000
1 h-m-p 0.0000 0.0002 391.6924 +++ 760.112625 m 0.0002 13 | 1/7
2 h-m-p 0.0011 0.0055 54.9496 -----------.. | 1/7
3 h-m-p 0.0000 0.0003 351.8118 +++ 727.883594 m 0.0003 43 | 2/7
4 h-m-p 0.0018 0.0090 33.8691 ------------.. | 2/7
5 h-m-p 0.0000 0.0000 306.8238 ++ 725.348550 m 0.0000 73 | 3/7
6 h-m-p 0.0003 0.0160 20.1320 ----------.. | 3/7
7 h-m-p 0.0000 0.0001 250.5291 ++ 721.107612 m 0.0001 101 | 4/7
8 h-m-p 0.0009 0.0255 12.9679 -----------.. | 4/7
9 h-m-p 0.0000 0.0000 177.4503 ++ 720.494733 m 0.0000 130 | 5/7
10 h-m-p 0.0797 8.0000 0.0000 C 720.494733 0 0.0199 140 | 5/7
11 h-m-p 1.6000 8.0000 0.0000 ----C 720.494733 0 0.0016 156
Out..
lnL = -720.494733
157 lfun, 157 eigenQcodon, 785 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.082988 0.091839 0.029485 0.037449 0.013234 0.299793 0.845365 0.119766
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 17.706913
np = 8
lnL0 = -763.550353
Iterating by ming2
Initial: fx= 763.550353
x= 0.08299 0.09184 0.02949 0.03745 0.01323 0.29979 0.84537 0.11977
1 h-m-p 0.0000 0.0001 363.1732 ++ 752.820370 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0002 265.0908 ++ 741.796177 m 0.0002 24 | 2/8
3 h-m-p 0.0000 0.0000 488.7904 ++ 738.178705 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0001 1162.2740 ++ 730.636718 m 0.0001 46 | 4/8
5 h-m-p 0.0015 0.0074 20.4009 -----------.. | 4/8
6 h-m-p 0.0000 0.0001 238.7196 ++ 722.224365 m 0.0001 77 | 5/8
7 h-m-p 0.0041 0.0585 5.8915 ------------.. | 5/8
8 h-m-p 0.0000 0.0001 175.2654 ++ 720.494723 m 0.0001 109 | 6/8
9 h-m-p 0.3641 8.0000 0.0000 +++ 720.494723 m 8.0000 121 | 6/8
10 h-m-p 0.0917 8.0000 0.0004 ++++ 720.494723 m 8.0000 136 | 6/8
11 h-m-p 0.0067 0.4860 0.5019 -----------N 720.494723 0 0.0000 160 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 -------Y 720.494723 0 0.0000 180 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 ---------C 720.494723 0 0.0000 202
Out..
lnL = -720.494723
203 lfun, 609 eigenQcodon, 2030 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.047469 0.076434 0.109272 0.106595 0.038246 0.287117 0.985734 0.346705 0.252375 1.538126
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.021821
np = 10
lnL0 = -783.715436
Iterating by ming2
Initial: fx= 783.715436
x= 0.04747 0.07643 0.10927 0.10660 0.03825 0.28712 0.98573 0.34671 0.25237 1.53813
1 h-m-p 0.0000 0.0002 353.7282 +++ 752.849658 m 0.0002 16 | 1/10
2 h-m-p 0.0001 0.0003 150.1124 ++ 746.388123 m 0.0003 29 | 2/10
3 h-m-p 0.0000 0.0001 2305.9425 ++ 731.810755 m 0.0001 42 | 3/10
4 h-m-p 0.0000 0.0001 1284.4946 ++ 725.337226 m 0.0001 55 | 4/10
5 h-m-p 0.0058 0.0554 7.0153 ------------.. | 4/10
6 h-m-p 0.0000 0.0001 245.8434 ++ 720.983444 m 0.0001 91 | 5/10
7 h-m-p 0.0036 0.1000 3.4277 ------------.. | 5/10
8 h-m-p 0.0000 0.0000 176.8986 ++ 720.494728 m 0.0000 127 | 6/10
9 h-m-p 0.0257 8.0000 0.0000 +++++ 720.494728 m 8.0000 143 | 6/10
10 h-m-p 0.0921 8.0000 0.0002 -----Y 720.494728 0 0.0000 165
Out..
