--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 12:46:55 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/mtrA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -936.24 -939.61
2 -936.21 -939.30
--------------------------------------
TOTAL -936.23 -939.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889810 0.086692 0.377000 1.477674 0.852056 1501.00 1501.00 1.000
r(A<->C){all} 0.169106 0.021086 0.000020 0.467647 0.132679 150.26 172.70 1.002
r(A<->G){all} 0.148017 0.016597 0.000053 0.408366 0.109741 228.50 336.54 1.000
r(A<->T){all} 0.173098 0.021337 0.000075 0.465865 0.135925 241.62 293.49 1.000
r(C<->G){all} 0.165762 0.019859 0.000044 0.446801 0.129728 231.27 259.01 1.000
r(C<->T){all} 0.164467 0.018159 0.000128 0.423977 0.133625 277.74 299.68 1.001
r(G<->T){all} 0.179549 0.023153 0.000156 0.479315 0.141236 166.30 207.56 1.003
pi(A){all} 0.197203 0.000242 0.167046 0.226481 0.197280 1194.25 1237.66 1.000
pi(C){all} 0.270558 0.000284 0.237853 0.303235 0.270536 1177.48 1217.22 1.000
pi(G){all} 0.322447 0.000317 0.289098 0.357976 0.321956 1165.43 1220.05 1.000
pi(T){all} 0.209791 0.000235 0.177034 0.237451 0.209804 1293.09 1305.06 1.000
alpha{1,2} 0.417465 0.216165 0.000102 1.357231 0.257643 973.44 1002.40 1.001
alpha{3} 0.467979 0.260066 0.000110 1.494485 0.302526 1355.75 1359.31 1.000
pinvar{all} 0.997693 0.000008 0.992064 0.999999 0.998590 1156.44 1282.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -887.819769
Model 2: PositiveSelection -887.819814
Model 0: one-ratio -887.819873
Model 7: beta -887.819546
Model 8: beta&w>1 -887.819499
Model 0 vs 1 2.080000001569715E-4
Model 2 vs 1 9.000000000014552E-5
Model 8 vs 7 9.399999999004649E-5
>C1
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
>C2
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
>C3
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
>C4
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
>C5
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
>C6
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=228
C1 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
C2 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
C3 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
C4 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
C5 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
C6 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
**************************************************
C1 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
C2 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
C3 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
C4 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
C5 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
C6 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
**************************************************
C1 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
C2 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
C3 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
C4 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
C5 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
C6 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
**************************************************
C1 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
C2 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
C3 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
C4 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
C5 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
C6 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
**************************************************
C1 LRAKVEKDPENPTVVLTVRGVGYKAGPP
C2 LRAKVEKDPENPTVVLTVRGVGYKAGPP
C3 LRAKVEKDPENPTVVLTVRGVGYKAGPP
C4 LRAKVEKDPENPTVVLTVRGVGYKAGPP
C5 LRAKVEKDPENPTVVLTVRGVGYKAGPP
C6 LRAKVEKDPENPTVVLTVRGVGYKAGPP
****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 228 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 228 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6840]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6840]--->[6840]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.488 Mb, Max= 30.776 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
C2 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
C3 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
C4 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
C5 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
C6 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
**************************************************
C1 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
C2 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
C3 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
C4 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
C5 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
C6 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
**************************************************
C1 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
C2 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
C3 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
C4 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
C5 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
C6 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
**************************************************
C1 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
C2 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
C3 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
C4 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
C5 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
C6 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
**************************************************
C1 LRAKVEKDPENPTVVLTVRGVGYKAGPP
C2 LRAKVEKDPENPTVVLTVRGVGYKAGPP
C3 LRAKVEKDPENPTVVLTVRGVGYKAGPP
C4 LRAKVEKDPENPTVVLTVRGVGYKAGPP
C5 LRAKVEKDPENPTVVLTVRGVGYKAGPP
C6 LRAKVEKDPENPTVVLTVRGVGYKAGPP
****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
C2 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
C3 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
C4 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
C5 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
C6 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
**************************************************
C1 GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
C2 GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
C3 GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
C4 GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
C5 GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
C6 GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
**************************************************
C1 TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
C2 TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
C3 TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
C4 TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
C5 TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
C6 TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
**************************************************
C1 GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
C2 GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
C3 GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
C4 GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
C5 GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
C6 GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
**************************************************
C1 GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
C2 GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
C3 GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
C4 GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
C5 GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
C6 GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
**************************************************
C1 CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
C2 CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
C3 CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
C4 CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
C5 CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
C6 CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
**************************************************
C1 GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
C2 GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
C3 GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
C4 GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
C5 GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
C6 GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
**************************************************
C1 GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
C2 GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
C3 GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
C4 GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
C5 GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
C6 GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
**************************************************
C1 CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
C2 CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
C3 CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
C4 CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
C5 CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
C6 CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
**************************************************
C1 CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
C2 CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
C3 CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
C4 CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
C5 CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
C6 CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
**************************************************
C1 CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
C2 CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
C3 CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
C4 CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
C5 CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
C6 CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
**************************************************
C1 GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
C2 GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
C3 GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
C4 GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
C5 GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
C6 GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
**************************************************
C1 CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
C2 CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
C3 CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
C4 CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
C5 CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
C6 CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
**************************************************
C1 CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
C2 CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
C3 CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
C4 CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
C5 CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
C6 CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
**********************************
>C1
ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
>C2
ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
>C3
ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
>C4
ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
>C5
ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
>C6
ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT
GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG
TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC
GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT
GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG
CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT
GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG
GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG
CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA
CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG
CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG
GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG
CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC
CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
>C1
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
>C2
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
>C3
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
>C4
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
>C5
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
>C6
MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 684 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579783539
Setting output file names to "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 978981697
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9495722900
Seed = 2060477000
Swapseed = 1579783539
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1530.824789 -- -24.965149
Chain 2 -- -1530.824556 -- -24.965149
Chain 3 -- -1530.824556 -- -24.965149
Chain 4 -- -1530.824789 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1530.824789 -- -24.965149
Chain 2 -- -1530.824556 -- -24.965149
Chain 3 -- -1530.824789 -- -24.965149
Chain 4 -- -1530.824789 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1530.825] (-1530.825) (-1530.825) (-1530.825) * [-1530.825] (-1530.825) (-1530.825) (-1530.825)
500 -- [-949.338] (-948.389) (-955.195) (-948.165) * (-954.396) [-941.456] (-945.511) (-950.618) -- 0:00:00
1000 -- [-945.452] (-942.444) (-945.739) (-948.303) * (-947.253) (-954.741) (-948.520) [-944.832] -- 0:00:00
1500 -- (-942.783) [-942.847] (-952.866) (-943.505) * [-942.954] (-952.596) (-947.926) (-943.510) -- 0:00:00
2000 -- (-944.190) [-945.395] (-953.426) (-941.744) * (-942.894) [-940.370] (-948.851) (-945.172) -- 0:00:00
2500 -- (-947.610) (-953.060) [-945.297] (-944.105) * [-947.838] (-949.715) (-947.494) (-941.979) -- 0:00:00
3000 -- (-939.593) (-945.870) [-946.001] (-946.958) * (-943.836) (-949.594) (-941.993) [-942.992] -- 0:00:00
3500 -- (-945.794) (-949.341) (-945.920) [-948.850] * [-949.646] (-942.830) (-952.138) (-946.529) -- 0:00:00
4000 -- (-950.564) (-943.140) [-949.907] (-946.217) * [-940.417] (-948.933) (-949.788) (-946.556) -- 0:00:00
4500 -- (-950.439) (-944.076) (-943.762) [-941.348] * [-945.181] (-946.644) (-945.204) (-943.274) -- 0:00:00
5000 -- (-950.257) (-945.178) [-945.631] (-944.969) * (-940.718) (-947.233) (-958.888) [-949.720] -- 0:03:19
Average standard deviation of split frequencies: 0.095647
5500 -- (-946.279) (-947.072) [-949.705] (-948.986) * [-948.544] (-941.712) (-948.969) (-944.702) -- 0:03:00
6000 -- (-946.195) (-947.404) (-950.883) [-943.561] * (-951.355) (-944.865) [-942.005] (-944.441) -- 0:02:45
6500 -- (-949.341) (-945.111) (-957.464) [-944.400] * (-945.130) (-943.184) (-944.824) [-943.729] -- 0:02:32
7000 -- (-943.700) (-945.028) (-941.778) [-941.658] * (-945.250) (-958.609) [-940.710] (-947.247) -- 0:02:21
7500 -- (-951.067) (-940.306) [-940.805] (-958.263) * (-949.325) (-955.163) (-942.784) [-948.040] -- 0:02:12
8000 -- (-945.199) [-942.599] (-937.944) (-947.409) * (-948.555) (-945.220) (-948.598) [-947.226] -- 0:02:04
8500 -- (-947.781) [-941.765] (-938.436) (-943.231) * (-941.259) (-943.363) [-953.529] (-950.752) -- 0:01:56
9000 -- (-947.185) (-951.678) [-936.879] (-939.337) * (-945.368) [-947.682] (-942.177) (-944.520) -- 0:01:50
9500 -- [-941.736] (-949.624) (-940.205) (-954.525) * (-958.783) (-953.521) [-944.872] (-949.646) -- 0:01:44
10000 -- [-942.847] (-945.513) (-939.866) (-943.886) * [-940.909] (-944.176) (-955.405) (-947.863) -- 0:01:39
Average standard deviation of split frequencies: 0.061872
10500 -- [-942.232] (-941.573) (-938.595) (-949.998) * [-942.337] (-942.854) (-948.122) (-948.980) -- 0:01:34
11000 -- (-945.632) (-947.164) (-935.663) [-948.636] * [-942.136] (-946.215) (-953.191) (-950.764) -- 0:01:29
11500 -- [-944.278] (-950.530) (-936.622) (-952.906) * (-953.193) [-947.650] (-948.428) (-943.135) -- 0:01:25
12000 -- (-956.925) (-946.921) (-935.269) [-943.211] * (-954.167) [-940.804] (-943.169) (-952.030) -- 0:01:22
12500 -- (-944.119) (-945.668) (-935.471) [-949.724] * (-944.570) [-961.008] (-944.788) (-951.238) -- 0:01:19
13000 -- (-942.619) (-949.311) [-935.242] (-943.920) * (-941.852) [-948.724] (-937.782) (-947.647) -- 0:01:15
13500 -- (-946.382) [-943.249] (-935.978) (-943.481) * (-944.795) (-944.730) [-936.163] (-947.842) -- 0:01:13
14000 -- (-951.754) (-946.117) [-936.406] (-940.967) * (-942.933) [-942.347] (-937.755) (-941.015) -- 0:01:10
14500 -- (-955.507) (-949.159) (-935.619) [-945.257] * (-944.818) [-944.473] (-938.704) (-957.795) -- 0:01:07
15000 -- (-943.398) [-941.951] (-937.320) (-947.886) * (-945.626) [-941.215] (-936.384) (-954.806) -- 0:01:05
Average standard deviation of split frequencies: 0.051911
15500 -- [-948.743] (-946.822) (-939.472) (-953.575) * (-952.377) [-953.766] (-938.883) (-955.995) -- 0:01:03
16000 -- (-948.147) (-962.593) (-939.595) [-944.826] * [-948.601] (-943.226) (-936.510) (-945.987) -- 0:01:01
16500 -- (-949.754) (-950.084) [-935.318] (-943.443) * (-942.674) [-949.982] (-935.031) (-943.374) -- 0:00:59
17000 -- (-951.599) (-946.041) [-936.023] (-945.801) * (-959.912) [-947.383] (-935.326) (-959.788) -- 0:00:57
17500 -- (-945.752) (-946.883) (-937.395) [-941.508] * (-948.622) (-943.342) (-934.752) [-945.978] -- 0:00:56
18000 -- (-943.965) (-939.025) (-937.154) [-948.682] * (-952.430) [-945.730] (-937.251) (-954.008) -- 0:00:54
18500 -- (-950.799) [-946.186] (-936.418) (-944.437) * (-952.132) (-943.529) (-936.424) [-946.833] -- 0:00:53
19000 -- [-949.822] (-948.102) (-939.237) (-940.210) * (-946.177) [-941.811] (-934.884) (-939.081) -- 0:00:51
19500 -- [-940.415] (-945.823) (-935.825) (-946.992) * (-950.932) (-947.929) [-935.126] (-938.828) -- 0:00:50
20000 -- [-940.518] (-946.268) (-939.282) (-945.276) * [-943.807] (-959.592) (-936.013) (-937.480) -- 0:00:49
Average standard deviation of split frequencies: 0.043085
20500 -- (-953.371) [-944.616] (-937.838) (-948.737) * (-949.605) [-937.760] (-934.847) (-934.711) -- 0:01:35
21000 -- [-946.236] (-945.581) (-937.373) (-944.097) * (-951.668) (-936.173) (-935.953) [-935.272] -- 0:01:33
21500 -- (-947.280) (-949.781) (-946.177) [-942.009] * (-952.751) (-941.734) [-935.611] (-937.607) -- 0:01:31
22000 -- [-939.526] (-949.270) (-940.370) (-947.753) * (-939.059) [-936.690] (-934.999) (-938.105) -- 0:01:28
22500 -- [-944.828] (-946.838) (-936.893) (-946.355) * (-951.077) [-938.839] (-934.820) (-941.852) -- 0:01:26
23000 -- (-951.113) (-942.412) [-936.423] (-954.172) * (-938.099) (-937.886) (-937.551) [-936.333] -- 0:01:24
23500 -- (-944.157) (-946.538) [-934.692] (-952.071) * (-937.907) (-937.293) (-936.184) [-936.125] -- 0:01:23
24000 -- [-944.692] (-942.234) (-935.466) (-945.409) * (-938.464) (-935.817) [-936.965] (-935.568) -- 0:01:21
24500 -- (-959.245) [-944.938] (-935.302) (-943.227) * (-937.445) (-936.537) (-937.391) [-935.085] -- 0:01:19
25000 -- (-953.670) [-941.854] (-935.389) (-944.078) * (-935.262) [-935.208] (-935.543) (-937.189) -- 0:01:18
Average standard deviation of split frequencies: 0.040383
25500 -- [-940.688] (-952.164) (-937.024) (-953.760) * (-935.776) (-936.054) (-935.242) [-937.554] -- 0:01:16
26000 -- [-943.005] (-945.874) (-935.448) (-944.010) * [-937.224] (-935.032) (-935.080) (-937.417) -- 0:01:14
26500 -- (-956.927) (-946.636) (-935.597) [-948.342] * (-939.079) (-935.767) (-938.080) [-935.714] -- 0:01:13
27000 -- (-953.555) (-950.256) (-936.043) [-941.606] * [-938.540] (-936.549) (-939.499) (-935.090) -- 0:01:12
27500 -- (-958.242) (-939.825) [-935.886] (-949.999) * [-938.133] (-935.871) (-935.288) (-936.026) -- 0:01:10
28000 -- [-941.093] (-941.858) (-938.432) (-948.887) * (-938.224) (-935.939) (-935.662) [-935.374] -- 0:01:09
28500 -- [-946.774] (-942.404) (-939.103) (-954.320) * [-939.020] (-935.676) (-940.857) (-936.049) -- 0:01:08
29000 -- (-943.291) (-949.464) [-934.989] (-942.591) * (-937.305) [-935.088] (-937.441) (-935.338) -- 0:01:06
29500 -- (-943.060) (-945.874) [-934.838] (-943.362) * (-936.280) [-936.968] (-935.007) (-937.254) -- 0:01:05
30000 -- (-949.150) (-949.126) [-936.194] (-947.567) * (-938.466) (-936.286) (-935.648) [-936.396] -- 0:01:04
Average standard deviation of split frequencies: 0.036893
30500 -- (-964.405) [-943.228] (-935.758) (-945.878) * (-944.963) (-935.722) (-938.572) [-937.773] -- 0:01:03
31000 -- (-950.888) (-942.693) [-934.792] (-947.072) * (-941.729) (-936.702) [-939.028] (-939.768) -- 0:01:02
31500 -- (-937.068) [-945.186] (-935.206) (-953.433) * [-938.269] (-938.210) (-936.929) (-943.100) -- 0:01:01
32000 -- [-938.052] (-947.199) (-936.169) (-946.205) * (-941.488) (-939.986) [-936.633] (-938.329) -- 0:01:00
32500 -- [-937.251] (-955.030) (-939.081) (-944.890) * [-935.272] (-937.235) (-935.724) (-935.060) -- 0:00:59
33000 -- (-935.791) (-946.870) (-936.767) [-945.766] * (-935.651) [-935.760] (-936.199) (-936.560) -- 0:00:58
33500 -- (-935.767) (-952.684) (-936.437) [-946.460] * (-935.403) (-936.035) [-937.743] (-935.714) -- 0:00:57
34000 -- [-936.149] (-955.174) (-938.730) (-944.877) * (-936.868) (-936.348) (-939.550) [-937.384] -- 0:00:56
34500 -- [-936.485] (-947.628) (-938.362) (-946.683) * (-937.239) (-937.266) (-938.649) [-936.867] -- 0:00:55
35000 -- [-935.451] (-942.572) (-936.009) (-940.793) * (-937.315) [-936.205] (-938.600) (-936.220) -- 0:00:55
Average standard deviation of split frequencies: 0.034459
35500 -- (-939.472) (-951.893) [-936.443] (-946.874) * (-938.150) (-937.673) (-937.704) [-936.794] -- 0:00:54
36000 -- [-936.101] (-947.803) (-935.343) (-941.188) * (-937.099) (-934.873) (-938.056) [-936.019] -- 0:00:53
36500 -- [-935.830] (-948.024) (-943.663) (-946.837) * (-937.826) [-937.178] (-938.699) (-937.519) -- 0:00:52
37000 -- (-937.354) (-949.382) (-936.262) [-943.877] * (-940.303) [-940.680] (-938.774) (-938.822) -- 0:01:18
37500 -- (-936.825) [-948.145] (-937.361) (-947.212) * (-939.248) [-936.994] (-936.110) (-941.206) -- 0:01:17
38000 -- (-935.781) (-951.779) (-935.779) [-944.195] * (-936.009) [-936.909] (-940.444) (-935.998) -- 0:01:15
38500 -- (-937.421) [-949.948] (-935.021) (-951.334) * (-935.285) (-936.400) (-937.498) [-935.846] -- 0:01:14
39000 -- (-938.863) (-947.311) [-935.692] (-969.761) * [-940.354] (-935.959) (-941.427) (-937.349) -- 0:01:13
39500 -- (-936.516) [-949.922] (-935.313) (-939.780) * (-935.723) (-936.787) [-937.413] (-938.433) -- 0:01:12
40000 -- [-936.358] (-949.807) (-937.754) (-936.253) * (-936.277) [-936.152] (-936.621) (-936.046) -- 0:01:12
Average standard deviation of split frequencies: 0.032335
40500 -- (-936.013) [-946.005] (-936.843) (-938.052) * [-935.889] (-936.094) (-940.927) (-938.001) -- 0:01:11
41000 -- (-936.962) (-942.607) (-935.003) [-937.613] * (-935.184) (-936.552) (-936.025) [-936.416] -- 0:01:10
41500 -- (-935.996) (-950.426) [-935.560] (-937.613) * (-936.089) (-936.694) (-937.440) [-936.334] -- 0:01:09
42000 -- (-936.030) (-949.839) [-936.516] (-934.997) * [-938.633] (-938.737) (-940.307) (-936.343) -- 0:01:08
42500 -- (-937.512) (-949.862) (-939.506) [-934.596] * (-936.007) (-938.081) (-939.265) [-937.257] -- 0:01:07
43000 -- (-935.103) (-943.045) [-938.531] (-936.501) * (-937.147) (-937.669) (-937.187) [-938.243] -- 0:01:06
43500 -- (-937.635) [-943.684] (-938.415) (-934.933) * [-937.046] (-939.249) (-940.651) (-935.148) -- 0:01:05
44000 -- (-937.314) [-945.886] (-942.590) (-934.789) * [-939.583] (-937.875) (-936.356) (-935.744) -- 0:01:05
44500 -- [-937.443] (-952.566) (-943.140) (-934.781) * (-941.652) (-937.188) [-945.062] (-934.971) -- 0:01:04
45000 -- [-935.489] (-949.493) (-937.725) (-935.333) * (-938.627) (-936.221) (-937.977) [-935.863] -- 0:01:03
Average standard deviation of split frequencies: 0.027017
45500 -- (-936.947) (-945.502) [-936.637] (-934.894) * (-936.306) [-940.850] (-939.603) (-936.793) -- 0:01:02
46000 -- (-935.181) [-944.898] (-936.419) (-935.862) * (-939.988) (-937.347) (-938.932) [-935.907] -- 0:01:02
46500 -- [-937.679] (-949.449) (-940.324) (-937.060) * [-935.406] (-937.658) (-938.188) (-937.675) -- 0:01:01
47000 -- (-935.767) [-947.215] (-939.699) (-939.122) * (-938.755) (-937.996) (-936.614) [-936.519] -- 0:01:00
47500 -- (-935.434) [-942.064] (-936.177) (-935.609) * (-938.015) (-939.497) (-941.725) [-935.432] -- 0:01:00
48000 -- (-935.051) [-942.091] (-936.098) (-934.697) * [-936.573] (-938.784) (-936.950) (-935.580) -- 0:00:59
48500 -- (-939.605) (-941.281) [-938.206] (-936.567) * (-937.341) (-937.386) (-938.655) [-938.479] -- 0:00:58
49000 -- (-938.675) (-950.276) (-936.228) [-936.038] * (-937.674) (-936.333) [-934.710] (-937.197) -- 0:00:58
49500 -- (-940.215) (-949.012) [-936.372] (-936.280) * (-935.381) (-935.577) [-936.731] (-936.611) -- 0:00:57
50000 -- (-936.571) [-943.613] (-938.874) (-935.475) * (-935.853) [-935.925] (-937.390) (-937.120) -- 0:00:57
Average standard deviation of split frequencies: 0.029773
50500 -- (-937.053) (-942.715) (-941.032) [-936.288] * (-937.357) (-938.223) [-938.678] (-937.710) -- 0:00:56
51000 -- (-940.127) [-945.305] (-936.996) (-936.566) * (-935.088) [-936.034] (-938.615) (-935.748) -- 0:00:55
51500 -- (-936.567) [-940.495] (-935.138) (-939.746) * (-935.081) (-938.443) [-936.035] (-939.382) -- 0:00:55
52000 -- (-938.075) [-944.947] (-935.123) (-936.666) * (-936.621) (-935.782) [-936.693] (-935.757) -- 0:00:54
52500 -- (-936.571) (-944.472) (-936.183) [-937.298] * [-935.219] (-936.797) (-935.772) (-936.850) -- 0:00:54
53000 -- (-938.702) (-946.533) [-938.616] (-937.850) * (-936.108) (-938.871) [-936.166] (-936.574) -- 0:00:53
53500 -- [-935.468] (-946.157) (-937.928) (-936.048) * (-936.842) (-936.121) [-935.416] (-937.054) -- 0:01:10
54000 -- (-935.876) (-945.532) [-938.355] (-936.732) * (-938.237) (-936.924) (-935.752) [-936.262] -- 0:01:10
54500 -- (-936.992) (-952.296) [-936.586] (-937.061) * (-936.658) (-935.708) (-935.158) [-938.867] -- 0:01:09
55000 -- (-936.736) (-943.833) [-936.604] (-935.095) * (-935.540) (-935.316) [-935.413] (-939.025) -- 0:01:08
Average standard deviation of split frequencies: 0.033251
55500 -- (-936.074) (-943.875) (-938.480) [-936.276] * (-935.459) (-937.487) (-937.620) [-937.741] -- 0:01:08
56000 -- [-936.455] (-941.605) (-936.150) (-938.148) * (-935.106) (-935.549) (-935.968) [-937.397] -- 0:01:07
56500 -- (-935.803) [-942.573] (-938.608) (-937.402) * (-935.363) [-935.221] (-936.754) (-938.257) -- 0:01:06
57000 -- (-937.661) [-947.459] (-940.595) (-936.210) * [-935.144] (-938.099) (-938.342) (-937.365) -- 0:01:06
57500 -- (-935.788) (-947.878) (-937.952) [-935.895] * (-938.053) [-941.659] (-938.735) (-935.116) -- 0:01:05
58000 -- (-935.797) [-942.637] (-942.871) (-937.407) * [-936.049] (-938.534) (-937.578) (-937.316) -- 0:01:04
58500 -- [-937.870] (-944.297) (-937.685) (-937.643) * (-936.789) [-935.438] (-940.291) (-937.182) -- 0:01:04
59000 -- [-935.706] (-947.989) (-936.483) (-935.820) * (-940.464) (-935.484) [-936.604] (-938.656) -- 0:01:03
59500 -- (-937.954) [-946.385] (-935.503) (-935.999) * (-937.051) [-935.720] (-937.180) (-936.269) -- 0:01:03
60000 -- (-935.649) (-951.061) [-934.891] (-935.363) * (-935.809) (-936.819) (-937.990) [-936.073] -- 0:01:02
Average standard deviation of split frequencies: 0.034281
60500 -- (-935.616) (-941.803) (-935.659) [-935.818] * [-936.156] (-938.228) (-937.765) (-935.949) -- 0:01:02
61000 -- (-935.619) [-946.894] (-937.515) (-936.278) * [-935.665] (-940.339) (-937.113) (-935.770) -- 0:01:01
61500 -- (-934.836) (-942.089) [-937.673] (-935.590) * (-939.400) [-938.958] (-935.924) (-936.289) -- 0:01:01
62000 -- [-934.593] (-945.131) (-941.072) (-940.271) * (-936.890) (-935.569) [-937.986] (-937.738) -- 0:01:00
62500 -- (-936.351) [-949.409] (-936.226) (-935.665) * (-940.610) (-937.023) [-939.867] (-937.392) -- 0:01:00
63000 -- (-937.615) [-950.391] (-934.994) (-935.322) * (-937.793) [-938.441] (-937.203) (-940.674) -- 0:00:59
63500 -- (-936.765) (-949.532) (-938.583) [-939.042] * [-936.348] (-937.348) (-938.290) (-937.080) -- 0:00:58
64000 -- (-935.032) (-944.562) (-937.201) [-936.671] * [-936.748] (-938.461) (-939.030) (-936.357) -- 0:00:58
64500 -- (-935.836) [-939.026] (-939.203) (-936.997) * (-935.854) [-937.587] (-935.759) (-938.231) -- 0:00:58
65000 -- (-935.314) (-945.655) (-937.064) [-936.784] * (-940.383) [-939.302] (-938.663) (-938.119) -- 0:00:57
Average standard deviation of split frequencies: 0.032141
65500 -- (-939.020) [-947.925] (-935.935) (-941.590) * [-938.091] (-939.588) (-934.890) (-936.558) -- 0:00:57
66000 -- (-940.234) (-951.001) (-937.369) [-937.287] * (-938.248) (-939.803) (-936.735) [-935.695] -- 0:00:56
66500 -- [-936.940] (-944.948) (-938.663) (-936.685) * (-938.692) [-937.879] (-937.041) (-937.651) -- 0:00:56
67000 -- (-939.193) (-948.818) (-939.519) [-936.815] * [-938.428] (-939.442) (-935.408) (-939.765) -- 0:00:55
67500 -- (-938.548) (-947.333) [-936.216] (-943.893) * (-940.545) [-937.320] (-940.190) (-937.156) -- 0:00:55
68000 -- (-940.137) [-948.256] (-935.618) (-936.909) * (-941.241) (-936.621) [-935.229] (-936.703) -- 0:00:54
68500 -- (-939.375) (-950.146) (-938.995) [-935.324] * (-944.455) [-939.263] (-936.394) (-943.877) -- 0:00:54
69000 -- [-938.967] (-963.668) (-941.310) (-935.354) * (-940.593) (-939.057) [-936.152] (-940.006) -- 0:00:53
69500 -- [-935.317] (-936.610) (-936.874) (-938.212) * (-935.372) [-938.273] (-936.623) (-939.348) -- 0:01:06
70000 -- (-937.094) (-934.839) (-935.325) [-936.675] * (-937.734) (-937.844) [-935.307] (-939.065) -- 0:01:06
Average standard deviation of split frequencies: 0.031686
70500 -- (-937.188) [-935.111] (-935.637) (-935.788) * (-937.564) (-939.239) [-935.347] (-940.862) -- 0:01:05
71000 -- [-935.759] (-937.864) (-937.533) (-936.545) * (-940.752) [-935.588] (-936.327) (-938.560) -- 0:01:05
71500 -- (-935.383) (-936.941) (-938.480) [-935.283] * (-937.011) (-935.257) (-936.528) [-936.331] -- 0:01:04
72000 -- (-935.631) [-934.983] (-936.739) (-936.192) * [-935.317] (-937.070) (-938.194) (-937.084) -- 0:01:04
72500 -- (-935.680) [-935.647] (-937.858) (-935.499) * (-936.052) (-934.960) [-934.984] (-935.142) -- 0:01:03
73000 -- (-936.655) (-937.420) (-937.442) [-935.414] * [-937.152] (-935.289) (-938.235) (-935.673) -- 0:01:03
73500 -- [-936.099] (-937.312) (-938.170) (-935.288) * (-937.732) (-935.687) [-938.519] (-936.191) -- 0:01:03
74000 -- [-938.357] (-938.490) (-936.535) (-935.932) * (-938.433) [-935.198] (-943.175) (-936.583) -- 0:01:02
74500 -- (-937.018) (-936.892) (-937.588) [-935.302] * (-939.243) (-935.471) [-939.373] (-938.437) -- 0:01:02
75000 -- [-936.131] (-939.746) (-936.439) (-936.633) * (-939.314) (-938.287) [-940.714] (-940.478) -- 0:01:01
Average standard deviation of split frequencies: 0.031634
75500 -- (-937.147) (-936.427) [-936.470] (-936.364) * [-938.090] (-936.064) (-936.039) (-938.782) -- 0:01:01
76000 -- (-937.139) [-935.663] (-937.985) (-935.730) * (-937.193) (-937.686) (-935.923) [-936.952] -- 0:01:00
76500 -- (-942.347) [-935.750] (-937.719) (-935.726) * (-937.081) (-936.499) [-938.037] (-941.122) -- 0:01:00
77000 -- (-937.211) (-940.254) [-936.084] (-938.665) * [-935.008] (-935.504) (-937.694) (-935.299) -- 0:00:59
77500 -- (-938.262) [-936.161] (-935.936) (-936.288) * (-935.311) [-937.949] (-936.138) (-936.737) -- 0:00:59
78000 -- (-938.324) (-939.319) (-936.084) [-935.686] * (-938.463) (-937.045) (-939.874) [-937.548] -- 0:00:59
78500 -- (-938.913) (-939.257) [-936.611] (-936.874) * [-939.703] (-937.434) (-940.320) (-935.307) -- 0:00:58
79000 -- (-935.723) [-937.581] (-936.316) (-935.817) * (-938.728) [-934.591] (-935.988) (-936.109) -- 0:00:58
79500 -- (-937.650) [-936.126] (-938.023) (-936.040) * [-935.925] (-934.932) (-937.714) (-936.144) -- 0:00:57
80000 -- (-936.166) [-936.994] (-936.463) (-937.884) * (-939.102) [-935.243] (-939.390) (-937.371) -- 0:00:57
Average standard deviation of split frequencies: 0.025221
80500 -- [-936.307] (-941.226) (-936.219) (-937.982) * (-935.092) (-934.511) [-939.449] (-936.996) -- 0:00:57
81000 -- (-936.262) [-935.288] (-940.819) (-942.201) * (-936.089) [-935.067] (-939.945) (-945.267) -- 0:00:56
81500 -- (-936.847) (-937.258) (-935.057) [-939.767] * (-941.002) (-935.038) [-938.316] (-939.676) -- 0:00:56
82000 -- (-937.101) [-936.001] (-935.791) (-938.167) * [-937.377] (-936.477) (-936.255) (-938.415) -- 0:00:55
82500 -- (-937.403) (-936.582) [-936.431] (-938.793) * [-936.775] (-936.468) (-936.959) (-942.752) -- 0:00:55
83000 -- (-941.041) (-938.233) [-937.942] (-939.782) * (-938.648) (-942.720) [-935.733] (-941.352) -- 0:00:55
83500 -- (-941.021) [-936.856] (-935.416) (-937.134) * (-937.700) (-939.192) (-935.314) [-936.280] -- 0:00:54
84000 -- (-936.889) [-936.280] (-938.308) (-936.368) * [-935.584] (-936.739) (-937.357) (-936.238) -- 0:00:54
84500 -- (-938.590) (-938.070) (-938.521) [-936.831] * (-937.202) (-938.506) [-936.046] (-939.606) -- 0:00:54
85000 -- [-939.053] (-936.189) (-936.254) (-935.921) * (-938.465) (-935.009) [-939.094] (-937.480) -- 0:00:53
Average standard deviation of split frequencies: 0.021665
85500 -- (-936.003) (-938.421) (-937.725) [-936.174] * [-937.942] (-937.626) (-935.034) (-935.304) -- 0:00:53
86000 -- (-936.394) (-938.240) (-939.863) [-937.007] * (-936.190) (-935.700) [-935.031] (-935.265) -- 0:00:53
86500 -- [-936.078] (-936.102) (-935.617) (-935.380) * (-937.904) [-935.762] (-935.192) (-935.460) -- 0:01:03
87000 -- [-936.066] (-938.557) (-937.847) (-939.230) * [-938.186] (-935.450) (-936.993) (-935.638) -- 0:01:02
87500 -- (-937.006) (-938.296) [-936.675] (-936.535) * (-935.276) [-942.803] (-941.858) (-936.207) -- 0:01:02
88000 -- (-937.402) (-939.130) [-935.722] (-939.067) * (-937.038) [-936.306] (-935.861) (-940.057) -- 0:01:02
88500 -- (-935.457) (-935.853) (-938.336) [-934.918] * (-940.212) (-940.630) [-938.174] (-937.542) -- 0:01:01
89000 -- [-937.273] (-935.342) (-935.302) (-936.706) * (-940.605) (-937.983) (-939.063) [-936.113] -- 0:01:01
89500 -- (-937.339) (-937.785) (-936.936) [-935.201] * [-935.071] (-935.147) (-941.363) (-935.402) -- 0:01:01
90000 -- (-937.973) [-936.369] (-935.800) (-935.563) * (-936.707) (-938.216) [-943.673] (-935.350) -- 0:01:00
Average standard deviation of split frequencies: 0.021664
90500 -- (-939.191) [-935.029] (-938.962) (-936.543) * (-937.072) (-938.404) [-936.885] (-937.436) -- 0:01:00
91000 -- (-936.508) [-939.162] (-937.795) (-936.366) * (-936.687) (-938.950) (-935.847) [-939.351] -- 0:00:59
91500 -- [-936.697] (-937.437) (-936.216) (-936.185) * (-937.098) (-942.353) (-936.723) [-935.650] -- 0:00:59
92000 -- (-939.042) (-935.657) (-938.322) [-937.272] * [-936.159] (-936.913) (-936.451) (-935.547) -- 0:00:59
92500 -- (-939.658) [-935.621] (-936.588) (-935.650) * [-935.356] (-938.977) (-936.640) (-936.894) -- 0:00:58
93000 -- (-938.142) [-935.926] (-937.236) (-938.679) * [-936.187] (-938.801) (-938.782) (-940.856) -- 0:00:58
93500 -- [-937.103] (-937.810) (-937.746) (-937.750) * [-936.985] (-935.533) (-935.283) (-939.571) -- 0:00:58
94000 -- (-937.420) [-936.961] (-935.762) (-935.408) * [-938.033] (-938.520) (-935.046) (-936.733) -- 0:00:57
94500 -- [-937.567] (-939.151) (-938.326) (-936.214) * (-936.122) (-936.382) [-936.358] (-940.928) -- 0:00:57
95000 -- [-935.779] (-937.114) (-936.966) (-937.162) * [-939.518] (-937.504) (-938.702) (-938.821) -- 0:00:57
Average standard deviation of split frequencies: 0.018823
95500 -- (-940.772) (-936.172) (-937.421) [-937.220] * (-935.047) [-935.701] (-935.464) (-936.651) -- 0:00:56
96000 -- (-937.877) [-937.947] (-934.988) (-941.766) * (-934.935) (-936.545) (-935.457) [-936.999] -- 0:00:56
96500 -- (-937.962) (-937.007) (-934.741) [-937.757] * [-935.035] (-937.959) (-938.350) (-935.516) -- 0:00:56
97000 -- [-936.327] (-939.105) (-937.644) (-936.320) * (-934.798) [-939.088] (-935.966) (-937.936) -- 0:00:55
97500 -- (-935.838) (-938.484) (-937.258) [-935.972] * (-935.442) (-937.559) (-936.219) [-938.302] -- 0:00:55
98000 -- (-935.163) (-936.210) (-935.308) [-937.534] * (-935.474) (-937.103) [-935.663] (-936.829) -- 0:00:55
98500 -- (-936.898) [-935.579] (-935.035) (-938.991) * (-936.802) (-937.847) (-937.275) [-937.033] -- 0:00:54
99000 -- (-936.666) (-936.930) [-934.656] (-938.692) * (-937.783) (-936.654) (-935.049) [-935.933] -- 0:00:54
99500 -- (-944.297) [-937.162] (-937.559) (-936.981) * (-935.936) (-938.469) (-935.590) [-936.342] -- 0:00:54
100000 -- [-938.478] (-937.108) (-941.273) (-936.884) * (-937.385) (-940.536) (-939.823) [-936.038] -- 0:00:54
Average standard deviation of split frequencies: 0.014829
100500 -- (-938.062) (-935.522) (-938.031) [-936.949] * (-938.732) (-937.163) [-936.423] (-935.486) -- 0:00:53
101000 -- (-938.167) (-934.921) (-938.881) [-937.465] * (-940.822) [-937.613] (-940.049) (-936.414) -- 0:00:53
101500 -- (-936.938) (-938.387) (-937.028) [-938.312] * (-944.315) (-939.689) [-936.562] (-937.897) -- 0:00:53
102000 -- (-939.231) (-937.191) (-937.119) [-938.987] * (-937.776) [-937.963] (-938.096) (-939.658) -- 0:00:52
102500 -- (-936.319) [-937.004] (-940.455) (-936.890) * [-936.006] (-937.967) (-935.988) (-940.468) -- 0:00:52
103000 -- [-935.315] (-935.295) (-939.074) (-935.546) * [-937.911] (-940.470) (-936.368) (-936.509) -- 0:01:00
103500 -- (-936.166) (-934.817) [-937.146] (-936.028) * (-935.604) [-942.130] (-936.160) (-937.024) -- 0:01:00
104000 -- (-936.398) (-937.895) [-935.993] (-937.620) * (-938.097) (-939.604) [-938.498] (-937.476) -- 0:01:00
104500 -- (-939.221) (-935.609) (-936.827) [-936.970] * (-936.454) (-940.145) [-935.119] (-937.439) -- 0:00:59
105000 -- (-936.257) (-935.125) [-937.936] (-935.816) * [-935.524] (-938.588) (-935.802) (-936.236) -- 0:00:59
Average standard deviation of split frequencies: 0.014824
105500 -- (-937.253) (-937.456) (-940.821) [-937.269] * (-935.273) (-938.017) [-935.417] (-937.294) -- 0:00:59
106000 -- (-937.048) [-935.894] (-937.751) (-935.795) * [-935.159] (-939.672) (-935.802) (-935.264) -- 0:00:59
106500 -- [-937.048] (-934.747) (-937.406) (-936.225) * (-935.338) (-937.444) [-936.733] (-937.302) -- 0:00:58
107000 -- (-939.265) (-935.210) (-938.088) [-936.265] * (-935.526) (-937.483) (-940.557) [-935.505] -- 0:00:58
107500 -- (-939.073) [-935.536] (-939.544) (-934.908) * (-935.504) (-937.881) (-936.003) [-935.403] -- 0:00:58
108000 -- (-937.349) [-938.341] (-938.889) (-934.987) * [-935.647] (-937.114) (-938.530) (-935.522) -- 0:00:57
108500 -- (-935.546) [-937.452] (-940.710) (-936.589) * (-935.481) (-936.026) (-937.159) [-934.891] -- 0:00:57
109000 -- (-935.362) [-935.873] (-948.057) (-937.404) * (-938.090) (-936.810) [-938.701] (-934.838) -- 0:00:57
109500 -- (-935.631) (-935.982) [-937.381] (-941.398) * (-939.721) (-936.626) [-935.085] (-935.594) -- 0:00:56
110000 -- (-935.831) (-935.780) (-939.927) [-937.663] * (-938.720) (-936.026) (-935.308) [-935.741] -- 0:00:56
Average standard deviation of split frequencies: 0.013489