lnL = -720.494728
166 lfun, 664 eigenQcodon, 2490 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -720.502208 S = -720.492656 -0.003654
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:01
did 20 / 50 patterns 0:01
did 30 / 50 patterns 0:01
did 40 / 50 patterns 0:02
did 50 / 50 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.033689 0.080678 0.095976 0.018839 0.109950 0.260670 0.504857 1.198351
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.904214
np = 8
lnL0 = -777.818855
Iterating by ming2
Initial: fx= 777.818855
x= 0.03369 0.08068 0.09598 0.01884 0.10995 0.26067 0.50486 1.19835
1 h-m-p 0.0000 0.0001 362.8062 ++ 762.570378 m 0.0001 13 | 1/8
2 h-m-p 0.0008 0.0059 46.0051 ++ 753.436082 m 0.0059 24 | 2/8
3 h-m-p 0.0002 0.0009 78.6570 ++ 740.280851 m 0.0009 35 | 3/8
4 h-m-p 0.0003 0.0015 93.1065 ++ 736.815256 m 0.0015 46 | 4/8
5 h-m-p 0.0018 0.0124 41.6315 ------------.. | 4/8
6 h-m-p 0.0000 0.0002 238.1245 +++ 726.055159 m 0.0002 79 | 5/8
7 h-m-p 0.0026 0.0224 12.0257 ------------.. | 5/8
8 h-m-p 0.0000 0.0002 172.4027 +++ 720.494709 m 0.0002 112 | 6/8
9 h-m-p 1.6000 8.0000 0.0000 ++ 720.494709 m 8.0000 123 | 6/8
10 h-m-p 0.0160 8.0000 0.0124 --------C 720.494709 0 0.0000 144 | 6/8
11 h-m-p 0.0160 8.0000 0.0000 -C 720.494709 0 0.0010 158 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
13 h-m-p 0.0160 8.0000 0.0000 +++++ 720.494709 m 8.0000 198 | 6/8
14 h-m-p 0.0160 8.0000 0.2439 -----------Y 720.494709 0 0.0000 222 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 +++++ 720.494709 m 8.0000 238 | 6/8
16 h-m-p 0.0160 8.0000 0.2737 ---------C 720.494709 0 0.0000 260 | 6/8
17 h-m-p 0.0160 8.0000 0.0001 -----C 720.494709 0 0.0000 278 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 ------N 720.494709 0 0.0000 297
Out..
lnL = -720.494709
298 lfun, 3278 eigenQcodon, 14900 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.097825 0.084244 0.083392 0.054883 0.044537 0.000100 0.900000 0.386963 1.371962 1.299991
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.308724
np = 10
lnL0 = -779.638789
Iterating by ming2
Initial: fx= 779.638789
x= 0.09782 0.08424 0.08339 0.05488 0.04454 0.00011 0.90000 0.38696 1.37196 1.29999
1 h-m-p 0.0000 0.0000 335.1764 ++ 779.438774 m 0.0000 15 | 1/10
2 h-m-p 0.0000 0.0014 180.7772 ++++ 744.437598 m 0.0014 30 | 2/10
3 h-m-p 0.0000 0.0000 9810.3988 ++ 737.634237 m 0.0000 43 | 3/10
4 h-m-p 0.0013 0.0077 39.1330 ++ 729.210432 m 0.0077 56 | 4/10
5 h-m-p 0.0000 0.0001 2046.6453 ++ 721.479221 m 0.0001 69 | 5/10
6 h-m-p 0.0001 0.0006 84.4200 ++ 721.226943 m 0.0006 82 | 6/10
7 h-m-p 0.0000 0.0002 605.7998 ++ 720.494713 m 0.0002 95 | 7/10
8 h-m-p 1.6000 8.0000 0.0004 ++ 720.494713 m 8.0000 108 | 7/10
9 h-m-p 0.0138 1.8628 0.2574 ++++ 720.494692 m 1.8628 126 | 8/10
10 h-m-p 1.6000 8.0000 0.0001 C 720.494692 0 0.4000 142 | 8/10
11 h-m-p 0.7403 8.0000 0.0001 Y 720.494692 0 0.1851 157 | 8/10
12 h-m-p 1.0000 8.0000 0.0000 +C 720.494692 0 4.0000 173 | 8/10
13 h-m-p 0.7500 8.0000 0.0001 ---N 720.494692 0 0.0029 191 | 8/10
14 h-m-p 0.0685 8.0000 0.0000 C 720.494692 0 0.0685 206 | 8/10
15 h-m-p 0.0649 8.0000 0.0000 Y 720.494692 0 0.0162 221 | 8/10
16 h-m-p 0.0160 8.0000 4.9813 -------------.. | 8/10
17 h-m-p 0.0160 8.0000 0.0000 N 720.494692 0 0.0040 260
Out..