110500 -- (-935.352) (-935.961) (-934.872) [-939.204] * (-938.601) (-936.494) (-935.844) [-935.047] -- 0:00:56
111000 -- (-935.421) (-936.298) [-935.200] (-939.903) * (-936.657) [-936.348] (-936.729) (-935.096) -- 0:00:56
111500 -- [-935.978] (-936.208) (-936.925) (-937.617) * (-936.082) [-937.673] (-939.205) (-935.445) -- 0:00:55
112000 -- (-936.555) (-937.705) [-936.561] (-937.833) * [-938.605] (-942.222) (-936.147) (-937.355) -- 0:00:55
112500 -- [-934.953] (-937.253) (-936.155) (-937.790) * [-935.855] (-937.967) (-935.434) (-936.980) -- 0:00:55
113000 -- (-939.948) [-936.344] (-935.143) (-937.147) * [-936.185] (-936.588) (-935.947) (-936.397) -- 0:00:54
113500 -- (-935.687) [-936.122] (-935.370) (-936.377) * (-939.531) [-935.605] (-937.982) (-936.358) -- 0:00:54
114000 -- (-936.498) [-938.787] (-937.067) (-934.711) * (-936.633) (-936.352) [-937.891] (-942.322) -- 0:00:54
114500 -- (-938.385) [-939.127] (-937.193) (-935.736) * (-936.836) [-936.061] (-936.366) (-936.866) -- 0:00:54
115000 -- (-942.236) (-938.869) (-937.282) [-935.188] * (-937.519) (-943.973) (-934.990) [-936.600] -- 0:00:53
Average standard deviation of split frequencies: 0.013320
115500 -- (-942.815) (-936.197) (-939.901) [-935.593] * (-936.844) [-938.686] (-938.456) (-938.134) -- 0:00:53
116000 -- (-936.523) [-935.230] (-939.383) (-936.125) * (-936.114) (-939.026) [-937.873] (-937.914) -- 0:00:53
116500 -- (-939.938) (-937.136) (-938.361) [-938.654] * [-936.949] (-940.393) (-934.841) (-936.287) -- 0:00:53
117000 -- (-935.193) (-937.232) [-937.782] (-937.018) * [-936.540] (-936.356) (-936.391) (-936.315) -- 0:00:52
117500 -- (-940.188) [-938.321] (-935.174) (-936.809) * (-937.417) [-935.177] (-936.493) (-938.166) -- 0:00:52
118000 -- (-935.829) (-938.444) [-937.217] (-937.105) * (-937.718) [-935.374] (-936.888) (-937.328) -- 0:00:52
118500 -- (-936.458) (-937.790) (-940.284) [-936.137] * (-938.601) (-937.618) [-935.493] (-937.764) -- 0:00:52
119000 -- (-936.265) (-940.109) (-943.591) [-937.476] * [-939.393] (-936.502) (-938.291) (-936.109) -- 0:00:51
119500 -- (-936.051) (-938.317) (-944.876) [-939.032] * (-935.567) [-936.467] (-939.721) (-940.493) -- 0:00:51
120000 -- [-937.601] (-935.460) (-935.578) (-935.080) * (-937.942) (-936.268) (-938.476) [-936.182] -- 0:00:58
Average standard deviation of split frequencies: 0.011503
120500 -- (-936.323) (-935.460) (-935.604) [-937.031] * [-937.249] (-937.976) (-938.762) (-936.363) -- 0:00:58
121000 -- (-936.252) [-936.026] (-942.028) (-942.640) * (-940.890) (-938.077) (-941.038) [-938.155] -- 0:00:58
121500 -- (-936.759) (-936.838) [-937.478] (-941.804) * [-935.522] (-937.573) (-936.920) (-937.393) -- 0:00:57
122000 -- (-938.041) [-935.331] (-937.493) (-937.393) * (-935.945) (-938.826) [-936.815] (-935.576) -- 0:00:57
122500 -- (-938.277) (-936.599) [-937.129] (-935.910) * [-935.470] (-935.310) (-935.786) (-936.173) -- 0:00:57
123000 -- (-939.542) [-935.377] (-936.651) (-939.718) * (-935.230) [-934.743] (-940.134) (-942.039) -- 0:00:57
123500 -- [-936.260] (-937.696) (-935.644) (-936.116) * (-936.033) [-935.945] (-938.415) (-936.210) -- 0:00:56
124000 -- (-936.653) [-936.383] (-935.760) (-936.376) * (-934.987) (-934.886) [-935.517] (-941.406) -- 0:00:56
124500 -- (-936.903) [-937.362] (-935.754) (-937.295) * (-937.733) [-935.056] (-941.985) (-936.600) -- 0:00:56
125000 -- (-940.417) (-936.284) (-936.699) [-936.903] * (-939.189) (-938.179) (-941.279) [-939.136] -- 0:00:56
Average standard deviation of split frequencies: 0.011847
125500 -- (-935.464) (-937.051) (-938.864) [-935.483] * (-935.412) (-941.157) [-937.205] (-937.801) -- 0:00:55
126000 -- (-935.475) [-934.875] (-938.410) (-939.115) * (-935.338) (-934.816) [-938.767] (-938.518) -- 0:00:55
126500 -- (-935.465) [-941.208] (-938.078) (-938.863) * (-936.373) (-935.715) (-940.519) [-939.874] -- 0:00:55
127000 -- (-939.714) (-936.147) [-936.352] (-940.319) * [-937.012] (-935.705) (-940.248) (-943.687) -- 0:00:54
127500 -- (-934.612) (-938.318) [-938.885] (-935.747) * (-941.813) (-934.646) [-937.123] (-942.244) -- 0:00:54
128000 -- (-935.313) (-936.906) (-936.596) [-936.625] * (-939.473) [-934.514] (-938.278) (-936.886) -- 0:00:54
128500 -- (-935.889) (-936.101) (-936.480) [-936.988] * (-936.043) [-937.120] (-937.283) (-936.218) -- 0:00:54
129000 -- (-935.952) [-937.543] (-935.676) (-936.904) * (-935.665) [-936.914] (-936.350) (-935.812) -- 0:00:54
129500 -- (-935.418) (-938.740) [-935.618] (-937.608) * (-934.718) (-938.702) (-939.362) [-938.766] -- 0:00:53
130000 -- (-935.511) (-942.023) [-935.933] (-935.966) * (-936.480) (-935.747) [-937.503] (-939.038) -- 0:00:53
Average standard deviation of split frequencies: 0.011224
130500 -- (-936.230) (-937.878) (-936.789) [-935.656] * (-938.482) [-937.542] (-936.117) (-937.131) -- 0:00:53
131000 -- (-938.602) (-939.090) (-938.277) [-937.395] * (-937.572) (-935.531) (-935.852) [-935.014] -- 0:00:53
131500 -- (-935.857) (-938.476) [-938.156] (-937.683) * (-940.092) (-935.388) [-936.057] (-935.736) -- 0:00:52
132000 -- (-937.168) [-937.694] (-937.950) (-936.520) * (-936.033) [-936.498] (-935.935) (-938.031) -- 0:00:52
132500 -- (-935.051) [-937.346] (-939.953) (-935.205) * (-936.766) (-939.380) (-935.270) [-936.925] -- 0:00:52
133000 -- [-937.182] (-936.311) (-941.002) (-934.920) * (-939.655) (-937.232) [-936.744] (-937.191) -- 0:00:52
133500 -- [-937.781] (-939.617) (-939.170) (-936.253) * (-937.300) [-935.845] (-945.651) (-938.677) -- 0:00:51
134000 -- (-937.595) [-937.144] (-937.871) (-936.638) * (-937.281) (-937.326) (-939.606) [-935.508] -- 0:00:51
134500 -- (-938.822) (-938.807) (-938.983) [-939.303] * (-938.363) (-937.549) [-936.881] (-935.325) -- 0:00:51
135000 -- (-936.680) (-942.384) [-937.467] (-937.164) * (-941.529) [-937.309] (-936.789) (-936.660) -- 0:00:51
Average standard deviation of split frequencies: 0.011939
135500 -- (-934.801) (-937.230) [-935.306] (-939.847) * (-940.482) (-938.543) [-938.552] (-935.209) -- 0:00:51
136000 -- [-938.110] (-937.565) (-935.759) (-942.178) * [-939.564] (-935.603) (-941.635) (-939.193) -- 0:00:50
136500 -- [-937.594] (-936.991) (-935.291) (-936.950) * (-940.191) (-936.440) [-941.560] (-936.712) -- 0:00:56
137000 -- (-935.992) (-937.725) (-938.262) [-941.010] * (-940.952) (-939.904) (-939.379) [-939.346] -- 0:00:56
137500 -- (-936.437) (-938.287) (-936.011) [-937.230] * [-936.975] (-937.845) (-942.914) (-939.936) -- 0:00:56
138000 -- (-937.078) (-936.203) [-937.649] (-937.119) * (-935.418) (-935.841) [-935.806] (-937.331) -- 0:00:56
138500 -- (-935.945) [-937.269] (-936.536) (-936.436) * (-937.320) (-938.321) (-936.875) [-938.200] -- 0:00:55
139000 -- (-934.739) [-936.827] (-938.659) (-939.067) * [-936.792] (-937.766) (-938.199) (-936.492) -- 0:00:55
139500 -- (-937.612) (-935.059) (-936.714) [-938.443] * (-936.864) (-935.338) [-937.820] (-937.731) -- 0:00:55
140000 -- (-938.492) [-937.061] (-936.266) (-937.057) * (-935.876) (-938.149) (-937.375) [-939.375] -- 0:00:55
Average standard deviation of split frequencies: 0.014522
140500 -- (-937.473) (-937.537) [-937.052] (-938.538) * (-940.944) (-937.117) (-939.944) [-936.809] -- 0:00:55
141000 -- (-937.662) [-935.799] (-939.272) (-937.480) * (-937.863) [-936.676] (-939.346) (-935.654) -- 0:00:54
141500 -- (-938.090) [-942.316] (-938.699) (-939.304) * (-936.582) [-936.258] (-936.767) (-940.213) -- 0:00:54
142000 -- [-936.917] (-939.130) (-939.468) (-936.347) * [-936.354] (-937.415) (-936.902) (-935.313) -- 0:00:54
142500 -- (-935.388) (-938.607) [-935.508] (-935.708) * [-936.484] (-937.600) (-936.287) (-936.551) -- 0:00:54
143000 -- [-935.149] (-938.339) (-937.534) (-937.306) * (-935.726) (-935.780) (-935.982) [-936.161] -- 0:00:53
143500 -- [-936.087] (-936.531) (-935.212) (-938.210) * (-937.819) (-937.566) (-935.663) [-935.157] -- 0:00:53
144000 -- (-936.080) (-937.117) [-936.468] (-936.860) * (-936.430) (-938.458) (-937.211) [-934.666] -- 0:00:53
144500 -- [-934.705] (-937.026) (-935.945) (-936.813) * (-938.517) [-937.160] (-937.088) (-937.682) -- 0:00:53
145000 -- (-937.324) (-935.713) (-935.319) [-935.896] * [-937.240] (-938.084) (-938.249) (-937.931) -- 0:00:53
Average standard deviation of split frequencies: 0.013991
145500 -- (-937.636) (-941.853) [-937.365] (-940.953) * (-941.728) (-939.160) [-937.966] (-942.965) -- 0:00:52
146000 -- [-936.464] (-940.646) (-936.317) (-938.935) * [-941.815] (-940.343) (-939.164) (-936.906) -- 0:00:52
146500 -- (-936.975) (-940.166) [-936.290] (-936.793) * [-936.943] (-940.054) (-940.558) (-936.305) -- 0:00:52
147000 -- (-936.398) [-935.833] (-935.261) (-935.646) * (-936.592) [-944.885] (-935.220) (-936.735) -- 0:00:52
147500 -- (-935.796) [-936.596] (-937.296) (-934.745) * (-937.609) (-938.011) (-938.979) [-936.284] -- 0:00:52
148000 -- [-937.547] (-936.634) (-934.978) (-937.281) * (-941.803) (-938.554) (-939.710) [-942.156] -- 0:00:51
148500 -- (-936.156) (-937.751) [-936.666] (-937.542) * (-939.493) (-937.535) (-941.823) [-935.128] -- 0:00:51
149000 -- (-937.237) (-937.840) (-936.875) [-941.884] * (-940.377) (-937.810) (-938.933) [-935.457] -- 0:00:51
149500 -- [-937.300] (-936.369) (-936.755) (-936.594) * (-937.735) (-936.433) (-936.836) [-936.097] -- 0:00:51
150000 -- (-940.555) [-934.712] (-937.564) (-936.914) * (-939.018) (-943.017) (-936.140) [-937.113] -- 0:00:51
Average standard deviation of split frequencies: 0.014985
150500 -- (-940.513) (-936.034) (-935.996) [-938.418] * [-936.157] (-937.509) (-936.893) (-936.100) -- 0:00:50
151000 -- [-934.887] (-935.354) (-935.575) (-938.160) * [-936.513] (-940.194) (-936.603) (-937.581) -- 0:00:50
151500 -- (-934.887) (-935.505) (-937.826) [-937.390] * [-935.196] (-935.659) (-936.321) (-937.444) -- 0:00:50
152000 -- [-934.887] (-935.781) (-936.646) (-942.784) * (-935.852) (-937.984) [-936.721] (-941.288) -- 0:00:50
152500 -- [-936.541] (-936.443) (-936.898) (-936.617) * (-935.312) [-938.217] (-937.181) (-939.148) -- 0:00:50
153000 -- [-937.119] (-935.975) (-940.402) (-937.532) * (-935.147) (-937.560) (-936.624) [-936.605] -- 0:00:55
153500 -- (-935.893) [-936.009] (-943.591) (-937.767) * [-936.292] (-935.790) (-938.548) (-937.898) -- 0:00:55
154000 -- (-935.356) (-934.966) (-939.490) [-938.370] * (-937.434) [-934.990] (-938.661) (-936.726) -- 0:00:54
154500 -- (-934.765) (-939.321) [-937.696] (-938.692) * (-936.241) (-936.349) (-941.313) [-938.441] -- 0:00:54
155000 -- (-935.361) (-939.419) (-943.419) [-935.407] * (-935.253) [-937.954] (-941.975) (-937.687) -- 0:00:54
Average standard deviation of split frequencies: 0.014807
155500 -- [-934.742] (-940.248) (-938.704) (-935.334) * [-934.618] (-935.901) (-938.018) (-938.854) -- 0:00:54
156000 -- (-935.528) (-936.237) (-938.157) [-938.969] * (-936.942) [-934.613] (-938.952) (-936.564) -- 0:00:54
156500 -- (-936.855) [-935.812] (-936.201) (-936.853) * (-937.350) [-935.251] (-938.840) (-935.223) -- 0:00:53
157000 -- (-937.812) [-935.141] (-937.886) (-937.459) * [-936.208] (-939.139) (-936.777) (-936.480) -- 0:00:53
157500 -- [-939.048] (-935.917) (-938.876) (-936.724) * [-936.593] (-938.249) (-935.206) (-937.633) -- 0:00:53
158000 -- [-941.334] (-938.579) (-935.661) (-937.141) * (-937.244) (-937.347) (-937.256) [-937.547] -- 0:00:53
158500 -- (-935.875) (-935.121) [-935.076] (-935.410) * (-938.424) [-941.676] (-935.208) (-937.840) -- 0:00:53
159000 -- [-935.335] (-935.121) (-938.274) (-937.077) * (-937.113) (-936.975) (-934.668) [-937.722] -- 0:00:52
159500 -- (-936.382) (-937.069) (-939.753) [-935.923] * (-935.445) (-935.809) [-935.553] (-936.914) -- 0:00:52
160000 -- (-938.109) (-940.880) (-937.115) [-935.395] * (-936.589) (-937.238) [-940.444] (-937.798) -- 0:00:52
Average standard deviation of split frequencies: 0.014670
160500 -- (-939.084) [-937.832] (-935.883) (-935.861) * [-940.406] (-944.728) (-939.617) (-936.592) -- 0:00:52
161000 -- (-939.529) (-937.607) (-936.166) [-937.507] * [-937.381] (-935.977) (-936.586) (-936.312) -- 0:00:52
161500 -- (-939.013) (-937.655) (-939.731) [-936.704] * (-935.989) [-937.158] (-936.563) (-936.902) -- 0:00:51
162000 -- (-941.668) (-936.294) [-935.064] (-939.992) * (-937.927) (-937.089) (-937.216) [-937.979] -- 0:00:51
162500 -- (-937.808) [-934.949] (-935.692) (-937.686) * [-936.487] (-936.861) (-936.837) (-937.509) -- 0:00:51
163000 -- (-935.836) (-937.450) (-934.888) [-936.649] * (-939.272) (-935.178) (-937.010) [-937.672] -- 0:00:51
163500 -- (-935.309) (-936.910) [-937.007] (-936.778) * [-939.499] (-936.993) (-936.135) (-938.085) -- 0:00:51
164000 -- (-938.508) (-940.388) (-936.021) [-938.220] * (-940.502) (-936.822) [-935.808] (-939.010) -- 0:00:50
164500 -- (-937.075) (-937.339) (-936.856) [-937.001] * (-936.573) [-936.526] (-937.804) (-937.638) -- 0:00:50
165000 -- (-935.231) (-937.497) [-935.886] (-935.408) * [-935.271] (-936.143) (-938.517) (-935.898) -- 0:00:50
Average standard deviation of split frequencies: 0.012704
165500 -- (-935.789) [-935.951] (-936.798) (-937.147) * (-937.218) (-937.815) [-937.123] (-935.228) -- 0:00:50
166000 -- (-935.262) [-937.799] (-941.467) (-939.100) * (-937.366) (-938.014) [-935.725] (-935.375) -- 0:00:50
166500 -- [-938.198] (-935.952) (-937.922) (-938.569) * (-938.123) (-936.586) (-937.115) [-935.791] -- 0:00:50
167000 -- [-936.341] (-938.255) (-935.553) (-936.057) * [-936.619] (-937.076) (-935.863) (-935.076) -- 0:00:49
167500 -- (-937.123) [-935.030] (-935.039) (-935.726) * (-935.646) (-936.869) (-935.849) [-935.253] -- 0:00:49
168000 -- (-934.805) [-935.968] (-935.514) (-940.094) * (-942.499) [-935.139] (-937.356) (-935.584) -- 0:00:49
168500 -- (-936.784) [-936.839] (-935.492) (-940.674) * (-936.318) (-936.392) (-938.877) [-935.040] -- 0:00:49
169000 -- (-935.496) [-937.209] (-936.467) (-938.804) * (-938.541) (-935.410) [-937.578] (-934.793) -- 0:00:49
169500 -- [-934.627] (-939.013) (-935.971) (-937.690) * [-937.832] (-937.589) (-938.181) (-934.735) -- 0:00:48
170000 -- (-937.865) [-935.588] (-937.184) (-937.840) * (-936.234) (-938.100) [-935.922] (-940.188) -- 0:00:53
Average standard deviation of split frequencies: 0.010903
170500 -- (-936.030) [-937.496] (-937.577) (-937.666) * (-938.316) (-935.296) [-935.512] (-940.046) -- 0:00:53
171000 -- (-936.162) (-939.482) (-937.477) [-934.988] * (-935.359) (-935.894) (-936.808) [-938.576] -- 0:00:53
171500 -- [-937.562] (-935.576) (-937.045) (-934.985) * [-935.963] (-936.902) (-936.943) (-941.864) -- 0:00:53
172000 -- (-936.831) (-934.848) (-937.845) [-938.008] * (-936.230) (-938.845) [-941.614] (-939.367) -- 0:00:52
172500 -- (-938.167) (-936.419) (-936.930) [-938.790] * (-937.616) (-942.083) (-936.569) [-939.380] -- 0:00:52
173000 -- (-938.746) [-935.792] (-938.778) (-938.353) * (-934.978) [-938.750] (-936.985) (-942.492) -- 0:00:52
173500 -- (-935.490) (-938.575) [-935.013] (-938.536) * [-935.647] (-938.172) (-936.281) (-936.633) -- 0:00:52
174000 -- (-937.340) (-937.150) (-935.388) [-938.560] * (-936.154) [-939.541] (-937.110) (-936.757) -- 0:00:52
174500 -- (-937.754) [-935.782] (-937.525) (-936.338) * (-937.764) (-938.812) (-935.673) [-935.418] -- 0:00:52
175000 -- (-937.968) (-937.786) (-937.741) [-936.686] * [-936.536] (-936.511) (-936.044) (-936.557) -- 0:00:51
Average standard deviation of split frequencies: 0.010863
175500 -- (-940.300) (-937.777) [-935.517] (-935.641) * (-936.150) (-937.435) (-935.824) [-937.943] -- 0:00:51
176000 -- (-935.898) [-938.304] (-938.421) (-936.537) * (-935.941) [-937.991] (-937.676) (-935.297) -- 0:00:51
176500 -- (-936.585) [-936.397] (-939.830) (-935.873) * [-937.949] (-937.339) (-936.145) (-936.720) -- 0:00:51
177000 -- (-936.364) [-934.984] (-938.429) (-935.644) * (-935.428) (-936.334) [-935.990] (-938.066) -- 0:00:51
177500 -- (-935.628) [-934.835] (-936.341) (-935.285) * (-935.331) (-942.044) [-935.892] (-940.573) -- 0:00:50
178000 -- (-936.295) (-934.672) (-935.096) [-935.614] * (-939.748) [-940.166] (-934.865) (-939.330) -- 0:00:50
178500 -- (-936.621) (-935.608) (-942.894) [-935.499] * (-936.250) (-939.778) (-938.817) [-935.734] -- 0:00:50
179000 -- [-937.154] (-936.074) (-935.475) (-940.186) * (-937.433) [-937.996] (-941.817) (-935.621) -- 0:00:50
179500 -- [-941.362] (-936.754) (-935.701) (-938.693) * (-936.228) (-935.604) (-937.516) [-935.327] -- 0:00:50
180000 -- [-937.196] (-938.661) (-936.685) (-936.943) * (-935.715) (-936.113) (-939.571) [-935.335] -- 0:00:50
Average standard deviation of split frequencies: 0.010744
180500 -- (-938.324) (-935.582) (-936.192) [-938.735] * [-935.480] (-937.422) (-936.060) (-938.582) -- 0:00:49
181000 -- (-937.138) [-936.756] (-938.168) (-937.490) * (-935.077) (-937.154) (-939.519) [-939.251] -- 0:00:49
181500 -- (-937.060) [-934.938] (-939.726) (-935.775) * (-937.029) [-937.811] (-935.879) (-938.429) -- 0:00:49
182000 -- (-939.189) (-937.111) (-936.928) [-936.822] * [-937.261] (-935.679) (-935.571) (-936.299) -- 0:00:49
182500 -- (-937.868) [-936.151] (-936.722) (-939.278) * (-936.862) [-936.658] (-935.203) (-937.877) -- 0:00:49
183000 -- (-938.945) (-938.422) (-938.891) [-940.703] * (-938.625) (-939.052) (-935.710) [-937.078] -- 0:00:49
183500 -- (-938.025) (-940.911) [-937.941] (-938.551) * (-938.998) [-938.044] (-935.594) (-936.894) -- 0:00:48
184000 -- (-939.371) (-938.075) (-936.611) [-935.438] * [-936.358] (-937.511) (-936.841) (-936.526) -- 0:00:48
184500 -- (-938.204) (-936.550) [-937.012] (-936.579) * (-936.126) (-940.167) [-936.046] (-937.618) -- 0:00:48
185000 -- [-938.593] (-937.001) (-938.740) (-935.827) * (-936.693) [-940.393] (-936.687) (-939.477) -- 0:00:48
Average standard deviation of split frequencies: 0.011546
185500 -- [-935.481] (-936.013) (-937.857) (-936.473) * [-935.425] (-939.735) (-935.012) (-938.598) -- 0:00:48
186000 -- (-937.274) (-936.449) (-937.720) [-935.960] * (-936.656) (-940.197) (-935.506) [-936.600] -- 0:00:48
186500 -- (-939.016) (-934.870) [-935.792] (-937.764) * (-943.470) (-938.413) [-936.736] (-936.259) -- 0:00:52
187000 -- (-937.412) (-935.870) [-938.900] (-936.046) * (-936.714) (-938.288) [-936.157] (-937.788) -- 0:00:52
187500 -- (-938.017) [-937.443] (-935.676) (-939.042) * (-936.907) [-935.805] (-938.119) (-938.691) -- 0:00:52
188000 -- [-938.379] (-936.972) (-937.656) (-937.770) * (-936.767) [-935.097] (-936.771) (-936.906) -- 0:00:51
188500 -- (-942.539) (-938.154) (-935.720) [-937.390] * (-936.095) (-940.692) (-935.334) [-938.380] -- 0:00:51
189000 -- (-942.274) (-934.947) [-936.576] (-936.101) * (-935.799) (-935.892) [-935.219] (-938.775) -- 0:00:51
189500 -- (-942.692) (-936.727) (-937.253) [-936.425] * (-936.191) (-936.191) (-937.061) [-937.737] -- 0:00:51
190000 -- (-935.687) (-937.047) (-936.552) [-938.125] * (-938.373) (-938.011) [-936.154] (-938.428) -- 0:00:51
Average standard deviation of split frequencies: 0.013273
190500 -- (-936.363) (-938.491) (-935.996) [-937.892] * [-938.667] (-939.631) (-944.114) (-940.968) -- 0:00:50
191000 -- (-937.646) [-938.006] (-938.481) (-937.254) * (-937.561) (-937.142) [-937.143] (-941.939) -- 0:00:50
191500 -- (-937.958) (-937.260) [-937.270] (-935.336) * [-939.065] (-937.803) (-941.544) (-937.156) -- 0:00:50
192000 -- (-937.019) (-942.089) [-938.568] (-935.168) * (-938.416) (-935.994) (-939.120) [-937.685] -- 0:00:50
192500 -- (-935.175) [-937.682] (-936.732) (-934.610) * (-940.343) (-936.966) (-940.373) [-937.371] -- 0:00:50
193000 -- (-936.241) [-936.315] (-936.739) (-938.724) * [-940.849] (-936.783) (-939.593) (-934.804) -- 0:00:50
193500 -- [-939.798] (-936.111) (-936.842) (-938.695) * [-936.194] (-938.796) (-937.369) (-935.791) -- 0:00:50
194000 -- [-935.433] (-936.715) (-938.664) (-936.188) * (-936.849) [-937.512] (-936.702) (-940.082) -- 0:00:49