lnL = -720.494692
261 lfun, 3132 eigenQcodon, 14355 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -720.531554 S = -720.495264 -0.016027
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:10
did 20 / 50 patterns 0:10
did 30 / 50 patterns 0:10
did 40 / 50 patterns 0:10
did 50 / 50 patterns 0:10
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=180
NC_011896_1_WP_010909036_1_2878_MLBR_RS13710 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
NC_002677_1_NP_302717_1_1589_ML2691 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR
**************************************************
NC_011896_1_WP_010909036_1_2878_MLBR_RS13710 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
NC_002677_1_NP_302717_1_1589_ML2691 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160 LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH
**************************************************
NC_011896_1_WP_010909036_1_2878_MLBR_RS13710 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
NC_002677_1_NP_302717_1_1589_ML2691 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160 LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ
**************************************************
NC_011896_1_WP_010909036_1_2878_MLBR_RS13710 LGLESSEREVKWLNELIAAERALLGRVEQT
NC_002677_1_NP_302717_1_1589_ML2691 LGLESSEREVKWLNELIAAERALLGRVEQT
NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505 LGLESSEREVKWLNELIAAERALLGRVEQT
NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835 LGLESSEREVKWLNELIAAERALLGRVEQT
NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160 LGLESSEREVKWLNELIAAERALLGRVEQT
******************************
>NC_011896_1_WP_010909036_1_2878_MLBR_RS13710 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG >NC_002677_1_NP_302717_1_1589_ML2691 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG >NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG >NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG >NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160 ATGCTGGAACTCGCCATCCTGGGTCTTCTTATCGAGTCGCCGATGCACGG CTACGAATTACGGAAACGGCTAACCGGGTTACTCGGTGCATTCCGGGCAT TTTCGTATGGCTCGCTTTACCCTGCTCTGCGTCGAATGCAAGCTGACAGG CTAATCACCGGGCACGTCGCACCGGCCGGGACTCCGGTGCGACGTGCCCG GCAGGTATACCAACTGACAGACGCAGGCCGCCGGCGCTTCAGCGAGCTGG TAACTGACACCGGGCCGGACAATTACACCGACAACGGTTTCGGGGTGCAC TTAGCGTTTTTCAACCGCACACCAGCGGAAGCCCGGATGCGCATCTTGGA AGGCCGTCGCCGTCGGGTCGAAGAACGCCGCGAAGGTTTACGCGAGGCAG TAACGCGAGCCAGCAATTCGTTCGACCGTTATACCCGCCAACTACATCAA CTCGGGCTCGAGTCCAGCGAACGCGAAGTCAAGTGGCTCAACGAACTGAT TGCCGCTGAACGGGCACTACTCGGCCGTGTCGAGCAGACG
>NC_011896_1_WP_010909036_1_2878_MLBR_RS13710 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ LGLESSEREVKWLNELIAAERALLGRVEQT >NC_002677_1_NP_302717_1_1589_ML2691 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ LGLESSEREVKWLNELIAAERALLGRVEQT >NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ LGLESSEREVKWLNELIAAERALLGRVEQT >NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ LGLESSEREVKWLNELIAAERALLGRVEQT >NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160 MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADR LITGHVAPAGTPVRRARQVYQLTDAGRRRFSELVTDTGPDNYTDNGFGVH LAFFNRTPAEARMRILEGRRRRVEERREGLREAVTRASNSFDRYTRQLHQ LGLESSEREVKWLNELIAAERALLGRVEQT
#NEXUS
[ID: 9382846395]
begin taxa;
dimensions ntax=5;
taxlabels
NC_011896_1_WP_010909036_1_2878_MLBR_RS13710
NC_002677_1_NP_302717_1_1589_ML2691
NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505
NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835
NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160
;
end;
begin trees;
translate
1 NC_011896_1_WP_010909036_1_2878_MLBR_RS13710,
2 NC_002677_1_NP_302717_1_1589_ML2691,
3 NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505,
4 NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835,
5 NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06994501,2:0.06907601,3:0.06818698,4:0.06857592,5:0.07158089);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06994501,2:0.06907601,3:0.06818698,4:0.06857592,5:0.07158089);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -738.55 -741.99
2 -738.45 -743.25
--------------------------------------
TOTAL -738.49 -742.81
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2691/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.699620 0.070222 0.218391 1.209717 0.662556 1405.43 1453.22 1.000
r(A<->C){all} 0.167493 0.020951 0.000424 0.462585 0.124939 190.69 228.26 1.003
r(A<->G){all} 0.163548 0.019990 0.000054 0.462380 0.122722 167.59 189.47 1.001
r(A<->T){all} 0.168043 0.020112 0.000135 0.458560 0.130684 189.76 257.06 1.000
r(C<->G){all} 0.177677 0.021336 0.000038 0.467690 0.144266 163.54 257.34 1.000
r(C<->T){all} 0.164997 0.020843 0.000072 0.457211 0.120740 172.70 212.10 1.002
r(G<->T){all} 0.158243 0.018373 0.000009 0.427983 0.122321 279.50 300.89 1.000
pi(A){all} 0.212969 0.000309 0.180432 0.248976 0.212752 1142.23 1261.24 1.000
pi(C){all} 0.307320 0.000396 0.268487 0.344905 0.307275 1235.89 1316.62 1.002
pi(G){all} 0.293507 0.000401 0.255125 0.333940 0.293696 1180.96 1307.25 1.000
pi(T){all} 0.186204 0.000277 0.154793 0.218666 0.185417 1234.84 1367.92 1.002
alpha{1,2} 0.422802 0.240335 0.000231 1.392820 0.252505 1322.11 1347.68 1.000
alpha{3} 0.456241 0.235051 0.000220 1.392285 0.305538 1109.92 1141.21 1.000
pinvar{all} 0.996958 0.000013 0.990220 1.000000 0.998158 1152.70 1326.85 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/ML2691/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 180
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 | Ser TCT 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 | Cys TGT 0 0 0 0 0
TTC 5 5 5 5 5 | TCC 1 1 1 1 1 | TAC 4 4 4 4 4 | TGC 0 0 0 0 0
Leu TTA 4 4 4 4 4 | TCA 0 0 0 0 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 1 1 1 1 1 | TCG 4 4 4 4 4 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 | Pro CCT 1 1 1 1 1 | His CAT 1 1 1 1 1 | Arg CGT 6 6 6 6 6
CTC 6 6 6 6 6 | CCC 0 0 0 0 0 | CAC 3 3 3 3 3 | CGC 10 10 10 10 10
CTA 4 4 4 4 4 | CCA 1 1 1 1 1 | Gln CAA 4 4 4 4 4 | CGA 3 3 3 3 3
CTG 6 6 6 6 6 | CCG 4 4 4 4 4 | CAG 2 2 2 2 2 | CGG 8 8 8 8 8
----------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 | Thr ACT 2 2 2 2 2 | Asn AAT 2 2 2 2 2 | Ser AGT 0 0 0 0 0
ATC 4 4 4 4 4 | ACC 5 5 5 5 5 | AAC 3 3 3 3 3 | AGC 3 3 3 3 3
ATA 0 0 0 0 0 | ACA 2 2 2 2 2 | Lys AAA 1 1 1 1 1 | Arg AGA 0 0 0 0 0
Met ATG 4 4 4 4 4 | ACG 2 2 2 2 2 | AAG 1 1 1 1 1 | AGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 | Ala GCT 3 3 3 3 3 | Asp GAT 0 0 0 0 0 | Gly GGT 4 4 4 4 4
GTC 4 4 4 4 4 | GCC 6 6 6 6 6 | GAC 6 6 6 6 6 | GGC 5 5 5 5 5
GTA 3 3 3 3 3 | GCA 6 6 6 6 6 | Glu GAA 11 11 11 11 11 | GGA 0 0 0 0 0
GTG 2 2 2 2 2 | GCG 2 2 2 2 2 | GAG 5 5 5 5 5 | GGG 6 6 6 6 6
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909036_1_2878_MLBR_RS13710
position 1: T:0.13333 C:0.34444 A:0.17222 G:0.35000
position 2: T:0.27222 C:0.21667 A:0.25000 G:0.26111
position 3: T:0.15000 C:0.36111 A:0.21667 G:0.27222
Average T:0.18519 C:0.30741 A:0.21296 G:0.29444
#2: NC_002677_1_NP_302717_1_1589_ML2691
position 1: T:0.13333 C:0.34444 A:0.17222 G:0.35000
position 2: T:0.27222 C:0.21667 A:0.25000 G:0.26111