194500 -- (-935.529) [-935.804] (-940.369) (-936.100) * [-935.570] (-939.579) (-938.586) (-941.746) -- 0:00:49
195000 -- (-937.058) [-939.802] (-945.799) (-937.928) * (-935.789) [-937.825] (-936.337) (-937.854) -- 0:00:49
Average standard deviation of split frequencies: 0.011491
195500 -- (-936.652) [-937.334] (-937.178) (-937.935) * (-940.383) (-941.052) [-936.039] (-935.189) -- 0:00:49
196000 -- (-937.922) (-936.657) (-937.734) [-936.259] * (-935.650) (-937.035) [-936.552] (-939.010) -- 0:00:49
196500 -- [-938.678] (-935.737) (-936.734) (-935.886) * (-937.437) [-939.568] (-937.740) (-935.174) -- 0:00:49
197000 -- (-939.132) [-935.996] (-937.699) (-936.046) * (-936.721) [-937.848] (-937.167) (-938.344) -- 0:00:48
197500 -- (-938.782) (-935.554) (-938.486) [-936.455] * (-937.902) [-940.421] (-935.209) (-935.647) -- 0:00:48
198000 -- (-939.150) (-940.112) (-940.430) [-936.006] * (-937.280) (-943.793) (-934.961) [-936.422] -- 0:00:48
198500 -- [-935.550] (-937.589) (-937.192) (-936.712) * (-937.571) (-940.783) [-936.127] (-937.136) -- 0:00:48
199000 -- (-939.118) [-936.444] (-936.232) (-937.852) * (-940.425) (-938.163) [-936.250] (-939.643) -- 0:00:48
199500 -- (-938.743) (-938.534) [-937.177] (-937.463) * [-936.897] (-938.141) (-935.207) (-938.244) -- 0:00:48
200000 -- (-938.647) [-939.111] (-938.150) (-939.017) * (-934.646) (-939.989) (-937.978) [-936.191] -- 0:00:48
Average standard deviation of split frequencies: 0.010049
200500 -- (-936.988) (-941.034) (-939.623) [-937.391] * (-935.028) (-938.783) (-938.806) [-935.992] -- 0:00:47
201000 -- (-935.481) (-940.990) [-937.467] (-936.400) * [-934.694] (-939.265) (-940.832) (-936.343) -- 0:00:47
201500 -- [-935.870] (-935.548) (-936.067) (-937.488) * (-936.585) (-935.620) [-937.202] (-940.211) -- 0:00:47
202000 -- (-943.384) [-937.073] (-936.916) (-938.037) * [-936.244] (-935.557) (-937.188) (-935.556) -- 0:00:47
202500 -- [-938.730] (-936.975) (-936.739) (-936.467) * (-935.796) [-937.440] (-936.204) (-936.425) -- 0:00:47
203000 -- (-937.985) (-937.979) (-937.303) [-936.334] * (-935.780) [-936.591] (-937.269) (-935.375) -- 0:00:51
203500 -- (-941.701) (-938.686) (-936.646) [-935.635] * (-935.943) (-936.259) [-935.633] (-935.600) -- 0:00:50
204000 -- (-938.979) (-938.508) [-935.518] (-937.709) * (-939.898) [-935.971] (-935.034) (-937.136) -- 0:00:50
204500 -- (-938.657) (-935.238) (-937.068) [-944.311] * (-938.997) (-935.551) (-935.049) [-937.481] -- 0:00:50
205000 -- (-936.771) [-936.799] (-938.179) (-936.423) * (-937.859) (-938.312) (-937.874) [-935.500] -- 0:00:50
Average standard deviation of split frequencies: 0.010117
205500 -- (-941.519) [-936.552] (-936.711) (-936.929) * (-938.355) (-938.938) (-935.509) [-935.237] -- 0:00:50
206000 -- [-939.222] (-936.509) (-939.262) (-938.099) * (-939.051) (-937.733) (-937.456) [-935.415] -- 0:00:50
206500 -- (-939.371) [-935.640] (-936.333) (-935.759) * (-937.245) (-939.825) (-938.232) [-936.139] -- 0:00:49
207000 -- (-941.139) (-936.529) [-936.349] (-935.520) * (-936.154) [-940.422] (-935.803) (-938.329) -- 0:00:49
207500 -- (-936.219) (-937.331) [-939.254] (-935.371) * (-937.051) (-938.937) (-935.636) [-936.107] -- 0:00:49
208000 -- (-937.067) (-936.540) (-937.783) [-936.497] * [-936.119] (-937.793) (-935.130) (-937.171) -- 0:00:49
208500 -- (-937.892) [-936.268] (-938.932) (-941.954) * (-937.495) (-937.634) (-936.938) [-938.055] -- 0:00:49
209000 -- [-936.375] (-936.032) (-937.623) (-937.421) * (-936.024) [-938.022] (-940.876) (-937.547) -- 0:00:49
209500 -- (-936.964) (-935.122) [-938.361] (-937.592) * (-936.405) (-941.362) [-942.264] (-938.448) -- 0:00:49
210000 -- (-937.565) (-934.941) [-936.959] (-936.434) * (-936.613) [-936.335] (-941.893) (-937.969) -- 0:00:48
Average standard deviation of split frequencies: 0.008951
210500 -- [-939.240] (-936.309) (-937.052) (-935.759) * (-938.108) [-936.279] (-937.217) (-940.072) -- 0:00:48
211000 -- (-938.903) (-937.725) [-936.241] (-942.409) * [-936.601] (-936.553) (-935.914) (-936.488) -- 0:00:48
211500 -- (-936.505) [-941.610] (-936.441) (-939.696) * (-934.813) (-939.925) (-938.845) [-935.516] -- 0:00:48
212000 -- [-938.459] (-939.214) (-937.051) (-937.063) * (-936.448) (-938.206) [-937.199] (-942.287) -- 0:00:48
212500 -- (-936.956) (-938.203) (-935.790) [-935.816] * [-935.042] (-937.512) (-938.415) (-939.343) -- 0:00:48
213000 -- (-936.786) (-938.373) [-935.615] (-939.308) * (-935.639) (-935.453) (-936.666) [-936.956] -- 0:00:48
213500 -- (-935.905) (-937.466) [-935.241] (-935.980) * (-935.378) (-937.774) (-937.170) [-935.767] -- 0:00:47
214000 -- (-936.829) [-936.977] (-937.010) (-936.381) * (-936.145) (-941.116) [-936.882] (-936.341) -- 0:00:47
214500 -- (-935.533) (-938.932) (-936.070) [-934.750] * (-935.114) [-936.220] (-940.110) (-936.651) -- 0:00:47
215000 -- (-939.075) (-939.225) [-937.363] (-937.959) * (-939.153) [-935.852] (-936.037) (-939.471) -- 0:00:47
Average standard deviation of split frequencies: 0.008851
215500 -- (-936.808) (-938.793) (-939.741) [-935.883] * (-936.840) [-935.183] (-935.092) (-940.290) -- 0:00:47
216000 -- [-936.222] (-940.639) (-937.233) (-936.902) * [-935.825] (-938.052) (-939.956) (-939.110) -- 0:00:47
216500 -- (-937.515) [-934.648] (-936.859) (-937.795) * (-936.704) (-935.695) [-937.192] (-936.042) -- 0:00:47
217000 -- (-937.808) (-935.945) (-934.758) [-935.750] * (-939.446) (-942.238) [-938.651] (-937.034) -- 0:00:46
217500 -- (-936.813) (-934.964) [-935.350] (-942.303) * (-940.848) [-937.198] (-937.568) (-937.483) -- 0:00:46
218000 -- (-938.084) [-935.272] (-942.318) (-935.082) * (-937.338) [-936.301] (-935.559) (-937.624) -- 0:00:46
218500 -- [-937.157] (-937.842) (-939.374) (-935.708) * (-937.155) (-937.893) [-936.135] (-939.078) -- 0:00:46
219000 -- (-940.884) (-936.610) [-935.316] (-935.708) * (-938.576) (-936.443) (-935.738) [-937.287] -- 0:00:46
219500 -- (-937.081) [-935.421] (-935.850) (-934.878) * (-938.628) [-935.631] (-935.435) (-937.442) -- 0:00:46
220000 -- [-938.916] (-936.928) (-936.610) (-935.246) * (-940.806) (-936.121) (-935.913) [-938.430] -- 0:00:49
Average standard deviation of split frequencies: 0.009139
220500 -- (-937.077) (-937.509) (-939.289) [-936.522] * (-936.771) (-937.753) (-937.068) [-935.855] -- 0:00:49
221000 -- [-937.373] (-936.584) (-935.679) (-935.636) * (-936.541) (-941.434) [-936.778] (-935.303) -- 0:00:49
221500 -- (-937.336) (-937.129) (-936.343) [-936.210] * [-935.510] (-938.829) (-936.633) (-935.472) -- 0:00:49
222000 -- [-937.530] (-936.771) (-937.553) (-935.939) * (-936.463) [-936.245] (-937.190) (-937.690) -- 0:00:49
222500 -- (-936.942) [-937.083] (-939.007) (-937.582) * (-935.502) [-935.474] (-935.239) (-935.529) -- 0:00:48
223000 -- (-936.205) (-934.894) (-937.596) [-937.582] * (-935.759) (-937.116) [-936.592] (-935.314) -- 0:00:48
223500 -- (-936.522) [-935.161] (-935.009) (-936.073) * (-936.951) (-936.509) (-936.113) [-935.188] -- 0:00:48
224000 -- [-935.567] (-935.677) (-936.117) (-936.312) * (-935.745) (-935.564) (-936.335) [-935.098] -- 0:00:48
224500 -- (-935.339) [-936.256] (-937.316) (-936.740) * (-935.390) (-935.095) (-937.963) [-937.670] -- 0:00:48
225000 -- (-935.604) (-937.904) (-937.272) [-936.429] * (-938.862) (-935.140) (-936.444) [-935.926] -- 0:00:48
Average standard deviation of split frequencies: 0.009771
225500 -- [-935.196] (-938.557) (-936.388) (-938.383) * (-937.416) (-936.941) (-936.196) [-936.232] -- 0:00:48
226000 -- (-936.711) (-939.430) (-937.771) [-935.914] * (-937.887) (-937.609) (-937.404) [-937.603] -- 0:00:47
226500 -- (-935.743) (-939.494) (-942.206) [-936.623] * (-936.337) [-935.275] (-938.226) (-937.336) -- 0:00:47
227000 -- (-934.790) (-936.508) [-935.947] (-936.035) * (-938.531) (-937.267) (-937.204) [-935.593] -- 0:00:47
227500 -- (-936.984) [-940.046] (-939.280) (-936.710) * (-938.659) [-936.742] (-941.776) (-937.173) -- 0:00:47
228000 -- (-939.149) (-941.398) [-935.479] (-936.475) * (-936.996) [-937.052] (-936.372) (-936.541) -- 0:00:47
228500 -- (-935.025) (-938.623) [-936.870] (-939.454) * (-936.600) (-937.128) [-935.981] (-936.699) -- 0:00:47
229000 -- (-938.611) (-936.694) [-937.074] (-937.600) * (-936.754) (-937.392) (-938.577) [-936.296] -- 0:00:47
229500 -- [-935.358] (-936.715) (-937.666) (-938.140) * (-936.990) (-938.928) [-938.381] (-936.420) -- 0:00:47
230000 -- (-939.761) [-934.918] (-940.099) (-937.829) * (-936.327) (-938.685) (-937.468) [-935.935] -- 0:00:46
Average standard deviation of split frequencies: 0.009257
230500 -- (-939.465) (-939.793) (-939.655) [-940.139] * (-936.933) (-938.059) (-937.574) [-935.397] -- 0:00:46
231000 -- (-937.520) (-936.477) [-935.433] (-938.152) * (-939.025) (-940.940) (-936.619) [-934.921] -- 0:00:46
231500 -- (-936.077) [-936.676] (-941.173) (-936.870) * (-937.045) (-938.499) (-937.700) [-936.222] -- 0:00:46
232000 -- (-937.108) (-937.115) [-935.596] (-938.408) * [-936.431] (-936.880) (-937.402) (-935.308) -- 0:00:46
232500 -- (-937.104) (-937.800) [-936.247] (-937.411) * [-937.190] (-937.819) (-940.040) (-935.169) -- 0:00:46
233000 -- (-939.089) [-935.751] (-937.675) (-936.327) * (-936.479) [-936.220] (-939.291) (-935.297) -- 0:00:46
233500 -- (-940.474) [-935.146] (-937.808) (-939.229) * (-939.805) (-935.832) (-938.607) [-936.137] -- 0:00:45
234000 -- [-938.090] (-936.127) (-937.372) (-935.690) * (-937.785) [-935.493] (-939.136) (-936.078) -- 0:00:45
234500 -- (-935.807) (-935.554) (-936.982) [-935.720] * (-938.990) (-935.344) (-936.576) [-935.481] -- 0:00:45
235000 -- [-935.049] (-936.764) (-938.147) (-936.675) * (-938.818) [-935.647] (-937.383) (-936.194) -- 0:00:45
Average standard deviation of split frequencies: 0.008577
235500 -- (-934.590) [-938.249] (-935.303) (-936.998) * [-936.371] (-935.753) (-937.107) (-935.405) -- 0:00:45
236000 -- (-936.205) [-938.278] (-938.436) (-937.942) * (-937.671) (-936.944) (-935.078) [-935.024] -- 0:00:48
236500 -- (-939.561) [-939.421] (-939.209) (-938.625) * (-938.416) (-939.285) (-939.057) [-937.988] -- 0:00:48
237000 -- (-936.128) (-936.679) [-938.892] (-936.432) * (-936.408) (-940.149) [-936.839] (-935.671) -- 0:00:48
237500 -- (-936.281) (-936.305) [-936.660] (-938.410) * (-937.860) (-940.046) (-935.962) [-936.680] -- 0:00:48
238000 -- (-934.897) (-936.091) (-935.482) [-936.458] * (-937.797) [-937.949] (-935.233) (-935.634) -- 0:00:48
238500 -- (-940.155) (-937.420) [-935.014] (-937.376) * (-938.763) (-936.947) (-935.824) [-935.639] -- 0:00:47
239000 -- [-937.841] (-937.878) (-935.709) (-935.627) * (-938.528) (-935.784) [-935.671] (-935.943) -- 0:00:47
239500 -- (-936.654) [-937.857] (-937.101) (-935.446) * [-939.463] (-936.139) (-935.958) (-938.502) -- 0:00:47
240000 -- [-935.503] (-935.769) (-937.722) (-934.922) * (-936.911) [-935.261] (-940.872) (-937.735) -- 0:00:47
Average standard deviation of split frequencies: 0.011644
240500 -- [-935.967] (-937.917) (-936.354) (-935.626) * (-936.869) (-935.769) (-937.533) [-937.409] -- 0:00:47
241000 -- (-936.495) [-936.181] (-938.590) (-935.329) * [-936.281] (-936.399) (-936.969) (-938.194) -- 0:00:47
241500 -- (-942.226) (-937.374) (-936.152) [-936.069] * (-938.936) (-934.925) (-946.556) [-936.025] -- 0:00:47
242000 -- (-938.044) (-936.513) [-936.434] (-936.821) * (-937.468) [-935.020] (-939.209) (-934.621) -- 0:00:46
242500 -- [-939.586] (-936.419) (-941.292) (-937.230) * (-935.327) (-938.548) [-936.499] (-936.153) -- 0:00:46
243000 -- (-936.378) (-937.368) [-939.818] (-935.580) * (-936.145) [-934.686] (-937.922) (-939.682) -- 0:00:46
243500 -- [-936.782] (-936.832) (-936.884) (-936.850) * (-934.556) [-938.355] (-937.465) (-936.594) -- 0:00:46
244000 -- [-936.769] (-939.586) (-935.476) (-940.279) * (-934.561) (-936.696) (-934.862) [-934.874] -- 0:00:46
244500 -- (-938.939) (-939.586) [-939.227] (-938.047) * (-937.429) [-935.880] (-935.942) (-936.719) -- 0:00:46
245000 -- (-938.449) (-940.436) [-935.626] (-936.824) * [-935.569] (-936.593) (-939.028) (-941.156) -- 0:00:46
Average standard deviation of split frequencies: 0.012103
245500 -- (-936.215) (-939.533) [-936.474] (-936.936) * (-945.110) [-935.423] (-935.932) (-935.663) -- 0:00:46
246000 -- (-939.111) [-941.287] (-937.953) (-936.324) * (-937.332) [-936.241] (-937.027) (-935.832) -- 0:00:45
246500 -- [-937.747] (-938.036) (-936.233) (-938.110) * (-937.952) (-936.891) (-937.042) [-934.918] -- 0:00:45
247000 -- [-937.347] (-937.486) (-935.616) (-936.782) * (-938.273) (-936.584) [-936.882] (-935.150) -- 0:00:45
247500 -- (-936.760) (-937.672) (-935.313) [-935.832] * (-937.648) [-935.913] (-936.038) (-935.742) -- 0:00:45
248000 -- [-938.262] (-936.390) (-935.471) (-934.940) * (-938.055) (-935.914) [-938.875] (-935.392) -- 0:00:45
248500 -- (-939.337) [-934.946] (-937.173) (-935.947) * [-937.927] (-935.735) (-937.055) (-935.958) -- 0:00:45
249000 -- (-937.893) (-936.961) (-936.235) [-937.178] * (-938.118) [-935.480] (-942.353) (-937.197) -- 0:00:45
249500 -- [-937.680] (-936.573) (-936.595) (-935.325) * [-936.443] (-935.449) (-936.131) (-937.442) -- 0:00:45
250000 -- [-936.831] (-935.164) (-936.169) (-935.545) * (-937.025) (-936.770) [-935.606] (-939.226) -- 0:00:45
Average standard deviation of split frequencies: 0.010620
250500 -- (-936.503) (-935.266) (-936.890) [-935.205] * [-938.396] (-937.774) (-935.960) (-937.794) -- 0:00:44
251000 -- (-935.561) [-935.532] (-937.218) (-937.159) * (-938.608) [-935.561] (-935.671) (-936.551) -- 0:00:44
251500 -- (-937.709) [-939.459] (-938.113) (-936.781) * [-936.258] (-938.658) (-935.214) (-936.649) -- 0:00:44
252000 -- (-938.296) (-943.269) (-938.882) [-936.379] * (-940.490) (-936.333) (-936.230) [-937.494] -- 0:00:44
252500 -- (-936.449) (-936.217) [-935.732] (-938.190) * (-937.625) (-936.999) [-938.535] (-937.110) -- 0:00:44
253000 -- (-938.018) (-938.845) [-936.495] (-937.494) * (-937.166) [-937.710] (-938.292) (-939.128) -- 0:00:47
253500 -- (-935.434) (-935.261) [-936.105] (-935.834) * (-935.855) [-937.561] (-936.311) (-942.096) -- 0:00:47
254000 -- (-938.430) (-936.981) [-936.388] (-936.288) * [-935.547] (-936.066) (-938.230) (-938.998) -- 0:00:46
254500 -- (-936.263) [-937.636] (-936.471) (-935.747) * [-937.378] (-937.366) (-940.750) (-937.105) -- 0:00:46
255000 -- [-936.264] (-937.218) (-938.932) (-936.916) * (-937.136) [-938.612] (-938.242) (-937.740) -- 0:00:46
Average standard deviation of split frequencies: 0.010399
255500 -- (-935.322) (-939.664) (-939.128) [-937.755] * (-938.166) (-937.466) [-936.497] (-936.881) -- 0:00:46
256000 -- (-934.980) (-939.723) [-934.998] (-937.247) * (-936.908) (-936.555) [-936.052] (-941.445) -- 0:00:46
256500 -- (-934.927) (-935.671) [-935.751] (-935.528) * (-941.275) (-936.283) [-937.416] (-935.911) -- 0:00:46
257000 -- (-935.849) (-935.101) (-936.435) [-934.963] * [-936.089] (-935.354) (-937.469) (-937.225) -- 0:00:46
257500 -- (-936.400) (-935.398) (-936.330) [-935.767] * (-936.127) (-935.246) (-940.256) [-938.563] -- 0:00:46
258000 -- (-939.427) (-935.311) (-942.061) [-936.168] * [-936.129] (-935.161) (-937.578) (-947.546) -- 0:00:46
258500 -- (-936.865) (-941.412) (-943.331) [-934.914] * [-936.134] (-935.381) (-936.022) (-937.061) -- 0:00:45
259000 -- [-940.520] (-937.345) (-939.753) (-935.603) * [-937.502] (-937.054) (-936.104) (-937.374) -- 0:00:45
259500 -- (-940.514) [-937.280] (-942.522) (-934.820) * (-936.325) [-935.544] (-935.702) (-936.129) -- 0:00:45
260000 -- (-942.597) (-937.527) [-936.968] (-935.287) * (-935.583) [-936.156] (-936.738) (-936.881) -- 0:00:45
Average standard deviation of split frequencies: 0.012358
260500 -- [-935.845] (-936.745) (-937.786) (-936.065) * (-935.464) (-935.445) [-936.901] (-940.794) -- 0:00:45
261000 -- (-940.944) (-936.507) [-938.961] (-936.807) * [-936.930] (-936.578) (-938.738) (-939.857) -- 0:00:45
261500 -- (-944.776) [-938.388] (-936.463) (-937.733) * (-936.226) (-944.720) (-938.450) [-937.090] -- 0:00:45
262000 -- (-945.630) [-936.610] (-937.687) (-935.286) * [-936.226] (-938.646) (-935.113) (-937.171) -- 0:00:45
262500 -- [-936.395] (-936.266) (-936.220) (-937.955) * (-935.613) [-935.711] (-936.682) (-936.237) -- 0:00:44
263000 -- [-935.156] (-938.773) (-936.737) (-937.931) * [-934.900] (-938.542) (-935.074) (-937.889) -- 0:00:44
263500 -- [-936.003] (-936.052) (-940.866) (-939.661) * (-937.931) (-936.213) [-936.974] (-936.047) -- 0:00:44
264000 -- (-938.540) [-936.797] (-935.991) (-937.081) * (-936.597) (-936.815) (-937.577) [-936.046] -- 0:00:44
264500 -- (-939.232) (-936.530) [-939.769] (-939.418) * (-936.315) (-934.935) (-936.353) [-937.453] -- 0:00:44
265000 -- (-938.970) (-938.156) [-938.615] (-939.236) * [-934.995] (-936.727) (-938.675) (-938.266) -- 0:00:44
Average standard deviation of split frequencies: 0.012208
265500 -- (-938.592) (-937.913) (-937.453) [-941.217] * (-935.514) (-936.858) [-940.110] (-936.039) -- 0:00:44
266000 -- [-939.307] (-937.085) (-936.888) (-938.438) * (-935.840) (-935.334) (-941.983) [-938.086] -- 0:00:44
266500 -- (-936.107) (-935.612) [-936.363] (-936.730) * (-939.336) (-940.332) [-939.052] (-939.318) -- 0:00:44
267000 -- (-936.038) [-935.497] (-935.934) (-937.282) * (-940.078) (-940.253) [-936.415] (-936.016) -- 0:00:43
267500 -- [-937.598] (-935.439) (-935.249) (-937.781) * [-937.204] (-935.526) (-936.477) (-936.200) -- 0:00:43
268000 -- [-935.834] (-935.712) (-935.476) (-937.776) * (-936.883) (-934.775) (-937.665) [-935.725] -- 0:00:43
268500 -- [-936.034] (-937.557) (-935.549) (-935.941) * [-941.389] (-935.621) (-936.992) (-937.672) -- 0:00:43
269000 -- (-935.199) (-936.220) [-937.348] (-936.894) * (-938.335) (-939.657) (-938.702) [-936.208] -- 0:00:43
269500 -- [-936.204] (-939.405) (-937.703) (-938.028) * [-938.554] (-939.522) (-936.718) (-937.427) -- 0:00:46
270000 -- (-935.654) [-938.382] (-938.542) (-937.562) * (-936.415) (-942.847) [-937.404] (-936.206) -- 0:00:45
Average standard deviation of split frequencies: 0.010643
270500 -- (-936.790) (-936.935) (-937.087) [-935.966] * (-934.994) (-937.635) [-936.279] (-943.223) -- 0:00:45
271000 -- (-936.864) (-936.222) (-939.276) [-936.227] * [-935.553] (-937.223) (-934.767) (-938.566) -- 0:00:45
271500 -- (-936.183) (-935.359) [-936.077] (-935.882) * (-937.170) [-936.010] (-938.492) (-937.384) -- 0:00:45
272000 -- [-936.489] (-939.342) (-940.425) (-937.806) * [-937.125] (-937.088) (-935.728) (-937.572) -- 0:00:45
272500 -- (-936.027) [-937.897] (-938.238) (-936.554) * [-936.129] (-936.536) (-934.939) (-937.016) -- 0:00:45
273000 -- [-937.379] (-941.749) (-939.565) (-936.023) * (-937.405) (-938.237) (-935.883) [-936.787] -- 0:00:45
273500 -- (-938.023) (-941.811) [-936.410] (-940.174) * (-938.185) [-935.373] (-936.595) (-935.847) -- 0:00:45
274000 -- [-937.410] (-940.137) (-940.560) (-937.788) * [-935.512] (-935.747) (-935.196) (-935.959) -- 0:00:45
274500 -- (-938.862) [-938.023] (-941.605) (-935.994) * [-935.054] (-935.626) (-937.958) (-937.663) -- 0:00:44
275000 -- (-937.195) (-939.730) [-938.538] (-938.194) * [-936.157] (-937.118) (-938.427) (-937.159) -- 0:00:44
Average standard deviation of split frequencies: 0.010153
275500 -- (-937.776) (-938.965) (-939.690) [-935.672] * (-937.161) [-935.339] (-936.302) (-938.390) -- 0:00:44
276000 -- (-938.566) (-938.480) (-937.824) [-935.060] * (-938.523) (-937.483) (-937.113) [-937.569] -- 0:00:44
276500 -- [-939.152] (-937.952) (-936.791) (-935.283) * (-936.468) (-937.002) [-936.342] (-937.048) -- 0:00:44
277000 -- [-939.039] (-935.990) (-936.296) (-935.065) * (-936.872) (-935.524) (-941.316) [-935.727] -- 0:00:44
277500 -- (-938.028) (-936.300) (-937.009) [-936.024] * (-937.416) [-939.292] (-938.743) (-936.455) -- 0:00:44
278000 -- (-937.560) (-936.007) [-935.793] (-937.090) * [-936.439] (-937.862) (-940.764) (-939.361) -- 0:00:44
278500 -- [-936.501] (-936.675) (-940.200) (-936.568) * (-936.966) (-940.621) (-936.564) [-938.807] -- 0:00:44
279000 -- [-935.890] (-935.483) (-936.594) (-937.648) * (-938.922) (-935.651) [-938.631] (-935.766) -- 0:00:43
279500 -- [-941.142] (-936.134) (-939.419) (-937.771) * (-938.555) (-935.739) (-938.390) [-934.953] -- 0:00:43
280000 -- (-937.411) (-935.871) [-938.367] (-936.914) * (-937.043) (-940.354) [-936.809] (-935.464) -- 0:00:43
Average standard deviation of split frequencies: 0.010264
280500 -- (-935.197) (-937.136) (-935.773) [-938.915] * (-938.771) [-935.694] (-935.326) (-935.521) -- 0:00:43
281000 -- (-935.317) (-937.111) [-936.549] (-942.091) * (-941.876) [-936.170] (-934.993) (-936.213) -- 0:00:43
281500 -- (-937.088) (-938.806) (-936.593) [-936.831] * [-937.450] (-938.268) (-934.714) (-936.081) -- 0:00:43
282000 -- (-935.941) (-938.180) [-938.376] (-939.305) * (-937.222) [-936.626] (-940.622) (-937.069) -- 0:00:43
282500 -- (-939.842) (-936.575) (-935.950) [-934.997] * (-939.926) [-937.806] (-937.678) (-936.793) -- 0:00:43
283000 -- [-937.453] (-939.198) (-939.604) (-940.694) * (-940.412) (-936.419) [-937.220] (-936.759) -- 0:00:43
283500 -- (-937.702) (-938.735) (-939.027) [-936.630] * [-935.169] (-936.675) (-937.789) (-936.188) -- 0:00:42
284000 -- [-938.856] (-940.249) (-938.112) (-938.152) * (-936.377) (-937.680) (-939.178) [-938.327] -- 0:00:42
284500 -- (-944.568) [-940.253] (-938.690) (-943.133) * [-935.695] (-937.501) (-935.754) (-936.122) -- 0:00:42
285000 -- [-937.052] (-936.725) (-937.416) (-940.764) * (-938.249) [-938.186] (-936.697) (-937.441) -- 0:00:42
Average standard deviation of split frequencies: 0.010805
285500 -- [-938.140] (-940.006) (-936.078) (-940.138) * [-937.576] (-937.447) (-935.284) (-936.284) -- 0:00:42
286000 -- [-939.174] (-938.788) (-936.857) (-938.186) * (-935.987) (-935.290) (-937.579) [-936.524] -- 0:00:44
286500 -- (-942.861) (-937.569) [-936.901] (-935.844) * (-935.852) (-936.243) (-936.527) [-936.603] -- 0:00:44
287000 -- (-935.378) [-936.514] (-939.320) (-935.727) * [-934.653] (-934.919) (-939.624) (-937.638) -- 0:00:44
287500 -- [-935.343] (-936.948) (-935.771) (-939.698) * (-936.858) [-934.925] (-937.924) (-936.594) -- 0:00:44
288000 -- [-935.343] (-939.005) (-934.812) (-936.328) * [-938.325] (-936.830) (-941.054) (-940.190) -- 0:00:44
288500 -- (-936.526) (-940.110) (-937.129) [-939.190] * (-936.486) [-935.122] (-938.903) (-937.352) -- 0:00:44
289000 -- [-937.836] (-938.416) (-935.846) (-939.237) * (-936.399) (-934.856) (-936.708) [-937.533] -- 0:00:44
289500 -- (-936.073) (-936.731) [-935.363] (-936.991) * (-937.328) (-935.538) (-935.873) [-935.649] -- 0:00:44
290000 -- (-937.357) [-934.980] (-936.572) (-937.284) * [-936.222] (-935.541) (-936.966) (-936.973) -- 0:00:44
Average standard deviation of split frequencies: 0.010208
290500 -- (-937.289) (-938.327) [-935.745] (-937.015) * (-935.926) [-936.660] (-937.408) (-937.578) -- 0:00:43
291000 -- (-938.684) [-939.052] (-939.232) (-934.883) * (-940.623) (-935.721) (-937.124) [-934.945] -- 0:00:43
291500 -- (-937.786) [-936.769] (-935.923) (-935.441) * (-938.494) (-935.685) (-938.878) [-936.314] -- 0:00:43
292000 -- [-938.098] (-936.609) (-942.138) (-935.600) * (-940.351) (-935.545) [-939.743] (-936.189) -- 0:00:43
292500 -- (-937.794) (-938.117) [-935.944] (-937.464) * (-938.125) (-935.340) (-940.579) [-935.114] -- 0:00:43
293000 -- (-935.654) [-937.696] (-935.484) (-936.006) * (-936.828) [-936.770] (-935.985) (-939.261) -- 0:00:43
293500 -- (-936.526) (-946.573) (-940.886) [-936.559] * (-939.320) [-936.032] (-936.859) (-936.627) -- 0:00:43
294000 -- [-938.085] (-939.744) (-937.257) (-935.900) * (-939.711) (-934.640) (-938.502) [-937.405] -- 0:00:43
294500 -- (-941.238) (-938.061) [-936.841] (-935.848) * [-938.509] (-935.476) (-935.276) (-936.931) -- 0:00:43
295000 -- (-938.355) (-936.575) (-937.229) [-936.690] * (-937.667) (-937.301) [-937.969] (-936.028) -- 0:00:43
Average standard deviation of split frequencies: 0.010586
295500 -- (-939.808) [-936.478] (-937.181) (-935.939) * [-935.960] (-936.122) (-937.279) (-937.407) -- 0:00:42
296000 -- (-937.994) (-943.303) (-935.825) [-938.334] * (-935.945) [-937.875] (-937.858) (-937.874) -- 0:00:42
296500 -- [-937.097] (-938.985) (-935.037) (-935.687) * (-936.316) (-936.161) [-938.534] (-939.200) -- 0:00:42
297000 -- [-938.546] (-943.042) (-936.548) (-936.808) * [-935.361] (-937.874) (-938.561) (-936.055) -- 0:00:42
297500 -- (-940.198) (-936.746) (-936.382) [-936.372] * [-935.019] (-939.896) (-939.421) (-942.122) -- 0:00:42
298000 -- (-938.836) (-935.999) (-935.264) [-935.952] * (-935.151) (-939.290) (-938.060) [-939.931] -- 0:00:42
298500 -- (-938.739) (-935.117) (-937.083) [-936.248] * (-935.664) [-938.389] (-935.782) (-937.771) -- 0:00:42
299000 -- (-941.680) (-937.618) [-938.900] (-938.967) * (-934.785) (-935.351) [-935.510] (-935.469) -- 0:00:42
299500 -- (-941.399) (-935.917) (-939.522) [-935.968] * (-935.418) [-937.384] (-940.270) (-935.552) -- 0:00:42
300000 -- (-936.897) (-938.086) [-937.080] (-935.387) * (-937.815) (-937.860) (-939.084) [-935.294] -- 0:00:42
Average standard deviation of split frequencies: 0.010237
300500 -- (-936.431) (-937.859) [-935.951] (-936.813) * [-936.953] (-938.004) (-935.935) (-938.070) -- 0:00:41
301000 -- (-936.582) (-935.988) [-937.004] (-937.089) * (-940.684) (-936.371) (-937.086) [-936.221] -- 0:00:41
301500 -- [-937.629] (-935.838) (-934.680) (-937.797) * (-937.724) [-940.671] (-935.215) (-936.899) -- 0:00:41
302000 -- (-938.046) [-936.083] (-937.588) (-938.235) * (-935.704) (-935.016) [-939.166] (-935.989) -- 0:00:41
302500 -- (-938.983) (-937.314) (-937.829) [-934.893] * (-936.657) (-937.531) (-940.587) [-940.625] -- 0:00:41
303000 -- (-937.145) [-936.036] (-936.587) (-935.511) * (-937.961) (-938.348) (-941.304) [-937.236] -- 0:00:43
303500 -- (-937.924) [-937.484] (-937.960) (-936.763) * (-941.526) [-937.211] (-938.116) (-941.393) -- 0:00:43
304000 -- (-939.333) (-935.807) (-937.259) [-937.753] * [-939.051] (-935.136) (-937.267) (-937.583) -- 0:00:43
304500 -- (-938.725) (-938.219) [-941.802] (-937.052) * (-937.640) (-935.430) [-939.880] (-935.714) -- 0:00:43
305000 -- (-936.652) (-945.489) (-940.574) [-939.156] * (-940.185) (-936.355) (-937.620) [-936.327] -- 0:00:43
Average standard deviation of split frequencies: 0.009842
305500 -- (-938.729) [-936.720] (-938.059) (-937.287) * (-935.410) (-935.372) [-938.507] (-936.282) -- 0:00:43
306000 -- [-938.833] (-935.408) (-939.158) (-937.923) * (-938.905) (-939.438) (-935.207) [-935.127] -- 0:00:43
306500 -- [-937.456] (-936.207) (-936.113) (-938.942) * (-937.983) [-935.669] (-936.312) (-936.932) -- 0:00:42
307000 -- (-937.646) (-935.313) [-935.620] (-939.511) * (-935.928) (-935.317) [-936.268] (-935.894) -- 0:00:42
307500 -- (-940.414) [-934.944] (-935.962) (-936.357) * (-936.739) [-935.522] (-936.716) (-943.626) -- 0:00:42
308000 -- [-936.652] (-938.205) (-935.831) (-937.523) * [-937.507] (-937.301) (-938.375) (-936.012) -- 0:00:42
308500 -- (-934.751) [-936.306] (-936.023) (-939.359) * [-937.477] (-937.093) (-937.443) (-936.631) -- 0:00:42
309000 -- (-934.966) (-937.938) (-936.296) [-941.239] * (-937.941) [-937.227] (-936.923) (-935.474) -- 0:00:42
309500 -- [-936.054] (-937.485) (-934.964) (-937.630) * [-935.058] (-935.056) (-937.800) (-937.655) -- 0:00:42
310000 -- [-935.658] (-936.774) (-935.490) (-942.746) * [-938.479] (-937.249) (-937.750) (-939.006) -- 0:00:42
Average standard deviation of split frequencies: 0.009947
310500 -- [-936.803] (-939.729) (-935.578) (-936.662) * [-941.210] (-936.765) (-936.424) (-939.733) -- 0:00:42
311000 -- (-936.203) (-936.628) [-935.035] (-938.071) * (-937.569) (-936.349) [-938.269] (-936.203) -- 0:00:42
311500 -- (-936.552) (-941.478) [-936.614] (-940.215) * [-936.036] (-934.782) (-937.458) (-936.587) -- 0:00:41
312000 -- [-935.807] (-938.299) (-936.319) (-939.520) * (-936.867) (-936.007) [-939.200] (-936.050) -- 0:00:41
312500 -- [-938.027] (-942.195) (-937.994) (-935.934) * (-938.225) [-934.913] (-937.597) (-936.749) -- 0:00:41
313000 -- (-938.265) [-936.051] (-938.983) (-935.771) * (-935.551) [-936.599] (-939.489) (-939.592) -- 0:00:41
313500 -- (-938.808) [-935.538] (-936.111) (-935.559) * (-935.467) [-936.389] (-935.821) (-943.128) -- 0:00:41
314000 -- [-936.899] (-940.177) (-939.119) (-935.512) * [-936.642] (-937.376) (-935.242) (-936.846) -- 0:00:41
314500 -- (-935.951) (-942.207) (-936.206) [-936.582] * [-935.513] (-938.501) (-937.636) (-937.989) -- 0:00:41
315000 -- (-940.997) (-943.157) [-937.690] (-936.682) * (-937.218) (-936.845) [-937.214] (-937.148) -- 0:00:41
Average standard deviation of split frequencies: 0.008951
315500 -- [-937.109] (-942.747) (-937.787) (-937.561) * (-937.132) (-937.793) (-937.235) [-937.328] -- 0:00:41
316000 -- (-935.209) (-938.836) (-936.582) [-937.918] * (-936.266) (-936.931) (-936.831) [-938.510] -- 0:00:41
316500 -- [-935.852] (-935.991) (-937.775) (-937.967) * [-942.851] (-935.472) (-936.050) (-938.161) -- 0:00:41
317000 -- (-936.389) (-936.797) [-935.203] (-938.190) * [-936.040] (-936.724) (-935.152) (-938.025) -- 0:00:40
317500 -- (-937.237) (-936.960) [-939.112] (-939.864) * (-943.177) [-936.269] (-943.551) (-936.928) -- 0:00:40
318000 -- [-937.839] (-937.907) (-938.870) (-940.849) * (-936.013) (-936.063) (-935.991) [-936.866] -- 0:00:40
318500 -- [-936.348] (-937.037) (-939.128) (-940.348) * [-935.653] (-936.561) (-938.331) (-935.116) -- 0:00:40
319000 -- (-940.919) [-935.806] (-937.806) (-936.081) * (-939.267) (-939.052) [-937.015] (-936.706) -- 0:00:40
319500 -- (-937.764) (-937.353) [-936.289] (-936.159) * [-937.805] (-941.853) (-937.213) (-936.547) -- 0:00:42
320000 -- (-937.675) (-936.663) (-936.404) [-935.505] * (-936.020) (-935.301) (-937.733) [-936.175] -- 0:00:42
Average standard deviation of split frequencies: 0.009599
320500 -- (-937.047) [-936.472] (-936.562) (-936.132) * [-936.018] (-940.188) (-939.614) (-941.802) -- 0:00:42
321000 -- (-935.648) (-936.320) [-936.320] (-936.697) * [-935.931] (-937.385) (-937.323) (-935.783) -- 0:00:42
321500 -- (-937.352) (-935.820) [-938.643] (-937.609) * (-939.283) (-936.897) [-937.121] (-937.286) -- 0:00:42
322000 -- (-943.621) [-937.875] (-935.108) (-935.355) * (-936.970) (-937.950) [-937.553] (-937.181) -- 0:00:42
322500 -- (-937.862) [-938.289] (-935.152) (-935.234) * (-937.692) (-937.991) (-936.498) [-938.339] -- 0:00:42
323000 -- (-935.753) [-936.003] (-935.433) (-935.645) * (-935.535) [-935.328] (-938.671) (-937.981) -- 0:00:41
323500 -- (-935.925) (-935.991) (-936.695) [-937.601] * (-936.559) [-937.848] (-938.234) (-936.840) -- 0:00:41
324000 -- (-937.417) (-936.404) [-936.037] (-938.577) * (-934.720) (-938.109) (-940.889) [-935.807] -- 0:00:41
324500 -- [-935.377] (-936.272) (-936.543) (-937.090) * (-935.917) (-937.777) [-935.357] (-940.479) -- 0:00:41
325000 -- (-936.713) (-936.224) (-939.464) [-936.490] * (-936.686) (-938.227) (-939.575) [-934.753] -- 0:00:41
Average standard deviation of split frequencies: 0.009952
325500 -- (-936.531) (-938.407) (-937.636) [-936.618] * [-936.476] (-937.487) (-937.188) (-935.975) -- 0:00:41
326000 -- [-936.118] (-935.721) (-940.801) (-935.883) * (-936.598) [-936.955] (-940.469) (-935.518) -- 0:00:41
326500 -- (-937.354) [-936.840] (-940.093) (-936.001) * (-936.976) (-936.052) [-936.023] (-934.805) -- 0:00:41
327000 -- (-936.760) (-938.105) (-938.928) [-935.528] * [-936.743] (-938.953) (-938.818) (-938.762) -- 0:00:41
327500 -- (-936.642) (-937.849) [-936.792] (-935.469) * (-936.500) (-937.798) [-936.385] (-936.704) -- 0:00:41
328000 -- (-936.173) (-939.273) (-935.987) [-936.325] * (-938.081) [-937.832] (-937.826) (-934.837) -- 0:00:40
328500 -- (-935.095) (-937.363) (-935.290) [-936.687] * (-937.099) (-937.661) (-936.251) [-934.836] -- 0:00:40
329000 -- [-935.049] (-937.787) (-934.965) (-937.855) * (-935.622) (-937.298) [-935.372] (-936.857) -- 0:00:40
329500 -- (-936.762) (-935.370) [-935.900] (-935.731) * (-936.533) [-937.717] (-939.379) (-938.418) -- 0:00:40
330000 -- (-937.018) (-936.929) [-934.962] (-936.766) * (-937.511) [-936.161] (-937.331) (-934.744) -- 0:00:40
Average standard deviation of split frequencies: 0.010063
330500 -- [-937.304] (-937.455) (-935.311) (-940.254) * [-938.303] (-936.217) (-937.852) (-935.545) -- 0:00:40
331000 -- (-938.750) (-937.087) (-941.238) [-937.165] * (-938.170) (-936.980) (-937.691) [-935.335] -- 0:00:40
331500 -- (-935.011) [-939.044] (-941.552) (-938.129) * (-937.429) (-935.756) (-936.271) [-936.769] -- 0:00:40
332000 -- (-935.513) [-938.289] (-939.366) (-936.363) * (-936.783) (-936.499) [-935.204] (-935.872) -- 0:00:40
332500 -- (-935.513) (-936.914) [-938.453] (-936.767) * (-936.492) (-939.512) [-934.826] (-938.198) -- 0:00:40
333000 -- (-936.507) (-936.466) (-938.772) [-935.672] * (-937.128) (-938.460) [-937.282] (-941.387) -- 0:00:40
333500 -- (-938.022) [-939.441] (-935.434) (-936.933) * (-937.447) [-937.761] (-937.460) (-941.104) -- 0:00:39
334000 -- (-937.876) (-937.384) (-936.947) [-937.283] * (-939.037) [-936.949] (-938.206) (-935.589) -- 0:00:39
334500 -- [-935.324] (-939.764) (-935.862) (-936.140) * (-938.870) (-940.381) [-936.277] (-935.257) -- 0:00:39
335000 -- [-936.212] (-936.717) (-935.983) (-936.563) * (-935.611) (-936.329) [-942.015] (-939.010) -- 0:00:39
Average standard deviation of split frequencies: 0.010234
335500 -- (-935.146) (-936.667) (-942.994) [-938.439] * (-935.907) (-942.301) [-936.692] (-937.182) -- 0:00:41
336000 -- (-939.601) (-936.089) (-942.655) [-936.760] * (-938.696) (-936.139) (-937.072) [-937.831] -- 0:00:41
336500 -- (-936.759) [-935.603] (-936.825) (-937.813) * (-936.834) [-936.404] (-935.529) (-936.573) -- 0:00:41
337000 -- [-935.296] (-935.638) (-936.997) (-941.321) * (-935.017) [-937.178] (-935.945) (-937.471) -- 0:00:41
337500 -- [-935.683] (-935.195) (-938.671) (-940.149) * (-935.727) [-935.646] (-936.745) (-936.673) -- 0:00:41
338000 -- [-938.289] (-936.985) (-938.392) (-935.465) * (-936.503) [-936.607] (-936.301) (-936.906) -- 0:00:41
338500 -- (-938.128) [-936.877] (-936.451) (-935.213) * (-942.768) [-936.997] (-935.820) (-940.883) -- 0:00:41
339000 -- (-937.036) (-936.254) (-936.858) [-940.478] * (-938.657) [-936.588] (-936.349) (-937.036) -- 0:00:40
339500 -- (-935.469) [-936.796] (-936.255) (-936.447) * [-938.448] (-935.434) (-935.838) (-936.952) -- 0:00:40
340000 -- (-938.755) [-936.680] (-940.541) (-935.106) * (-935.697) (-935.579) [-936.929] (-935.916) -- 0:00:40
Average standard deviation of split frequencies: 0.010419
340500 -- (-938.334) (-935.668) (-936.963) [-936.021] * (-935.682) (-938.110) (-939.403) [-935.634] -- 0:00:40
341000 -- (-939.795) (-935.524) (-938.350) [-938.761] * (-935.586) [-936.427] (-938.990) (-935.545) -- 0:00:40
341500 -- (-937.091) (-937.017) (-939.670) [-940.295] * (-936.735) [-939.592] (-936.289) (-935.512) -- 0:00:40
342000 -- [-934.808] (-935.680) (-938.866) (-937.110) * (-936.036) (-935.388) (-936.586) [-936.249] -- 0:00:40
342500 -- (-935.299) [-936.366] (-937.434) (-937.558) * (-938.013) [-935.087] (-936.305) (-938.506) -- 0:00:40
343000 -- (-936.012) (-935.275) (-938.049) [-939.833] * (-936.823) (-936.173) (-937.089) [-937.032] -- 0:00:40
343500 -- [-936.118] (-937.168) (-941.672) (-940.243) * (-935.817) (-937.408) [-939.277] (-938.981) -- 0:00:40
344000 -- (-936.873) (-936.256) [-936.372] (-937.193) * (-936.184) [-936.030] (-940.073) (-939.526) -- 0:00:40
344500 -- [-940.539] (-936.243) (-937.771) (-936.529) * (-935.793) (-940.794) (-939.702) [-936.009] -- 0:00:39
345000 -- [-935.232] (-935.806) (-938.378) (-938.456) * (-935.830) [-940.194] (-942.333) (-935.989) -- 0:00:39
Average standard deviation of split frequencies: 0.010018
345500 -- [-939.460] (-936.509) (-946.003) (-940.540) * (-935.732) (-936.976) (-938.734) [-937.937] -- 0:00:39
346000 -- (-935.641) (-936.024) (-939.737) [-936.379] * (-938.896) (-939.515) (-935.893) [-935.675] -- 0:00:39
346500 -- (-940.083) (-935.171) [-935.608] (-936.672) * (-936.888) (-937.266) [-937.959] (-935.809) -- 0:00:39
347000 -- (-939.430) [-935.141] (-937.051) (-937.513) * [-935.923] (-939.367) (-938.305) (-937.447) -- 0:00:39
347500 -- (-937.366) (-936.810) (-937.432) [-936.894] * (-935.848) (-941.583) (-937.194) [-937.447] -- 0:00:39
348000 -- [-940.447] (-936.352) (-938.277) (-937.344) * (-936.411) [-935.657] (-936.513) (-940.190) -- 0:00:39
348500 -- [-941.072] (-936.750) (-937.495) (-936.253) * (-935.279) [-935.890] (-936.942) (-936.222) -- 0:00:39
349000 -- (-940.018) (-935.523) [-936.723] (-935.117) * [-936.397] (-935.528) (-936.249) (-936.939) -- 0:00:39
349500 -- (-941.543) (-936.511) (-936.793) [-936.026] * (-936.170) (-938.097) (-936.651) [-937.348] -- 0:00:39
350000 -- (-937.110) (-938.590) (-935.443) [-937.450] * [-935.599] (-936.222) (-935.321) (-938.433) -- 0:00:39
Average standard deviation of split frequencies: 0.009410
350500 -- (-938.820) [-936.629] (-937.431) (-935.337) * (-936.840) [-936.693] (-935.361) (-935.005) -- 0:00:38
351000 -- (-939.820) (-937.048) (-938.690) [-937.714] * (-938.808) (-935.909) (-939.237) [-935.115] -- 0:00:38
351500 -- (-936.098) [-936.890] (-937.503) (-939.963) * (-943.103) [-935.184] (-937.311) (-935.250) -- 0:00:38
352000 -- (-936.021) (-939.590) [-938.459] (-940.606) * [-937.107] (-937.143) (-937.038) (-939.303) -- 0:00:38
352500 -- [-936.838] (-941.276) (-936.192) (-940.109) * (-936.770) (-939.876) (-935.361) [-936.572] -- 0:00:40
353000 -- (-937.590) [-934.778] (-935.760) (-942.972) * (-936.611) [-937.492] (-935.696) (-935.010) -- 0:00:40
353500 -- [-935.005] (-936.919) (-936.573) (-940.716) * (-936.149) (-937.305) (-934.902) [-936.615] -- 0:00:40
354000 -- [-935.918] (-937.924) (-937.007) (-939.612) * (-936.997) (-936.216) [-936.469] (-935.199) -- 0:00:40
354500 -- (-941.291) (-935.117) [-938.536] (-937.858) * (-935.643) [-940.996] (-936.424) (-936.919) -- 0:00:40
355000 -- (-944.159) (-938.629) (-942.682) [-937.832] * (-936.226) (-936.053) [-935.005] (-940.231) -- 0:00:39
Average standard deviation of split frequencies: 0.009659
355500 -- (-942.773) (-935.398) (-938.027) [-935.349] * (-936.208) (-936.172) [-935.005] (-938.021) -- 0:00:39
356000 -- (-936.427) (-936.142) [-935.848] (-937.973) * (-939.500) (-935.851) [-935.807] (-935.749) -- 0:00:39
356500 -- (-936.344) (-938.244) (-934.976) [-938.896] * (-939.024) [-935.354] (-935.804) (-938.061) -- 0:00:39
357000 -- (-935.544) (-936.656) (-936.686) [-938.753] * (-944.049) [-936.166] (-935.501) (-937.104) -- 0:00:39
357500 -- [-937.350] (-947.082) (-936.948) (-936.447) * (-939.163) [-935.352] (-936.822) (-937.782) -- 0:00:39
358000 -- [-937.280] (-936.772) (-945.668) (-937.521) * (-939.719) [-936.946] (-936.348) (-935.643) -- 0:00:39
358500 -- [-937.296] (-935.264) (-937.549) (-937.930) * (-941.666) [-937.392] (-936.482) (-937.042) -- 0:00:39
359000 -- (-936.697) (-935.575) (-938.000) [-935.974] * (-939.146) (-936.129) [-936.504] (-936.947) -- 0:00:39
359500 -- [-937.632] (-939.140) (-938.603) (-938.750) * (-935.635) (-937.596) (-939.167) [-936.808] -- 0:00:39
360000 -- (-938.616) (-938.054) (-937.060) [-939.376] * (-935.774) (-937.990) [-936.249] (-936.255) -- 0:00:39
Average standard deviation of split frequencies: 0.010764
360500 -- [-939.826] (-938.732) (-935.524) (-937.405) * (-936.734) [-936.226] (-935.750) (-937.014) -- 0:00:39
361000 -- (-940.081) (-936.415) [-935.859] (-944.770) * (-938.318) [-940.722] (-940.473) (-937.676) -- 0:00:38
361500 -- (-935.212) [-936.911] (-937.327) (-938.846) * (-937.388) (-936.414) (-938.479) [-936.450] -- 0:00:38