position 3: T:0.15000 C:0.36111 A:0.21667 G:0.27222
Average T:0.18519 C:0.30741 A:0.21296 G:0.29444
#3: NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505
position 1: T:0.13333 C:0.34444 A:0.17222 G:0.35000
position 2: T:0.27222 C:0.21667 A:0.25000 G:0.26111
position 3: T:0.15000 C:0.36111 A:0.21667 G:0.27222
Average T:0.18519 C:0.30741 A:0.21296 G:0.29444
#4: NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835
position 1: T:0.13333 C:0.34444 A:0.17222 G:0.35000
position 2: T:0.27222 C:0.21667 A:0.25000 G:0.26111
position 3: T:0.15000 C:0.36111 A:0.21667 G:0.27222
Average T:0.18519 C:0.30741 A:0.21296 G:0.29444
#5: NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160
position 1: T:0.13333 C:0.34444 A:0.17222 G:0.35000
position 2: T:0.27222 C:0.21667 A:0.25000 G:0.26111
position 3: T:0.15000 C:0.36111 A:0.21667 G:0.27222
Average T:0.18519 C:0.30741 A:0.21296 G:0.29444
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 10 | Ser S TCT 0 | Tyr Y TAT 10 | Cys C TGT 0
TTC 25 | TCC 5 | TAC 20 | TGC 0
Leu L TTA 20 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 5 | TCG 20 | TAG 0 | Trp W TGG 5
------------------------------------------------------------------------------
Leu L CTT 15 | Pro P CCT 5 | His H CAT 5 | Arg R CGT 30
CTC 30 | CCC 0 | CAC 15 | CGC 50
CTA 20 | CCA 5 | Gln Q CAA 20 | CGA 15
CTG 30 | CCG 20 | CAG 10 | CGG 40
------------------------------------------------------------------------------
Ile I ATT 5 | Thr T ACT 10 | Asn N AAT 10 | Ser S AGT 0
ATC 20 | ACC 25 | AAC 15 | AGC 15
ATA 0 | ACA 10 | Lys K AAA 5 | Arg R AGA 0
Met M ATG 20 | ACG 10 | AAG 5 | AGG 5
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 15 | Asp D GAT 0 | Gly G GGT 20
GTC 20 | GCC 30 | GAC 30 | GGC 25
GTA 15 | GCA 30 | Glu E GAA 55 | GGA 0
GTG 10 | GCG 10 | GAG 25 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13333 C:0.34444 A:0.17222 G:0.35000
position 2: T:0.27222 C:0.21667 A:0.25000 G:0.26111
position 3: T:0.15000 C:0.36111 A:0.21667 G:0.27222
Average T:0.18519 C:0.30741 A:0.21296 G:0.29444
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5); MP score: 0
lnL(ntime: 5 np: 7): -720.494733 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.000004 0.000004 0.299793 1.299991
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004);
(NC_011896_1_WP_010909036_1_2878_MLBR_RS13710: 0.000004, NC_002677_1_NP_302717_1_1589_ML2691: 0.000004, NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505: 0.000004, NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835: 0.000004, NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29979
omega (dN/dS) = 1.29999
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 405.3 134.7 1.3000 0.0000 0.0000 0.0 0.0
6..2 0.000 405.3 134.7 1.3000 0.0000 0.0000 0.0 0.0
6..3 0.000 405.3 134.7 1.3000 0.0000 0.0000 0.0 0.0
6..4 0.000 405.3 134.7 1.3000 0.0000 0.0000 0.0 0.0
6..5 0.000 405.3 134.7 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 0
lnL(ntime: 5 np: 8): -720.494723 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.000004 0.000004 0.287117 0.806104 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004);
(NC_011896_1_WP_010909036_1_2878_MLBR_RS13710: 0.000004, NC_002677_1_NP_302717_1_1589_ML2691: 0.000004, NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505: 0.000004, NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835: 0.000004, NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.28712
MLEs of dN/dS (w) for site classes (K=2)
p: 0.80610 0.19390
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 405.6 134.4 0.1939 0.0000 0.0000 0.0 0.0