362000 -- (-936.439) (-935.543) [-935.812] (-939.200) * [-935.906] (-935.041) (-935.651) (-936.865) -- 0:00:38
362500 -- (-938.335) (-936.984) [-938.175] (-935.082) * (-935.071) (-936.431) (-937.295) [-936.815] -- 0:00:38
363000 -- (-937.963) (-936.726) [-935.508] (-935.238) * (-935.867) (-935.695) [-941.635] (-936.811) -- 0:00:38
363500 -- (-938.908) (-939.436) [-937.506] (-937.861) * (-936.977) [-934.773] (-940.020) (-938.266) -- 0:00:38
364000 -- [-936.730] (-935.572) (-938.130) (-939.572) * (-938.871) (-934.732) (-938.738) [-938.476] -- 0:00:38
364500 -- (-936.019) (-935.370) [-937.029] (-940.154) * [-937.244] (-936.807) (-938.367) (-936.094) -- 0:00:38
365000 -- (-935.432) [-940.844] (-936.857) (-940.450) * (-938.483) [-935.462] (-935.448) (-935.563) -- 0:00:38
Average standard deviation of split frequencies: 0.008940
365500 -- (-936.971) (-935.971) (-943.844) [-939.012] * (-936.508) (-937.047) [-936.275] (-936.366) -- 0:00:38
366000 -- (-937.838) (-938.584) [-934.820] (-938.195) * [-936.074] (-936.517) (-941.061) (-939.133) -- 0:00:38
366500 -- [-934.976] (-938.627) (-936.743) (-938.734) * (-938.722) (-938.611) (-937.215) [-937.628] -- 0:00:38
367000 -- (-937.626) (-936.550) [-935.220] (-938.233) * (-938.190) (-935.513) (-936.904) [-935.950] -- 0:00:37
367500 -- (-936.055) (-937.021) [-937.797] (-940.212) * (-937.119) [-937.446] (-940.418) (-937.505) -- 0:00:37
368000 -- [-936.047] (-936.150) (-935.736) (-939.256) * (-937.708) [-935.270] (-950.325) (-935.963) -- 0:00:37
368500 -- (-934.585) (-938.831) [-936.535] (-940.465) * (-937.689) (-937.751) (-938.735) [-937.735] -- 0:00:37
369000 -- (-936.835) [-935.681] (-936.293) (-935.990) * (-938.059) [-937.985] (-935.102) (-936.805) -- 0:00:39
369500 -- (-938.770) (-937.803) (-935.469) [-935.947] * (-940.588) (-941.884) [-934.981] (-939.361) -- 0:00:39
370000 -- (-940.205) (-936.277) (-936.122) [-935.063] * (-939.058) (-942.016) [-939.008] (-938.598) -- 0:00:39
Average standard deviation of split frequencies: 0.008454
370500 -- (-938.730) (-937.649) [-940.245] (-936.587) * (-936.303) [-941.941] (-937.060) (-937.325) -- 0:00:39
371000 -- (-937.144) [-936.531] (-940.500) (-935.722) * (-938.533) (-938.726) (-938.372) [-936.633] -- 0:00:38
371500 -- (-935.259) (-935.937) (-939.770) [-935.451] * (-939.003) [-938.735] (-942.329) (-935.069) -- 0:00:38
372000 -- (-935.807) [-936.464] (-936.275) (-935.413) * [-936.979] (-935.900) (-945.865) (-936.118) -- 0:00:38
372500 -- (-935.358) (-939.050) [-936.365] (-936.357) * (-935.482) (-936.114) (-941.767) [-936.341] -- 0:00:38
373000 -- (-941.422) (-944.063) (-937.608) [-937.224] * (-937.301) [-936.542] (-937.618) (-937.065) -- 0:00:38
373500 -- (-938.512) (-940.610) [-937.555] (-938.106) * (-935.484) (-938.027) [-937.063] (-937.867) -- 0:00:38
374000 -- (-936.865) [-935.171] (-935.965) (-938.785) * (-938.432) (-939.150) (-935.811) [-938.332] -- 0:00:38
374500 -- (-937.555) (-937.263) [-934.683] (-940.193) * (-936.813) (-939.217) (-937.567) [-939.008] -- 0:00:38
375000 -- (-939.033) (-937.925) (-938.209) [-936.619] * [-936.682] (-937.652) (-937.092) (-937.084) -- 0:00:38
Average standard deviation of split frequencies: 0.007670
375500 -- (-936.528) (-942.081) [-935.488] (-939.466) * [-936.277] (-935.394) (-938.793) (-937.325) -- 0:00:38
376000 -- [-938.068] (-939.215) (-935.488) (-938.919) * [-935.765] (-935.329) (-939.811) (-936.800) -- 0:00:38
376500 -- (-938.568) (-936.105) (-936.033) [-936.073] * [-935.920] (-935.898) (-939.609) (-935.504) -- 0:00:38
377000 -- (-939.914) (-936.387) (-937.383) [-936.402] * (-936.536) (-940.894) [-935.290] (-936.160) -- 0:00:38
377500 -- (-938.666) (-939.627) (-937.889) [-936.713] * (-936.366) [-935.280] (-935.292) (-935.557) -- 0:00:37
378000 -- [-937.251] (-937.771) (-940.268) (-941.324) * (-936.149) (-936.068) (-935.848) [-938.474] -- 0:00:37
378500 -- [-935.257] (-935.850) (-936.895) (-936.960) * [-935.192] (-939.379) (-937.876) (-936.269) -- 0:00:37
379000 -- [-935.957] (-940.237) (-937.133) (-935.595) * (-936.766) (-940.419) [-941.212] (-942.720) -- 0:00:37
379500 -- (-938.184) (-939.586) (-937.453) [-935.198] * (-935.502) (-937.370) [-937.294] (-936.983) -- 0:00:37
380000 -- [-944.526] (-937.153) (-935.228) (-936.207) * (-938.343) [-937.526] (-936.062) (-935.845) -- 0:00:37
Average standard deviation of split frequencies: 0.007794
380500 -- (-936.572) [-938.133] (-936.331) (-935.237) * (-940.494) (-937.041) (-938.910) [-936.863] -- 0:00:37
381000 -- (-936.258) [-935.386] (-936.223) (-935.198) * (-938.276) (-937.149) (-940.582) [-941.256] -- 0:00:37
381500 -- (-939.092) (-938.848) [-935.253] (-936.672) * (-937.537) (-937.361) [-937.651] (-935.961) -- 0:00:37
382000 -- [-936.970] (-936.900) (-937.675) (-938.996) * (-940.833) (-940.608) [-935.888] (-936.125) -- 0:00:37
382500 -- (-941.776) [-935.569] (-934.887) (-938.577) * (-935.842) (-934.627) [-936.904] (-935.018) -- 0:00:37
383000 -- (-935.490) (-935.623) (-936.594) [-937.925] * (-940.422) (-937.225) [-941.607] (-937.960) -- 0:00:37
383500 -- (-938.616) (-937.949) [-937.842] (-938.964) * (-936.909) (-941.184) [-939.607] (-940.786) -- 0:00:36
384000 -- [-938.246] (-938.192) (-942.971) (-936.528) * (-939.637) (-937.507) [-936.098] (-937.659) -- 0:00:36
384500 -- (-937.257) (-937.798) [-937.501] (-939.315) * (-938.988) [-938.224] (-936.957) (-938.573) -- 0:00:36
385000 -- (-939.473) (-937.937) [-937.237] (-940.691) * (-940.280) (-937.714) (-937.797) [-935.170] -- 0:00:36
Average standard deviation of split frequencies: 0.007802
385500 -- (-937.702) [-936.061] (-938.215) (-940.503) * [-935.100] (-937.466) (-935.985) (-938.413) -- 0:00:38
386000 -- [-935.805] (-934.969) (-936.597) (-941.960) * (-939.710) [-936.143] (-940.037) (-938.087) -- 0:00:38
386500 -- [-937.445] (-936.309) (-937.064) (-938.028) * (-936.847) [-937.002] (-937.648) (-940.005) -- 0:00:38
387000 -- (-937.142) [-936.274] (-935.469) (-935.928) * (-935.258) (-937.789) (-936.322) [-937.710] -- 0:00:38
387500 -- (-938.698) [-936.771] (-937.994) (-937.812) * (-936.623) [-938.056] (-937.431) (-938.820) -- 0:00:37
388000 -- [-935.830] (-936.432) (-941.911) (-942.778) * [-937.393] (-938.466) (-937.962) (-938.434) -- 0:00:37
388500 -- (-941.333) (-936.554) [-938.969] (-941.404) * [-934.737] (-935.180) (-937.791) (-935.837) -- 0:00:37
389000 -- [-937.937] (-937.846) (-936.044) (-937.011) * (-935.148) [-935.171] (-937.383) (-937.399) -- 0:00:37
389500 -- (-936.397) [-936.996] (-936.405) (-936.753) * (-934.900) (-935.376) [-936.856] (-940.247) -- 0:00:37
390000 -- (-935.989) (-935.032) [-937.218] (-936.124) * (-934.888) (-935.606) (-940.079) [-937.557] -- 0:00:37
Average standard deviation of split frequencies: 0.007524
390500 -- (-938.174) (-935.132) (-939.196) [-936.408] * (-938.018) [-935.280] (-935.409) (-935.255) -- 0:00:37
391000 -- (-935.672) [-935.420] (-937.544) (-936.374) * (-937.450) (-935.370) [-935.418] (-935.022) -- 0:00:37
391500 -- (-937.225) [-936.513] (-938.093) (-937.308) * (-939.345) (-935.370) [-935.169] (-936.515) -- 0:00:37
392000 -- [-936.263] (-935.315) (-937.785) (-937.605) * [-937.435] (-937.171) (-935.872) (-940.270) -- 0:00:37
392500 -- (-937.816) (-937.227) [-937.943] (-939.365) * (-938.275) (-939.043) (-935.577) [-939.040] -- 0:00:37
393000 -- [-941.570] (-937.862) (-936.049) (-936.775) * [-936.668] (-935.047) (-941.544) (-939.784) -- 0:00:37
393500 -- (-938.203) (-936.784) [-935.589] (-935.991) * (-939.390) [-935.634] (-941.098) (-937.877) -- 0:00:36
394000 -- [-935.296] (-936.306) (-935.480) (-935.648) * (-936.115) [-937.564] (-938.913) (-939.297) -- 0:00:36
394500 -- [-936.837] (-937.589) (-937.473) (-935.893) * [-936.597] (-935.678) (-934.669) (-935.524) -- 0:00:36
395000 -- (-937.243) (-936.463) [-937.592] (-941.939) * [-938.321] (-937.338) (-939.712) (-936.376) -- 0:00:36
Average standard deviation of split frequencies: 0.007633
395500 -- (-937.046) (-936.363) [-936.329] (-935.359) * (-939.747) [-937.422] (-936.918) (-938.158) -- 0:00:36
396000 -- (-936.613) [-934.856] (-937.751) (-935.144) * (-935.106) [-937.849] (-936.074) (-940.640) -- 0:00:36
396500 -- (-936.567) [-936.875] (-936.512) (-938.571) * [-934.904] (-937.958) (-935.189) (-938.775) -- 0:00:36
397000 -- (-940.242) (-938.180) (-935.568) [-934.811] * [-934.773] (-937.904) (-935.947) (-939.040) -- 0:00:36
397500 -- (-939.607) [-934.848] (-935.870) (-936.922) * [-936.909] (-941.321) (-936.590) (-935.741) -- 0:00:36
398000 -- (-936.645) (-936.206) (-936.863) [-936.301] * [-935.753] (-936.870) (-937.146) (-936.307) -- 0:00:36
398500 -- (-938.324) (-936.283) (-935.874) [-936.767] * (-936.614) (-935.757) (-935.097) [-936.509] -- 0:00:36
399000 -- (-939.647) [-935.670] (-937.460) (-939.241) * [-937.478] (-935.108) (-936.747) (-936.860) -- 0:00:36
399500 -- [-936.135] (-934.853) (-938.775) (-936.275) * [-935.287] (-936.829) (-936.934) (-937.604) -- 0:00:36
400000 -- (-936.373) (-935.910) [-940.068] (-939.155) * [-935.807] (-936.223) (-935.855) (-937.099) -- 0:00:36
Average standard deviation of split frequencies: 0.008997
400500 -- (-935.006) (-938.612) (-940.314) [-936.280] * (-936.309) [-937.063] (-935.248) (-939.395) -- 0:00:35
401000 -- (-937.046) [-937.458] (-937.491) (-938.887) * [-935.558] (-936.827) (-935.684) (-935.658) -- 0:00:35
401500 -- [-938.242] (-935.793) (-936.337) (-935.585) * (-937.810) (-938.996) [-936.274] (-936.530) -- 0:00:35
402000 -- [-937.025] (-937.868) (-934.831) (-934.829) * (-937.239) (-936.972) (-937.660) [-938.157] -- 0:00:35
402500 -- [-935.085] (-935.724) (-939.552) (-936.793) * (-938.063) (-935.484) (-937.346) [-936.876] -- 0:00:37
403000 -- [-940.479] (-939.351) (-935.931) (-937.244) * (-935.015) (-936.351) (-942.940) [-938.779] -- 0:00:37
403500 -- (-939.165) (-935.994) (-937.207) [-935.340] * (-934.676) (-937.553) [-936.426] (-936.065) -- 0:00:36
404000 -- [-938.054] (-934.773) (-935.834) (-935.721) * (-935.322) (-936.590) [-935.627] (-938.948) -- 0:00:36
404500 -- (-936.385) (-934.765) [-935.124] (-940.460) * (-936.909) [-935.875] (-936.490) (-936.117) -- 0:00:36
405000 -- [-940.723] (-935.371) (-934.844) (-936.439) * (-943.403) (-935.927) [-937.006] (-936.435) -- 0:00:36
Average standard deviation of split frequencies: 0.009289
405500 -- (-935.479) (-935.476) (-936.868) [-935.427] * (-936.429) (-934.688) (-934.949) [-937.907] -- 0:00:36
406000 -- [-938.408] (-936.414) (-937.506) (-938.964) * (-938.393) [-934.663] (-935.818) (-937.676) -- 0:00:36
406500 -- [-936.915] (-936.702) (-937.265) (-937.855) * (-936.818) (-935.047) (-937.439) [-935.770] -- 0:00:36
407000 -- [-935.127] (-939.220) (-935.642) (-937.323) * (-936.343) (-935.746) (-938.281) [-937.900] -- 0:00:36
407500 -- (-938.943) [-936.790] (-935.724) (-936.325) * (-935.622) [-935.827] (-935.460) (-938.870) -- 0:00:36
408000 -- [-943.510] (-938.055) (-938.763) (-938.293) * (-935.239) (-937.818) [-936.684] (-934.706) -- 0:00:36
408500 -- [-937.196] (-938.638) (-936.867) (-938.641) * (-935.845) (-937.882) (-935.440) [-936.750] -- 0:00:36
409000 -- [-936.601] (-938.079) (-937.945) (-936.121) * (-936.784) [-935.362] (-937.082) (-936.611) -- 0:00:36
409500 -- (-936.048) (-937.030) (-935.024) [-936.187] * (-936.282) (-939.590) (-937.092) [-936.988] -- 0:00:36
410000 -- (-935.870) [-937.185] (-936.494) (-936.447) * (-935.687) (-939.225) (-941.735) [-935.682] -- 0:00:35
Average standard deviation of split frequencies: 0.009588
410500 -- (-935.870) [-937.173] (-936.551) (-936.426) * [-936.220] (-941.771) (-936.795) (-935.614) -- 0:00:35
411000 -- (-938.786) (-937.547) (-939.650) [-936.488] * (-937.455) (-939.837) [-936.513] (-936.431) -- 0:00:35
411500 -- (-936.861) [-939.748] (-937.318) (-936.881) * [-936.863] (-940.108) (-936.001) (-935.113) -- 0:00:35
412000 -- (-936.796) (-939.820) [-936.450] (-935.377) * (-936.281) (-935.400) (-941.720) [-935.727] -- 0:00:35
412500 -- (-937.451) (-937.109) (-938.092) [-934.663] * (-936.822) (-935.302) [-937.473] (-935.073) -- 0:00:35
413000 -- (-935.618) [-936.906] (-935.249) (-938.492) * (-935.702) [-935.259] (-938.159) (-935.923) -- 0:00:35
413500 -- [-939.277] (-935.087) (-937.871) (-936.372) * (-940.826) (-935.149) [-938.380] (-935.086) -- 0:00:35
414000 -- (-936.741) (-939.552) (-939.304) [-935.562] * (-937.548) (-936.485) [-937.959] (-935.880) -- 0:00:35
414500 -- (-935.470) [-937.031] (-936.645) (-935.341) * (-935.345) [-935.586] (-936.299) (-936.285) -- 0:00:35
415000 -- [-936.643] (-936.256) (-944.607) (-934.704) * (-935.215) [-936.338] (-937.153) (-936.400) -- 0:00:35
Average standard deviation of split frequencies: 0.009799
415500 -- (-938.947) [-935.815] (-936.595) (-935.634) * (-935.316) [-935.789] (-935.697) (-936.638) -- 0:00:35
416000 -- (-939.645) [-939.834] (-936.260) (-936.492) * [-935.300] (-935.528) (-936.876) (-937.975) -- 0:00:35
416500 -- (-935.888) (-938.171) (-937.101) [-937.229] * [-935.191] (-936.684) (-934.790) (-940.175) -- 0:00:35
417000 -- (-937.175) [-938.381] (-936.939) (-936.537) * (-936.261) [-937.357] (-934.667) (-941.245) -- 0:00:34
417500 -- [-937.249] (-935.530) (-940.200) (-936.772) * [-937.960] (-936.902) (-943.097) (-938.616) -- 0:00:34
418000 -- [-936.361] (-938.353) (-938.292) (-937.010) * (-937.701) (-936.468) [-940.803] (-938.857) -- 0:00:34
418500 -- (-936.824) [-940.032] (-936.952) (-936.458) * [-937.057] (-935.303) (-935.806) (-941.963) -- 0:00:34
419000 -- [-937.139] (-940.520) (-937.772) (-936.601) * [-937.923] (-936.483) (-937.047) (-942.754) -- 0:00:34
419500 -- (-937.669) [-937.532] (-937.450) (-942.322) * [-935.050] (-938.575) (-935.543) (-937.949) -- 0:00:35
420000 -- (-940.159) (-941.060) [-939.706] (-940.824) * (-935.989) [-940.238] (-940.090) (-934.781) -- 0:00:35
Average standard deviation of split frequencies: 0.010745
420500 -- (-942.019) [-939.125] (-936.197) (-939.089) * (-940.818) (-937.792) [-936.394] (-934.781) -- 0:00:35
421000 -- (-935.854) [-935.612] (-936.046) (-938.633) * (-936.600) (-935.885) (-939.246) [-935.997] -- 0:00:35
421500 -- (-937.383) [-936.670] (-935.176) (-935.112) * (-938.508) [-936.342] (-936.665) (-936.811) -- 0:00:35
422000 -- (-934.613) [-937.464] (-935.514) (-937.529) * (-935.241) (-937.159) (-939.008) [-938.685] -- 0:00:35
422500 -- (-937.596) [-936.618] (-938.174) (-936.679) * (-938.663) [-941.528] (-940.418) (-936.742) -- 0:00:35
423000 -- (-935.069) (-938.115) [-936.409] (-935.088) * (-936.757) (-935.099) [-939.671] (-936.870) -- 0:00:35
423500 -- (-936.405) [-936.128] (-935.892) (-935.898) * [-935.944] (-936.487) (-939.153) (-935.454) -- 0:00:35
424000 -- (-936.075) (-936.508) (-936.951) [-935.087] * (-935.373) [-936.420] (-941.530) (-935.193) -- 0:00:35
424500 -- (-936.835) [-935.331] (-935.027) (-940.789) * (-937.969) [-944.449] (-939.812) (-936.083) -- 0:00:35
425000 -- (-940.774) (-936.020) (-936.116) [-936.387] * (-936.259) [-937.511] (-939.343) (-940.697) -- 0:00:35
Average standard deviation of split frequencies: 0.010350
425500 -- [-936.832] (-939.052) (-934.685) (-936.645) * (-939.971) (-935.934) (-940.627) [-935.621] -- 0:00:35
426000 -- (-937.404) (-941.575) [-934.660] (-934.700) * (-940.060) (-939.058) [-935.841] (-937.721) -- 0:00:35
426500 -- (-937.189) [-940.871] (-937.730) (-936.307) * [-936.742] (-935.926) (-935.833) (-937.667) -- 0:00:34
427000 -- (-935.801) (-935.799) (-935.617) [-935.122] * [-935.931] (-936.715) (-936.969) (-940.989) -- 0:00:34
427500 -- [-937.095] (-938.250) (-941.219) (-936.446) * (-938.343) (-939.052) (-936.878) [-940.918] -- 0:00:34
428000 -- (-943.033) [-935.256] (-936.114) (-935.434) * (-935.702) (-937.971) [-935.869] (-939.237) -- 0:00:34
428500 -- (-935.827) [-935.226] (-936.175) (-936.062) * (-936.278) (-936.573) [-935.108] (-938.660) -- 0:00:34
429000 -- (-937.491) [-937.641] (-939.345) (-936.272) * (-938.784) (-937.124) [-937.221] (-943.234) -- 0:00:34
429500 -- (-934.815) (-938.519) (-938.610) [-936.138] * [-938.898] (-937.994) (-936.479) (-946.292) -- 0:00:34
430000 -- (-935.742) (-936.428) (-937.102) [-936.773] * (-937.998) [-937.348] (-936.035) (-944.834) -- 0:00:34
Average standard deviation of split frequencies: 0.009079
430500 -- (-941.547) [-936.726] (-937.674) (-936.474) * (-937.461) (-939.788) (-935.518) [-937.449] -- 0:00:34
431000 -- (-936.306) (-938.937) (-942.605) [-936.425] * (-936.895) (-936.519) [-935.686] (-934.752) -- 0:00:34
431500 -- (-936.647) (-936.289) [-944.854] (-939.726) * (-938.837) [-937.743] (-940.757) (-936.447) -- 0:00:34
432000 -- [-936.369] (-937.179) (-939.932) (-937.400) * (-937.676) (-940.126) (-937.926) [-937.789] -- 0:00:34
432500 -- [-936.423] (-936.609) (-937.096) (-941.737) * (-935.950) [-942.665] (-935.972) (-938.287) -- 0:00:34
433000 -- [-936.069] (-935.253) (-936.744) (-935.901) * (-939.815) (-941.014) (-935.878) [-937.196] -- 0:00:34
433500 -- (-936.090) (-938.550) (-936.282) [-937.020] * [-939.866] (-937.895) (-936.571) (-941.391) -- 0:00:33
434000 -- (-935.266) (-938.494) (-939.957) [-939.903] * (-936.146) (-938.110) [-937.329] (-942.428) -- 0:00:33
434500 -- (-935.019) (-936.150) [-936.719] (-939.269) * (-935.790) [-936.383] (-939.602) (-936.363) -- 0:00:33
435000 -- (-935.218) (-937.820) [-935.984] (-938.062) * (-936.001) [-936.961] (-935.709) (-940.639) -- 0:00:33
Average standard deviation of split frequencies: 0.009667
435500 -- (-936.629) (-938.402) [-938.233] (-936.478) * (-939.704) (-937.050) (-936.732) [-936.594] -- 0:00:33
436000 -- [-936.549] (-943.488) (-938.086) (-936.219) * (-937.983) (-941.298) (-937.567) [-936.416] -- 0:00:34
436500 -- [-935.161] (-938.866) (-940.415) (-939.334) * (-940.775) (-941.947) [-935.919] (-940.036) -- 0:00:34
437000 -- (-936.294) [-934.767] (-934.993) (-936.780) * (-937.230) (-935.014) [-938.751] (-937.261) -- 0:00:34
437500 -- (-937.423) (-937.382) [-934.538] (-936.324) * [-939.585] (-935.550) (-935.119) (-936.457) -- 0:00:34
438000 -- (-936.278) (-936.062) [-935.239] (-935.177) * [-936.928] (-938.094) (-935.184) (-936.042) -- 0:00:34
438500 -- [-937.034] (-936.541) (-935.345) (-937.615) * (-939.991) (-937.551) [-937.614] (-936.502) -- 0:00:34
439000 -- (-938.786) [-936.255] (-936.679) (-936.013) * (-940.735) (-935.840) (-935.559) [-937.013] -- 0:00:34
439500 -- (-937.654) (-937.411) (-934.827) [-937.164] * (-935.092) (-940.507) [-939.188] (-936.701) -- 0:00:34
440000 -- [-936.877] (-936.936) (-935.188) (-937.671) * (-935.613) (-935.441) (-937.093) [-934.929] -- 0:00:34
Average standard deviation of split frequencies: 0.009565
440500 -- [-938.381] (-938.960) (-935.727) (-935.975) * (-936.022) [-936.652] (-936.120) (-935.654) -- 0:00:34
441000 -- (-937.120) [-938.078] (-941.133) (-936.103) * (-936.549) (-936.417) (-936.194) [-935.126] -- 0:00:34
441500 -- (-938.150) [-936.931] (-936.760) (-940.536) * (-935.134) (-934.831) [-937.129] (-936.797) -- 0:00:34
442000 -- [-940.700] (-942.295) (-935.649) (-935.650) * (-935.435) (-936.584) (-936.447) [-935.377] -- 0:00:34
442500 -- (-936.748) (-942.802) (-936.912) [-937.505] * (-937.075) (-937.727) [-938.646] (-935.659) -- 0:00:34
443000 -- (-935.641) [-937.777] (-937.028) (-936.960) * (-935.498) (-936.750) (-936.035) [-935.544] -- 0:00:33
443500 -- (-935.405) (-939.609) (-938.074) [-936.542] * (-934.960) (-936.593) [-936.102] (-938.095) -- 0:00:33
444000 -- [-935.712] (-937.080) (-939.299) (-937.679) * (-939.337) (-935.416) [-940.767] (-936.294) -- 0:00:33
444500 -- [-935.871] (-937.045) (-935.850) (-936.991) * (-936.945) [-935.261] (-939.641) (-938.734) -- 0:00:33
445000 -- [-936.775] (-937.045) (-942.177) (-936.429) * (-937.143) (-936.790) (-936.527) [-935.686] -- 0:00:33
Average standard deviation of split frequencies: 0.010041
445500 -- (-939.033) (-935.230) [-935.996] (-936.254) * (-936.805) [-937.076] (-937.579) (-935.942) -- 0:00:33
446000 -- [-936.243] (-936.040) (-940.507) (-940.609) * (-935.442) (-936.013) (-937.026) [-937.380] -- 0:00:33
446500 -- (-938.432) [-936.759] (-940.609) (-940.772) * (-936.902) (-938.176) [-938.348] (-940.232) -- 0:00:33
447000 -- (-936.566) [-936.460] (-940.786) (-941.085) * (-935.044) (-938.136) [-935.954] (-937.451) -- 0:00:33
447500 -- (-937.647) [-934.936] (-937.187) (-936.802) * (-935.321) (-936.582) (-937.954) [-935.418] -- 0:00:33
448000 -- [-941.260] (-937.662) (-937.531) (-939.024) * (-937.386) (-936.582) (-936.474) [-938.534] -- 0:00:33
448500 -- (-943.788) [-937.211] (-937.408) (-937.290) * (-937.549) (-937.134) [-937.292] (-938.774) -- 0:00:33
449000 -- [-941.269] (-939.676) (-937.069) (-935.851) * (-936.621) (-936.186) (-936.116) [-937.421] -- 0:00:33
449500 -- (-936.631) (-938.793) [-936.213] (-937.313) * (-936.796) [-937.044] (-941.538) (-937.623) -- 0:00:33
450000 -- (-936.969) (-936.072) (-939.497) [-939.037] * (-935.240) (-937.061) (-941.448) [-938.397] -- 0:00:33
Average standard deviation of split frequencies: 0.009879
450500 -- (-937.596) (-935.679) [-935.336] (-936.725) * (-937.216) (-936.216) [-937.678] (-941.007) -- 0:00:32
451000 -- [-938.381] (-936.494) (-939.143) (-936.992) * (-935.674) (-937.071) [-941.104] (-936.724) -- 0:00:32
451500 -- (-938.151) [-937.336] (-938.453) (-937.331) * (-936.725) [-936.533] (-936.945) (-935.537) -- 0:00:32
452000 -- (-938.324) (-936.094) (-936.343) [-937.053] * [-937.181] (-941.689) (-937.127) (-935.138) -- 0:00:32
452500 -- (-940.804) (-938.031) (-938.643) [-936.154] * [-936.524] (-938.172) (-937.167) (-936.547) -- 0:00:33
453000 -- (-937.268) (-936.727) [-941.367] (-939.239) * (-936.404) (-941.289) [-937.171] (-936.655) -- 0:00:33
453500 -- (-936.583) (-936.250) (-936.720) [-936.503] * (-935.819) (-938.192) (-936.002) [-939.712] -- 0:00:33
454000 -- (-935.017) (-936.402) (-938.158) [-938.550] * [-935.126] (-938.063) (-936.831) (-936.293) -- 0:00:33
454500 -- [-935.528] (-936.000) (-939.683) (-938.282) * (-941.277) [-939.832] (-937.159) (-936.023) -- 0:00:33
455000 -- (-937.851) [-936.046] (-937.601) (-941.393) * [-943.623] (-939.745) (-936.586) (-936.324) -- 0:00:33
Average standard deviation of split frequencies: 0.010051
455500 -- (-937.961) (-935.400) (-937.988) [-936.387] * (-938.450) (-935.104) (-936.424) [-937.996] -- 0:00:33
456000 -- (-938.991) [-936.659] (-939.301) (-936.111) * (-937.380) [-937.165] (-937.527) (-937.309) -- 0:00:33
456500 -- [-938.198] (-936.466) (-936.886) (-938.062) * [-937.489] (-934.847) (-937.114) (-935.757) -- 0:00:33
457000 -- (-937.091) (-938.078) (-935.265) [-935.334] * (-937.258) (-935.373) (-936.387) [-935.797] -- 0:00:33
457500 -- (-937.081) (-935.701) (-938.522) [-934.802] * (-936.574) [-935.680] (-941.103) (-936.169) -- 0:00:33
458000 -- (-939.740) [-934.986] (-939.412) (-935.466) * (-936.620) (-935.708) (-937.927) [-936.294] -- 0:00:33
458500 -- (-936.924) (-935.942) [-936.538] (-935.628) * [-936.521] (-938.624) (-935.915) (-936.456) -- 0:00:33
459000 -- (-939.769) [-935.423] (-937.064) (-938.154) * (-935.866) [-937.448] (-938.465) (-934.996) -- 0:00:33
459500 -- [-941.447] (-936.573) (-936.701) (-937.395) * (-934.642) [-935.943] (-937.476) (-937.444) -- 0:00:32
460000 -- (-940.212) (-935.873) [-937.000] (-936.669) * (-937.809) [-935.048] (-938.374) (-936.586) -- 0:00:32
Average standard deviation of split frequencies: 0.010173
460500 -- (-938.082) (-935.690) [-936.559] (-940.885) * (-936.303) (-938.264) [-936.451] (-936.480) -- 0:00:32
461000 -- (-937.092) (-937.340) (-938.598) [-937.515] * [-937.173] (-935.879) (-937.197) (-936.473) -- 0:00:32
461500 -- [-937.525] (-940.128) (-934.848) (-940.265) * (-937.366) (-937.807) [-935.754] (-938.025) -- 0:00:32
462000 -- (-936.406) (-937.152) (-937.500) [-938.102] * (-935.846) [-935.648] (-939.515) (-940.555) -- 0:00:32
462500 -- (-938.796) (-935.601) (-935.915) [-935.583] * (-935.933) (-936.812) [-937.666] (-938.601) -- 0:00:32
463000 -- (-935.363) [-935.362] (-939.146) (-936.731) * (-935.477) (-939.203) [-937.158] (-938.487) -- 0:00:32
463500 -- [-936.240] (-936.185) (-938.080) (-941.377) * [-937.588] (-935.216) (-935.253) (-936.382) -- 0:00:32
464000 -- [-937.738] (-936.947) (-937.796) (-939.761) * (-938.772) [-935.198] (-935.494) (-938.181) -- 0:00:32
464500 -- (-937.434) (-940.042) [-937.730] (-940.660) * (-936.032) (-938.292) [-936.990] (-935.966) -- 0:00:32
465000 -- (-936.638) (-935.521) [-935.416] (-936.368) * (-936.466) (-936.068) [-940.728] (-936.075) -- 0:00:32
Average standard deviation of split frequencies: 0.010235
465500 -- (-937.004) (-938.187) (-938.297) [-936.045] * (-935.955) (-938.480) (-936.664) [-936.477] -- 0:00:32
466000 -- (-936.798) (-938.195) [-935.836] (-939.263) * [-935.455] (-935.839) (-942.027) (-937.358) -- 0:00:32
466500 -- (-936.591) [-941.739] (-935.691) (-937.612) * (-936.349) (-938.638) (-937.095) [-935.559] -- 0:00:32
467000 -- (-935.343) [-939.042] (-945.428) (-938.046) * (-935.471) (-936.444) [-936.873] (-935.525) -- 0:00:31
467500 -- (-935.888) (-935.977) (-936.937) [-936.405] * [-936.648] (-936.436) (-937.935) (-935.510) -- 0:00:31
468000 -- (-937.560) (-935.583) [-936.167] (-935.887) * [-937.074] (-935.267) (-937.446) (-937.189) -- 0:00:31
468500 -- (-935.887) (-936.374) [-937.551] (-938.222) * (-935.532) [-936.061] (-934.989) (-939.119) -- 0:00:31
469000 -- [-935.297] (-938.568) (-938.407) (-935.666) * (-939.853) (-937.692) (-939.261) [-937.034] -- 0:00:32
469500 -- (-938.062) (-940.763) [-935.733] (-935.410) * (-940.055) (-937.512) [-935.028] (-936.744) -- 0:00:32
470000 -- (-937.524) (-940.178) (-936.267) [-937.609] * (-938.286) [-936.112] (-940.714) (-934.796) -- 0:00:32
Average standard deviation of split frequencies: 0.011371
470500 -- (-943.942) [-940.147] (-936.763) (-941.852) * (-936.094) [-935.933] (-937.542) (-935.522) -- 0:00:32
471000 -- (-937.040) (-936.782) [-935.642] (-937.410) * (-936.252) (-936.886) (-939.297) [-936.598] -- 0:00:32
471500 -- [-935.263] (-940.651) (-936.095) (-939.630) * (-936.023) (-938.379) [-938.981] (-936.703) -- 0:00:32
472000 -- [-937.504] (-941.234) (-936.446) (-937.167) * [-936.847] (-945.087) (-938.757) (-937.698) -- 0:00:32
472500 -- (-937.542) [-940.842] (-937.804) (-935.034) * (-936.963) (-935.609) [-936.157] (-937.390) -- 0:00:32
473000 -- [-936.547] (-938.261) (-939.425) (-939.745) * (-936.026) (-935.913) [-937.776] (-936.376) -- 0:00:32
473500 -- [-936.933] (-936.611) (-939.321) (-938.291) * [-935.862] (-937.054) (-936.784) (-939.189) -- 0:00:32
474000 -- (-937.451) [-938.298] (-937.726) (-938.406) * (-935.806) [-938.933] (-937.230) (-935.870) -- 0:00:32
474500 -- (-939.475) [-935.868] (-939.158) (-937.084) * (-936.575) [-941.980] (-935.718) (-939.350) -- 0:00:32
475000 -- (-940.399) (-935.778) (-938.815) [-938.876] * (-935.661) (-935.946) [-941.964] (-936.779) -- 0:00:32
Average standard deviation of split frequencies: 0.011185
475500 -- (-937.911) (-935.837) (-938.200) [-937.349] * (-937.158) (-934.707) [-936.567] (-934.923) -- 0:00:31
476000 -- (-934.817) (-937.704) [-934.655] (-937.781) * (-941.130) (-935.313) (-935.864) [-938.996] -- 0:00:31
476500 -- [-936.254] (-935.620) (-936.883) (-935.080) * [-936.774] (-936.234) (-937.358) (-936.034) -- 0:00:31
477000 -- (-935.733) (-936.249) (-937.733) [-935.363] * (-935.953) (-935.473) [-937.028] (-940.878) -- 0:00:31
477500 -- [-936.763] (-938.522) (-936.587) (-937.327) * (-935.078) (-935.449) (-938.398) [-937.228] -- 0:00:31
478000 -- (-939.502) (-936.446) [-936.304] (-936.628) * [-937.851] (-937.375) (-936.227) (-937.588) -- 0:00:31
478500 -- (-937.435) (-943.412) (-937.655) [-936.364] * [-937.978] (-937.735) (-935.983) (-935.230) -- 0:00:31
479000 -- (-934.988) [-937.444] (-938.725) (-936.837) * (-937.311) (-937.572) (-935.406) [-936.569] -- 0:00:31
479500 -- [-934.805] (-940.523) (-935.938) (-938.190) * (-937.212) [-941.593] (-935.840) (-938.177) -- 0:00:31
480000 -- (-935.117) [-941.415] (-937.433) (-940.169) * [-936.301] (-941.569) (-937.605) (-937.582) -- 0:00:31
Average standard deviation of split frequencies: 0.010788
480500 -- (-939.746) [-937.090] (-938.385) (-936.131) * (-937.161) [-936.616] (-941.667) (-938.544) -- 0:00:31
481000 -- [-937.836] (-937.368) (-937.429) (-937.222) * (-936.591) (-937.566) (-939.220) [-936.265] -- 0:00:31
481500 -- (-937.712) (-938.379) (-937.740) [-937.430] * [-938.866] (-938.881) (-937.375) (-936.009) -- 0:00:31
482000 -- (-935.784) [-938.867] (-939.151) (-938.447) * (-938.695) (-936.490) [-935.904] (-936.540) -- 0:00:31
482500 -- (-939.129) (-938.765) (-937.580) [-938.452] * (-939.405) (-937.872) (-937.800) [-935.390] -- 0:00:31
483000 -- (-936.040) (-937.921) (-940.788) [-937.160] * [-935.672] (-935.072) (-936.937) (-938.723) -- 0:00:31
483500 -- [-937.336] (-937.830) (-934.984) (-937.338) * (-939.479) [-934.891] (-938.912) (-936.546) -- 0:00:30
484000 -- (-937.910) [-941.050] (-936.083) (-937.464) * (-935.129) [-935.369] (-936.990) (-936.919) -- 0:00:30
484500 -- (-937.914) [-936.388] (-938.927) (-935.954) * [-936.442] (-935.225) (-938.514) (-935.820) -- 0:00:30
485000 -- (-939.532) [-938.650] (-937.674) (-935.322) * (-936.117) [-935.773] (-937.007) (-936.383) -- 0:00:30
Average standard deviation of split frequencies: 0.010556
485500 -- (-939.251) [-936.672] (-938.587) (-935.202) * [-936.840] (-938.853) (-936.950) (-935.592) -- 0:00:31
486000 -- [-941.502] (-935.905) (-943.357) (-937.164) * (-936.177) (-938.911) (-937.701) [-935.523] -- 0:00:31
486500 -- [-938.599] (-940.739) (-940.539) (-938.257) * (-936.235) [-938.935] (-941.764) (-937.286) -- 0:00:31
487000 -- (-936.183) [-938.294] (-938.879) (-935.325) * (-940.416) [-934.720] (-935.962) (-936.726) -- 0:00:31
487500 -- [-938.238] (-938.168) (-935.578) (-938.568) * (-942.271) [-938.031] (-938.834) (-936.525) -- 0:00:31
488000 -- [-936.416] (-940.187) (-940.935) (-936.748) * (-935.273) (-935.764) (-940.678) [-935.774] -- 0:00:31
488500 -- (-937.774) (-934.789) [-937.786] (-937.534) * (-939.972) [-935.699] (-937.476) (-936.027) -- 0:00:31
489000 -- [-936.760] (-935.721) (-937.167) (-936.014) * (-938.114) (-936.050) (-937.523) [-936.900] -- 0:00:31
489500 -- (-938.089) (-938.048) (-936.210) [-935.480] * [-935.322] (-936.324) (-935.773) (-937.426) -- 0:00:31
490000 -- [-935.697] (-936.477) (-935.872) (-935.895) * (-936.185) [-938.226] (-935.690) (-935.844) -- 0:00:31
Average standard deviation of split frequencies: 0.010681
490500 -- (-939.334) (-939.253) (-937.065) [-936.623] * (-940.763) (-938.008) [-935.915] (-937.669) -- 0:00:31
491000 -- (-940.315) (-938.347) [-936.569] (-935.974) * [-937.361] (-937.531) (-938.759) (-936.908) -- 0:00:31
491500 -- (-934.826) (-938.163) [-936.639] (-935.390) * (-939.116) (-936.136) (-938.798) [-937.111] -- 0:00:31
492000 -- (-934.738) (-937.591) (-937.120) [-934.835] * [-938.729] (-937.224) (-937.469) (-936.433) -- 0:00:30
492500 -- [-938.537] (-937.458) (-934.760) (-935.723) * (-936.721) (-937.455) (-937.733) [-935.718] -- 0:00:30
493000 -- (-938.482) (-936.140) (-942.830) [-938.327] * [-936.410] (-937.826) (-936.925) (-935.405) -- 0:00:30
493500 -- [-940.750] (-935.649) (-939.495) (-939.071) * (-936.433) [-935.613] (-936.853) (-938.472) -- 0:00:30
494000 -- (-937.068) [-935.694] (-936.694) (-942.278) * (-935.922) [-935.866] (-937.192) (-938.432) -- 0:00:30
494500 -- [-936.334] (-935.043) (-936.041) (-935.943) * (-938.105) (-937.740) [-936.845] (-937.776) -- 0:00:30
495000 -- (-937.298) (-936.470) (-937.743) [-945.610] * (-936.134) [-936.404] (-936.471) (-938.778) -- 0:00:30
Average standard deviation of split frequencies: 0.010902
495500 -- (-936.499) [-938.915] (-937.220) (-937.040) * (-935.679) (-939.114) [-936.049] (-936.871) -- 0:00:30
496000 -- (-941.003) (-937.445) (-938.422) [-937.242] * (-935.567) (-938.815) (-937.606) [-934.915] -- 0:00:30
496500 -- (-939.603) [-939.578] (-937.658) (-935.556) * (-935.689) (-938.744) [-935.045] (-934.885) -- 0:00:30
497000 -- (-941.505) (-939.029) [-936.147] (-938.042) * [-935.315] (-940.054) (-934.849) (-936.649) -- 0:00:30
497500 -- (-935.289) (-938.950) [-935.866] (-936.832) * (-935.151) (-940.754) (-934.676) [-937.092] -- 0:00:30
498000 -- (-937.379) (-936.088) (-935.284) [-937.059] * (-935.294) (-936.499) [-936.719] (-936.360) -- 0:00:30
498500 -- (-937.825) (-936.353) [-935.151] (-935.639) * (-937.932) (-935.937) (-937.217) [-938.503] -- 0:00:30
499000 -- (-938.827) [-936.387] (-935.001) (-935.261) * (-938.854) [-937.015] (-936.546) (-935.162) -- 0:00:30
499500 -- (-935.361) [-935.413] (-936.501) (-936.912) * (-936.264) (-938.722) (-934.819) [-935.809] -- 0:00:30
500000 -- (-940.635) (-938.662) [-935.365] (-937.294) * (-936.271) (-936.596) (-939.190) [-935.639] -- 0:00:30
Average standard deviation of split frequencies: 0.010966
500500 -- [-935.792] (-938.170) (-935.569) (-936.733) * (-938.814) (-940.616) [-936.495] (-935.226) -- 0:00:29
501000 -- (-935.421) (-936.746) [-937.016] (-937.694) * (-936.805) (-936.614) [-935.685] (-937.014) -- 0:00:29
501500 -- [-936.330] (-936.907) (-937.999) (-939.003) * (-935.448) (-936.616) [-935.950] (-936.711) -- 0:00:29
502000 -- (-939.030) (-937.846) [-936.401] (-941.326) * (-934.629) (-937.974) (-936.945) [-936.244] -- 0:00:29
502500 -- (-937.635) [-937.462] (-938.188) (-939.683) * (-938.643) (-935.208) [-935.999] (-936.914) -- 0:00:30
503000 -- [-937.544] (-934.816) (-937.449) (-937.402) * (-935.797) (-935.216) (-937.808) [-943.674] -- 0:00:30
503500 -- (-939.330) (-937.199) (-938.171) [-936.791] * (-934.824) (-937.121) (-936.420) [-936.951] -- 0:00:30
504000 -- (-936.883) [-937.413] (-936.506) (-939.215) * (-935.815) (-937.700) [-938.334] (-936.602) -- 0:00:30
504500 -- (-937.759) [-934.819] (-936.257) (-938.320) * (-937.500) (-937.170) [-936.366] (-939.454) -- 0:00:30
505000 -- (-935.307) [-937.898] (-937.877) (-935.843) * (-937.991) (-936.555) (-936.255) [-938.305] -- 0:00:30
Average standard deviation of split frequencies: 0.010851
505500 -- (-935.752) (-939.703) [-938.456] (-935.701) * [-936.423] (-940.189) (-935.910) (-937.998) -- 0:00:30
506000 -- (-939.004) [-937.208] (-936.161) (-938.345) * (-936.049) (-936.893) (-936.465) [-936.726] -- 0:00:30
506500 -- [-937.726] (-937.640) (-937.820) (-935.945) * (-935.684) (-935.464) [-935.788] (-937.119) -- 0:00:30
507000 -- (-939.625) (-937.117) [-936.500] (-934.916) * (-938.298) [-935.392] (-940.684) (-935.285) -- 0:00:30
507500 -- (-936.007) (-935.013) (-935.220) [-936.052] * [-935.791] (-935.552) (-935.663) (-937.143) -- 0:00:30
508000 -- [-935.114] (-935.289) (-935.543) (-934.774) * (-935.564) (-937.184) [-937.324] (-939.660) -- 0:00:30
508500 -- (-934.980) (-935.279) [-935.140] (-935.868) * (-938.210) [-936.525] (-936.157) (-937.077) -- 0:00:29
509000 -- (-938.630) (-940.027) (-935.389) [-939.831] * [-938.779] (-935.989) (-936.354) (-936.312) -- 0:00:29
509500 -- (-935.797) [-937.295] (-935.242) (-937.751) * (-936.227) (-938.996) [-935.897] (-936.578) -- 0:00:29
510000 -- [-937.802] (-935.123) (-939.504) (-940.865) * (-938.487) [-937.699] (-934.923) (-938.490) -- 0:00:29
Average standard deviation of split frequencies: 0.010534
510500 -- (-937.297) [-936.811] (-940.173) (-937.660) * (-938.705) [-937.826] (-941.029) (-935.737) -- 0:00:29
511000 -- (-936.553) [-937.376] (-940.239) (-935.941) * (-935.110) (-941.927) (-937.464) [-937.048] -- 0:00:29
511500 -- (-938.239) [-936.535] (-939.722) (-935.218) * [-937.672] (-939.106) (-938.704) (-936.686) -- 0:00:29
512000 -- (-936.761) (-935.298) [-939.132] (-937.526) * (-939.821) [-935.824] (-934.926) (-934.966) -- 0:00:29
512500 -- (-938.106) (-941.292) (-936.038) [-937.086] * (-938.402) (-936.189) (-935.455) [-935.275] -- 0:00:29
513000 -- [-936.471] (-938.523) (-938.170) (-935.710) * (-936.369) (-937.476) [-936.076] (-936.701) -- 0:00:29
513500 -- [-936.048] (-934.769) (-935.608) (-937.018) * (-939.553) (-938.211) (-935.634) [-939.674] -- 0:00:29
514000 -- (-937.700) (-936.248) (-936.172) [-936.218] * (-938.958) (-940.077) [-936.110] (-939.617) -- 0:00:29
514500 -- [-936.408] (-937.682) (-935.446) (-938.322) * [-940.054] (-938.243) (-937.749) (-939.759) -- 0:00:29
515000 -- (-936.764) (-941.363) (-937.060) [-935.268] * (-935.892) (-940.646) [-935.725] (-941.742) -- 0:00:29
Average standard deviation of split frequencies: 0.010425
515500 -- (-939.357) (-935.544) (-938.609) [-936.563] * [-936.081] (-940.741) (-938.172) (-937.791) -- 0:00:29
516000 -- [-940.518] (-937.828) (-934.964) (-935.122) * (-939.879) [-937.068] (-936.847) (-938.647) -- 0:00:29
516500 -- (-937.430) (-937.749) [-937.136] (-935.068) * (-935.410) (-936.148) [-937.818] (-936.169) -- 0:00:29
517000 -- (-937.415) (-935.756) [-937.688] (-935.245) * (-939.167) (-937.806) (-937.248) [-936.277] -- 0:00:28
517500 -- (-936.561) (-938.048) [-937.188] (-940.303) * (-938.844) [-935.799] (-936.368) (-936.774) -- 0:00:28
518000 -- [-935.244] (-938.992) (-941.763) (-937.693) * (-937.635) [-937.016] (-936.830) (-937.070) -- 0:00:28
518500 -- (-935.137) [-935.804] (-939.115) (-935.067) * (-939.251) [-938.230] (-935.874) (-937.986) -- 0:00:28
519000 -- [-935.145] (-935.288) (-936.178) (-936.368) * (-936.091) (-939.282) [-935.588] (-936.683) -- 0:00:29
519500 -- (-940.535) [-937.630] (-936.151) (-938.123) * [-938.082] (-937.754) (-935.521) (-938.689) -- 0:00:29
520000 -- (-936.904) (-936.196) [-937.984] (-938.611) * (-936.327) (-935.931) (-935.273) [-939.553] -- 0:00:29
Average standard deviation of split frequencies: 0.010598
520500 -- (-935.200) [-937.485] (-937.227) (-938.180) * (-936.103) (-936.055) [-935.059] (-936.755) -- 0:00:29
521000 -- [-935.307] (-939.743) (-938.459) (-936.857) * (-935.800) (-936.964) [-936.722] (-937.696) -- 0:00:29
521500 -- (-935.110) (-936.560) [-939.567] (-941.857) * (-938.902) [-934.928] (-940.518) (-940.143) -- 0:00:29
522000 -- (-934.913) (-938.931) (-936.483) [-937.441] * (-935.953) (-938.862) (-937.775) [-936.718] -- 0:00:29
522500 -- (-936.985) (-938.951) (-936.799) [-936.143] * [-936.374] (-935.979) (-936.680) (-936.484) -- 0:00:29
523000 -- (-937.606) [-936.679] (-937.773) (-935.745) * (-936.701) (-939.357) [-940.140] (-940.368) -- 0:00:29
523500 -- (-939.759) [-940.120] (-938.366) (-935.660) * (-936.097) (-939.051) [-934.800] (-935.305) -- 0:00:29
524000 -- (-942.642) (-936.889) (-939.509) [-936.836] * (-935.137) [-935.056] (-939.674) (-937.111) -- 0:00:29
524500 -- [-939.682] (-936.995) (-936.816) (-937.712) * (-936.125) [-940.983] (-940.426) (-936.564) -- 0:00:29
525000 -- (-940.044) (-934.971) [-936.563] (-941.280) * [-938.586] (-944.455) (-938.049) (-938.124) -- 0:00:28
Average standard deviation of split frequencies: 0.010904
525500 -- [-939.606] (-935.834) (-937.417) (-936.216) * (-936.924) (-937.533) [-937.498] (-935.817) -- 0:00:28
526000 -- (-938.541) (-935.372) [-936.431] (-935.425) * [-936.748] (-936.886) (-934.932) (-937.326) -- 0:00:28
526500 -- (-937.327) [-935.818] (-936.787) (-935.406) * [-936.378] (-940.175) (-937.220) (-938.817) -- 0:00:28
527000 -- (-938.451) [-935.851] (-936.552) (-940.444) * (-937.878) (-937.662) [-936.100] (-936.233) -- 0:00:28
527500 -- (-934.727) (-936.155) [-937.734] (-938.756) * (-936.317) (-935.910) [-935.819] (-937.153) -- 0:00:28
528000 -- (-935.319) (-939.690) [-935.266] (-935.754) * (-936.217) [-935.788] (-935.315) (-940.091) -- 0:00:28
528500 -- (-935.719) (-938.567) [-935.519] (-935.071) * (-936.227) (-936.549) (-937.982) [-936.805] -- 0:00:28
529000 -- (-935.728) (-936.634) (-935.556) [-935.002] * [-935.195] (-935.269) (-939.839) (-936.685) -- 0:00:28