6..2 0.000 405.6 134.4 0.1939 0.0000 0.0000 0.0 0.0
6..3 0.000 405.6 134.4 0.1939 0.0000 0.0000 0.0 0.0
6..4 0.000 405.6 134.4 0.1939 0.0000 0.0000 0.0 0.0
6..5 0.000 405.6 134.4 0.1939 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 0
lnL(ntime: 5 np: 10): -720.494728 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.000004 0.000004 0.260670 0.536719 0.268294 0.000001 1.599662
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004);
(NC_011896_1_WP_010909036_1_2878_MLBR_RS13710: 0.000004, NC_002677_1_NP_302717_1_1589_ML2691: 0.000004, NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505: 0.000004, NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835: 0.000004, NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.26067
MLEs of dN/dS (w) for site classes (K=3)
p: 0.53672 0.26829 0.19499
w: 0.00000 1.00000 1.59966
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 406.1 133.9 0.5802 0.0000 0.0000 0.0 0.0
6..2 0.000 406.1 133.9 0.5802 0.0000 0.0000 0.0 0.0
6..3 0.000 406.1 133.9 0.5802 0.0000 0.0000 0.0 0.0
6..4 0.000 406.1 133.9 0.5802 0.0000 0.0000 0.0 0.0
6..5 0.000 406.1 133.9 0.5802 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909036_1_2878_MLBR_RS13710)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909036_1_2878_MLBR_RS13710)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 0
lnL(ntime: 5 np: 8): -720.494709 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.273019 1.091861
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004);
(NC_011896_1_WP_010909036_1_2878_MLBR_RS13710: 0.000004, NC_002677_1_NP_302717_1_1589_ML2691: 0.000004, NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505: 0.000004, NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835: 0.000004, NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.27302 q = 1.09186
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00002 0.00085 0.00553 0.01899 0.04778 0.10003 0.18569 0.31710 0.51080 0.79448
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 412.1 127.9 0.1981 0.0000 0.0000 0.0 0.0
6..2 0.000 412.1 127.9 0.1981 0.0000 0.0000 0.0 0.0
6..3 0.000 412.1 127.9 0.1981 0.0000 0.0000 0.0 0.0
6..4 0.000 412.1 127.9 0.1981 0.0000 0.0000 0.0 0.0
6..5 0.000 412.1 127.9 0.1981 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 0
lnL(ntime: 5 np: 10): -720.494692 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.611471 2.256845
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004);
(NC_011896_1_WP_010909036_1_2878_MLBR_RS13710: 0.000004, NC_002677_1_NP_302717_1_1589_ML2691: 0.000004, NZ_LYPH01000023_1_WP_010909036_1_944_A8144_RS04505: 0.000004, NZ_CP029543_1_WP_010909036_1_2916_DIJ64_RS14835: 0.000004, NZ_AP014567_1_WP_010909036_1_2981_JK2ML_RS15160: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.61147
(p1 = 0.00001) w = 2.25685
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.25685
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 412.1 127.9 0.0000 0.0000 0.0000 0.0 0.0
6..2 0.000 412.1 127.9 0.0000 0.0000 0.0000 0.0 0.0
6..3 0.000 412.1 127.9 0.0000 0.0000 0.0000 0.0 0.0
6..4 0.000 412.1 127.9 0.0000 0.0000 0.0000 0.0 0.0
6..5 0.000 412.1 127.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909036_1_2878_MLBR_RS13710)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.097
Time used: 0:10
Model 1: NearlyNeutral -720.494723 Model 2: PositiveSelection -720.494728 Model 0: one-ratio -720.494733 Model 7: beta -720.494709 Model 8: beta&w>1 -720.494692 Model 0 vs 1 1.9999999949504854E-5 Model 2 vs 1 9.999999974752427E-6 Model 8 vs 7 3.399999991415825E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