529500 -- (-934.974) (-937.062) [-935.414] (-935.440) * [-937.433] (-936.865) (-938.054) (-935.892) -- 0:00:28
530000 -- (-939.223) (-937.550) (-936.086) [-935.830] * (-935.257) [-942.333] (-936.537) (-936.170) -- 0:00:28
Average standard deviation of split frequencies: 0.010611
530500 -- [-936.675] (-936.366) (-936.650) (-936.415) * [-940.705] (-940.636) (-938.238) (-936.169) -- 0:00:28
531000 -- [-936.638] (-940.482) (-936.540) (-934.906) * [-940.748] (-937.066) (-939.900) (-936.153) -- 0:00:28
531500 -- (-935.588) (-936.323) (-936.426) [-935.850] * (-941.229) [-940.044] (-939.406) (-936.827) -- 0:00:28
532000 -- (-938.850) (-943.497) (-935.795) [-939.213] * (-940.028) [-936.159] (-935.305) (-935.843) -- 0:00:28
532500 -- [-938.359] (-941.202) (-935.629) (-938.756) * (-936.988) (-939.748) [-934.785] (-935.003) -- 0:00:28
533000 -- (-937.422) (-938.662) (-936.008) [-937.455] * (-938.032) (-942.298) (-936.118) [-936.129] -- 0:00:28
533500 -- (-937.624) (-937.988) [-937.282] (-938.948) * (-937.240) (-937.731) [-937.715] (-935.493) -- 0:00:27
534000 -- (-937.834) (-935.092) [-936.610] (-935.430) * (-939.154) (-936.802) [-937.067] (-936.270) -- 0:00:27
534500 -- (-935.599) (-936.094) (-935.588) [-935.430] * [-936.528] (-935.816) (-937.766) (-937.227) -- 0:00:27
535000 -- (-938.320) (-938.243) (-938.912) [-936.891] * (-939.483) (-938.512) [-935.582] (-939.436) -- 0:00:27
Average standard deviation of split frequencies: 0.010709
535500 -- (-937.070) [-935.529] (-939.472) (-937.525) * (-937.933) (-943.831) (-935.681) [-938.417] -- 0:00:28
536000 -- (-936.600) (-935.993) [-938.955] (-937.374) * (-936.216) [-936.433] (-938.276) (-937.122) -- 0:00:28
536500 -- (-935.841) [-936.352] (-938.187) (-935.396) * (-937.697) (-934.679) [-936.611] (-937.225) -- 0:00:28
537000 -- (-936.025) (-936.786) [-935.764] (-935.332) * (-942.486) [-940.132] (-938.189) (-939.400) -- 0:00:28
537500 -- (-938.194) [-940.185] (-938.012) (-936.242) * [-935.560] (-938.771) (-937.372) (-937.566) -- 0:00:28
538000 -- (-935.607) [-936.353] (-936.027) (-937.397) * (-935.252) (-937.164) (-938.348) [-935.951] -- 0:00:28
538500 -- [-936.811] (-939.933) (-935.484) (-939.812) * (-935.296) (-936.160) [-936.154] (-940.349) -- 0:00:28
539000 -- [-936.782] (-940.760) (-936.114) (-940.165) * (-937.036) (-936.897) [-937.209] (-936.628) -- 0:00:28
539500 -- [-939.523] (-940.535) (-936.956) (-936.315) * (-935.053) (-935.526) (-938.104) [-935.871] -- 0:00:28
540000 -- (-943.651) [-938.433] (-939.708) (-936.379) * (-938.267) [-935.434] (-937.722) (-936.186) -- 0:00:28
Average standard deviation of split frequencies: 0.011389
540500 -- (-938.176) [-938.357] (-938.049) (-936.400) * (-936.879) [-935.018] (-941.181) (-937.502) -- 0:00:28
541000 -- (-940.180) [-937.118] (-937.915) (-937.231) * (-939.164) [-936.763] (-940.966) (-935.793) -- 0:00:27
541500 -- (-940.359) (-935.262) (-936.929) [-937.755] * (-938.869) (-936.367) (-939.097) [-934.744] -- 0:00:27
542000 -- (-938.836) (-935.398) [-937.434] (-937.437) * (-938.328) (-938.125) (-938.354) [-935.706] -- 0:00:27
542500 -- (-938.618) (-935.803) [-937.506] (-941.486) * [-936.339] (-936.927) (-937.841) (-938.866) -- 0:00:27
543000 -- (-938.071) [-935.430] (-938.186) (-940.821) * [-938.498] (-937.476) (-938.646) (-935.743) -- 0:00:27
543500 -- (-943.550) [-934.812] (-937.783) (-942.240) * [-936.291] (-937.906) (-938.353) (-935.020) -- 0:00:27
544000 -- (-941.235) (-934.976) [-935.545] (-938.698) * (-936.225) (-944.946) (-937.528) [-935.931] -- 0:00:27
544500 -- (-937.370) (-935.626) [-936.883] (-941.952) * (-937.314) [-938.689] (-937.290) (-937.180) -- 0:00:27
545000 -- (-936.748) (-936.338) [-936.948] (-935.995) * (-937.241) [-936.320] (-935.536) (-937.037) -- 0:00:27
Average standard deviation of split frequencies: 0.011871
545500 -- (-936.057) [-937.419] (-935.191) (-935.868) * [-939.843] (-942.747) (-937.044) (-937.681) -- 0:00:27
546000 -- [-936.446] (-937.683) (-940.272) (-936.342) * (-940.885) (-935.491) [-937.409] (-936.365) -- 0:00:27
546500 -- (-936.115) (-939.081) [-936.266] (-938.079) * (-945.520) [-935.470] (-936.094) (-937.296) -- 0:00:27
547000 -- (-936.827) (-935.271) (-937.341) [-935.787] * (-936.452) (-935.042) [-935.058] (-936.125) -- 0:00:27
547500 -- (-936.699) (-939.576) (-937.873) [-938.971] * [-936.917] (-936.150) (-935.402) (-936.800) -- 0:00:27
548000 -- (-936.071) (-938.768) (-938.371) [-937.120] * (-937.513) (-939.280) (-936.714) [-936.725] -- 0:00:27
548500 -- [-936.674] (-935.750) (-938.322) (-937.618) * [-937.455] (-938.683) (-935.000) (-938.576) -- 0:00:27
549000 -- (-937.414) (-938.311) (-938.658) [-937.691] * (-938.943) (-938.976) [-936.730] (-942.580) -- 0:00:27
549500 -- (-936.533) (-937.550) [-936.497] (-936.115) * [-936.501] (-940.621) (-936.463) (-936.264) -- 0:00:27
550000 -- (-936.993) (-941.499) [-937.976] (-935.721) * (-937.193) [-939.249] (-935.374) (-938.575) -- 0:00:27
Average standard deviation of split frequencies: 0.011985
550500 -- (-938.522) (-938.066) [-937.209] (-937.063) * [-938.561] (-943.285) (-935.459) (-939.705) -- 0:00:26
551000 -- (-937.466) (-936.839) (-937.439) [-942.019] * (-936.959) [-936.502] (-937.154) (-936.458) -- 0:00:26
551500 -- (-939.219) (-937.062) (-936.499) [-937.248] * (-940.017) (-941.286) (-937.845) [-936.215] -- 0:00:26
552000 -- (-936.801) [-937.952] (-935.914) (-935.099) * (-937.774) (-938.963) [-937.400] (-936.031) -- 0:00:27
552500 -- (-938.122) (-939.420) (-938.252) [-937.614] * (-937.983) [-937.846] (-936.652) (-937.097) -- 0:00:27
553000 -- (-937.381) (-937.496) (-937.393) [-936.235] * (-941.931) (-939.869) [-939.975] (-937.236) -- 0:00:27
553500 -- [-936.216] (-935.335) (-937.614) (-934.892) * (-938.327) [-937.631] (-942.427) (-936.971) -- 0:00:27
554000 -- [-935.858] (-936.457) (-937.146) (-937.464) * (-941.439) (-939.061) (-937.331) [-940.698] -- 0:00:27
554500 -- (-937.254) [-936.259] (-947.689) (-937.298) * (-938.367) (-938.026) (-936.253) [-937.208] -- 0:00:27
555000 -- (-937.172) [-938.341] (-935.438) (-937.075) * (-935.665) (-937.884) (-936.945) [-938.297] -- 0:00:27
Average standard deviation of split frequencies: 0.011823
555500 -- (-941.883) (-936.176) [-938.264] (-939.754) * (-936.014) (-935.563) (-941.118) [-937.557] -- 0:00:27
556000 -- (-938.926) (-936.020) [-938.052] (-945.528) * (-936.459) (-938.422) [-938.044] (-937.899) -- 0:00:27
556500 -- (-935.882) (-937.584) (-935.263) [-941.719] * (-937.328) (-935.016) [-941.840] (-937.025) -- 0:00:27
557000 -- (-935.912) [-935.231] (-935.165) (-940.699) * (-936.716) (-938.831) [-935.549] (-936.070) -- 0:00:27
557500 -- (-936.052) (-936.194) (-936.731) [-943.441] * [-936.719] (-938.946) (-936.531) (-935.125) -- 0:00:26
558000 -- (-936.467) [-938.473] (-935.675) (-938.722) * [-934.992] (-937.726) (-935.621) (-937.933) -- 0:00:26
558500 -- (-938.931) (-936.591) [-936.433] (-938.386) * (-935.062) (-935.861) (-937.686) [-936.641] -- 0:00:26
559000 -- [-935.791] (-936.742) (-936.328) (-936.728) * [-936.512] (-935.934) (-936.822) (-938.049) -- 0:00:26
559500 -- [-937.777] (-937.129) (-938.310) (-937.977) * [-937.915] (-937.043) (-939.074) (-936.045) -- 0:00:26
560000 -- (-936.089) [-934.861] (-940.444) (-938.849) * [-941.796] (-936.336) (-939.421) (-937.007) -- 0:00:26
Average standard deviation of split frequencies: 0.010980
560500 -- (-936.089) (-935.532) [-936.513] (-935.918) * (-943.732) [-937.323] (-936.420) (-938.142) -- 0:00:26
561000 -- (-936.454) (-935.532) (-939.804) [-936.867] * (-941.274) (-936.322) [-936.932] (-937.253) -- 0:00:26
561500 -- (-936.463) (-937.948) (-935.543) [-936.186] * (-934.954) [-937.349] (-937.188) (-936.372) -- 0:00:26
562000 -- (-937.142) [-936.504] (-935.605) (-936.260) * (-938.439) (-938.183) [-937.862] (-937.807) -- 0:00:26
562500 -- (-937.772) (-936.496) [-937.065] (-937.140) * (-935.962) (-936.346) (-939.649) [-939.134] -- 0:00:26
563000 -- (-935.180) [-937.704] (-936.038) (-939.407) * [-935.688] (-941.940) (-940.888) (-936.398) -- 0:00:26
563500 -- (-936.340) [-936.122] (-936.050) (-936.367) * (-935.592) [-936.166] (-942.438) (-939.428) -- 0:00:26
564000 -- (-936.542) (-939.948) [-940.395] (-938.344) * (-942.147) [-936.460] (-936.174) (-937.396) -- 0:00:26
564500 -- [-936.727] (-943.847) (-935.476) (-938.027) * (-937.454) [-936.577] (-937.605) (-937.649) -- 0:00:26
565000 -- [-936.953] (-942.415) (-935.354) (-936.181) * (-937.647) (-935.455) [-936.175] (-939.284) -- 0:00:26
Average standard deviation of split frequencies: 0.011244
565500 -- (-937.440) (-937.868) [-935.780] (-935.972) * (-938.400) (-935.959) [-937.530] (-938.255) -- 0:00:26
566000 -- (-939.679) (-936.142) (-937.021) [-938.345] * [-935.209] (-936.433) (-937.545) (-939.385) -- 0:00:26
566500 -- [-937.385] (-935.500) (-937.594) (-937.121) * (-936.135) [-936.618] (-938.034) (-938.149) -- 0:00:26
567000 -- (-938.395) (-935.278) [-935.434] (-936.614) * (-936.535) (-936.959) [-938.777] (-939.861) -- 0:00:25
567500 -- [-934.796] (-936.027) (-936.097) (-939.074) * (-938.625) [-935.918] (-938.273) (-938.695) -- 0:00:25
568000 -- (-938.888) (-936.025) [-936.080] (-941.256) * [-935.992] (-936.336) (-937.784) (-939.815) -- 0:00:25
568500 -- [-936.304] (-935.905) (-935.641) (-935.760) * [-935.952] (-934.919) (-941.643) (-936.500) -- 0:00:25
569000 -- (-937.698) (-937.625) (-935.480) [-938.197] * [-939.276] (-935.795) (-936.704) (-935.792) -- 0:00:26
569500 -- (-936.207) [-935.008] (-936.408) (-938.498) * (-937.368) [-935.791] (-938.360) (-935.542) -- 0:00:26
570000 -- (-935.970) [-935.027] (-937.589) (-937.106) * (-940.949) (-935.515) (-937.314) [-937.826] -- 0:00:26
Average standard deviation of split frequencies: 0.011289
570500 -- (-937.151) (-935.241) (-938.366) [-937.943] * (-940.960) (-937.243) (-935.206) [-936.940] -- 0:00:26
571000 -- (-935.673) [-937.666] (-937.885) (-936.462) * (-936.202) (-934.956) (-935.305) [-938.448] -- 0:00:26
571500 -- (-936.144) [-936.249] (-937.374) (-938.664) * (-935.657) [-935.995] (-940.508) (-936.823) -- 0:00:26
572000 -- (-935.241) (-936.021) [-940.087] (-943.245) * [-937.595] (-940.155) (-936.460) (-936.706) -- 0:00:26
572500 -- (-935.776) (-935.976) (-936.649) [-936.718] * (-935.719) (-935.182) [-935.677] (-936.204) -- 0:00:26
573000 -- [-936.518] (-935.973) (-938.482) (-936.108) * (-935.726) (-935.407) [-936.078] (-935.582) -- 0:00:26
573500 -- (-938.686) (-936.059) [-937.902] (-936.587) * (-936.392) (-938.818) [-935.948] (-940.035) -- 0:00:26
574000 -- [-936.760] (-937.775) (-934.942) (-935.565) * [-934.618] (-945.795) (-935.343) (-940.536) -- 0:00:25
574500 -- [-937.731] (-941.003) (-939.440) (-936.461) * [-934.756] (-942.040) (-936.867) (-938.838) -- 0:00:25
575000 -- (-937.233) (-939.507) (-936.085) [-934.747] * (-941.867) [-936.829] (-936.767) (-936.757) -- 0:00:25
Average standard deviation of split frequencies: 0.011217
575500 -- (-939.807) [-937.394] (-935.790) (-935.499) * (-940.932) [-936.810] (-937.632) (-936.337) -- 0:00:25
576000 -- [-939.214] (-936.950) (-941.510) (-937.629) * (-937.518) (-937.328) [-937.779] (-936.193) -- 0:00:25
576500 -- [-938.210] (-936.026) (-937.782) (-935.789) * (-937.518) (-938.287) (-935.607) [-936.568] -- 0:00:25
577000 -- (-938.410) (-936.111) (-941.551) [-935.440] * (-937.335) [-935.362] (-936.590) (-937.767) -- 0:00:25
577500 -- (-938.103) [-936.661] (-934.830) (-936.343) * (-938.198) (-934.995) [-934.839] (-940.036) -- 0:00:25
578000 -- (-937.403) (-936.588) (-935.710) [-935.875] * [-939.048] (-938.184) (-935.980) (-941.483) -- 0:00:25
578500 -- (-937.685) [-937.088] (-936.670) (-940.359) * (-938.693) (-937.071) [-937.053] (-938.568) -- 0:00:25
579000 -- (-940.910) [-935.369] (-936.868) (-935.201) * (-939.541) (-939.402) (-935.498) [-936.349] -- 0:00:25
579500 -- (-937.695) (-935.862) (-940.435) [-937.162] * (-936.589) [-938.712] (-935.234) (-938.217) -- 0:00:25
580000 -- [-935.043] (-937.997) (-935.274) (-938.666) * (-935.455) (-940.226) [-935.301] (-936.347) -- 0:00:25
Average standard deviation of split frequencies: 0.010706
580500 -- [-938.206] (-935.634) (-940.445) (-938.822) * (-934.540) (-936.517) (-936.800) [-937.646] -- 0:00:25
581000 -- (-936.315) [-938.451] (-934.899) (-941.425) * [-936.373] (-940.361) (-936.232) (-938.153) -- 0:00:25
581500 -- (-938.704) (-935.489) [-934.934] (-939.670) * (-934.964) (-937.738) [-936.650] (-937.873) -- 0:00:25
582000 -- [-936.051] (-937.836) (-935.114) (-936.237) * (-940.355) (-941.062) [-942.257] (-943.352) -- 0:00:25
582500 -- (-935.200) (-945.470) [-935.291] (-935.451) * (-935.808) [-940.758] (-935.682) (-936.615) -- 0:00:25
583000 -- (-936.978) (-936.809) [-936.470] (-935.700) * [-935.585] (-938.138) (-934.808) (-939.259) -- 0:00:25
583500 -- [-936.682] (-936.747) (-937.913) (-936.083) * (-938.574) [-939.586] (-935.421) (-938.230) -- 0:00:24
584000 -- (-937.515) [-936.714] (-937.463) (-936.211) * (-936.616) [-935.763] (-936.789) (-935.734) -- 0:00:24
584500 -- (-936.839) (-937.643) [-938.129] (-937.091) * [-935.694] (-937.423) (-941.889) (-938.217) -- 0:00:24
585000 -- [-936.716] (-941.487) (-937.550) (-935.860) * (-935.221) (-936.910) [-936.733] (-937.040) -- 0:00:24
Average standard deviation of split frequencies: 0.010558
585500 -- (-937.487) [-939.145] (-935.946) (-935.177) * (-938.526) [-936.213] (-936.613) (-937.165) -- 0:00:25
586000 -- (-938.027) (-938.732) [-935.947] (-936.625) * (-935.264) (-936.648) (-936.834) [-936.006] -- 0:00:25
586500 -- (-938.597) (-938.800) [-937.136] (-935.944) * [-938.137] (-940.043) (-936.064) (-936.519) -- 0:00:25
587000 -- (-935.373) [-940.180] (-936.210) (-934.938) * [-938.242] (-936.550) (-936.460) (-937.049) -- 0:00:25
587500 -- (-936.209) (-936.721) (-936.618) [-936.451] * [-936.085] (-938.592) (-937.882) (-937.380) -- 0:00:25
588000 -- (-936.115) [-937.296] (-941.843) (-936.682) * (-935.465) (-937.367) [-936.188] (-938.893) -- 0:00:25
588500 -- (-937.279) (-935.336) (-935.772) [-937.329] * [-935.112] (-935.539) (-937.836) (-935.283) -- 0:00:25
589000 -- [-936.680] (-939.773) (-935.323) (-936.804) * (-936.392) (-935.341) [-936.348] (-935.176) -- 0:00:25
589500 -- (-937.389) (-936.417) (-935.171) [-935.498] * (-936.532) (-935.626) [-936.532] (-936.124) -- 0:00:25
590000 -- [-936.679] (-940.053) (-937.453) (-936.813) * (-936.971) (-937.900) (-935.863) [-936.160] -- 0:00:25
Average standard deviation of split frequencies: 0.009976
590500 -- (-935.771) [-941.129] (-937.714) (-937.472) * (-936.566) (-939.913) (-941.044) [-936.916] -- 0:00:24
591000 -- [-936.741] (-935.632) (-939.245) (-935.983) * [-935.486] (-940.505) (-938.847) (-942.473) -- 0:00:24
591500 -- [-935.734] (-936.048) (-939.193) (-936.056) * (-937.239) (-934.679) [-936.852] (-938.066) -- 0:00:24
592000 -- [-935.668] (-935.882) (-936.422) (-936.343) * (-939.391) [-936.771] (-935.335) (-935.820) -- 0:00:24
592500 -- [-940.214] (-937.573) (-936.400) (-935.436) * (-938.978) (-935.163) [-935.323] (-938.087) -- 0:00:24
593000 -- [-938.900] (-936.027) (-936.932) (-934.862) * (-938.200) (-937.379) (-935.615) [-940.122] -- 0:00:24
593500 -- [-937.087] (-937.315) (-936.791) (-936.361) * [-935.773] (-940.938) (-936.206) (-938.222) -- 0:00:24
594000 -- (-936.640) (-937.501) [-937.212] (-935.236) * (-939.947) (-940.240) (-936.066) [-935.747] -- 0:00:24
594500 -- (-938.201) [-937.517] (-937.658) (-938.463) * (-935.940) (-936.353) (-935.418) [-935.719] -- 0:00:24
595000 -- (-935.771) (-937.221) [-935.715] (-940.609) * (-935.161) (-936.123) [-938.316] (-936.353) -- 0:00:24
Average standard deviation of split frequencies: 0.009631
595500 -- (-938.773) [-936.428] (-936.952) (-939.684) * (-940.089) (-936.009) [-935.669] (-938.303) -- 0:00:24
596000 -- (-937.841) (-936.910) [-934.978] (-939.787) * (-936.342) (-937.063) [-936.114] (-937.007) -- 0:00:24
596500 -- [-938.009] (-935.768) (-935.877) (-934.800) * (-941.687) (-936.244) (-935.478) [-938.897] -- 0:00:24
597000 -- [-935.193] (-938.894) (-936.219) (-936.615) * (-939.420) [-938.802] (-935.792) (-939.197) -- 0:00:24
597500 -- (-935.036) (-938.599) (-935.805) [-938.036] * (-941.722) (-938.517) (-935.579) [-939.833] -- 0:00:24
598000 -- (-935.338) (-935.129) (-935.807) [-935.495] * (-942.525) (-937.179) (-937.482) [-938.815] -- 0:00:24
598500 -- (-935.241) (-936.147) (-935.853) [-936.096] * (-939.951) [-935.307] (-937.262) (-935.523) -- 0:00:24
599000 -- (-939.638) [-935.257] (-936.114) (-937.522) * (-935.842) (-937.671) (-937.775) [-936.028] -- 0:00:24
599500 -- (-938.403) (-939.005) [-934.932] (-937.160) * [-935.486] (-938.522) (-936.881) (-935.536) -- 0:00:24
600000 -- (-941.353) (-935.656) (-937.835) [-936.180] * (-936.050) [-941.253] (-938.893) (-937.971) -- 0:00:24
Average standard deviation of split frequencies: 0.010018
600500 -- (-939.567) (-936.608) [-937.085] (-935.035) * (-936.080) [-935.034] (-936.286) (-935.755) -- 0:00:23
601000 -- (-939.271) (-935.797) [-935.992] (-935.235) * (-938.171) (-934.968) (-936.764) [-935.770] -- 0:00:23
601500 -- (-935.555) (-936.413) (-937.517) [-937.370] * [-940.681] (-938.453) (-937.620) (-937.428) -- 0:00:23
602000 -- [-937.519] (-938.141) (-939.414) (-938.768) * [-935.248] (-936.869) (-939.179) (-937.570) -- 0:00:24
602500 -- (-935.634) (-937.905) (-937.300) [-939.944] * (-936.084) [-938.173] (-938.041) (-935.531) -- 0:00:24
603000 -- (-936.647) (-935.206) (-939.263) [-936.229] * [-935.790] (-937.942) (-936.171) (-936.754) -- 0:00:24
603500 -- (-940.786) [-935.585] (-936.191) (-935.833) * (-935.532) [-939.580] (-936.769) (-939.562) -- 0:00:24
604000 -- (-936.545) (-935.143) (-935.876) [-936.137] * [-935.343] (-939.555) (-938.136) (-936.712) -- 0:00:24
604500 -- [-935.431] (-935.483) (-936.000) (-935.313) * (-936.196) [-938.570] (-936.704) (-936.950) -- 0:00:24
605000 -- [-937.075] (-937.127) (-938.967) (-936.776) * (-935.760) [-936.638] (-938.307) (-937.188) -- 0:00:24
Average standard deviation of split frequencies: 0.010524
605500 -- [-935.234] (-935.768) (-936.245) (-936.127) * [-935.330] (-937.960) (-937.555) (-936.872) -- 0:00:24
606000 -- (-936.502) [-935.476] (-937.292) (-938.595) * (-936.179) [-937.081] (-937.802) (-935.027) -- 0:00:24
606500 -- (-935.813) (-935.504) [-938.745] (-937.250) * [-936.871] (-936.916) (-939.917) (-937.115) -- 0:00:24
607000 -- (-946.094) [-935.976] (-938.552) (-937.637) * (-935.777) (-936.963) [-939.918] (-935.760) -- 0:00:23
607500 -- [-937.639] (-936.019) (-936.214) (-938.892) * [-935.153] (-936.759) (-936.532) (-939.229) -- 0:00:23
608000 -- (-936.638) (-935.316) [-936.338] (-936.128) * (-935.379) (-936.332) [-935.781] (-937.181) -- 0:00:23
608500 -- (-936.957) (-936.920) [-937.594] (-936.268) * (-936.218) (-938.557) [-938.883] (-937.459) -- 0:00:23
609000 -- (-938.885) (-937.855) (-941.196) [-935.811] * (-937.554) [-936.935] (-936.719) (-935.651) -- 0:00:23
609500 -- (-935.852) (-935.454) (-936.134) [-936.378] * (-939.602) (-940.401) [-935.686] (-935.755) -- 0:00:23
610000 -- (-937.134) [-936.193] (-942.780) (-940.036) * (-936.282) (-937.206) (-935.754) [-936.374] -- 0:00:23
Average standard deviation of split frequencies: 0.010671
610500 -- (-937.828) [-937.834] (-938.513) (-938.801) * [-934.752] (-938.747) (-937.040) (-938.982) -- 0:00:23
611000 -- (-935.426) [-937.010] (-938.236) (-936.911) * [-934.837] (-936.253) (-936.573) (-935.852) -- 0:00:23
611500 -- (-934.976) (-937.625) (-935.462) [-936.415] * (-939.177) [-934.992] (-939.454) (-939.442) -- 0:00:23
612000 -- [-934.743] (-939.973) (-938.166) (-936.361) * (-936.021) [-934.989] (-937.250) (-939.171) -- 0:00:23
612500 -- [-934.746] (-939.153) (-937.883) (-935.267) * [-935.201] (-939.812) (-939.296) (-938.627) -- 0:00:23
613000 -- [-935.486] (-935.960) (-935.980) (-935.864) * [-936.744] (-940.540) (-938.755) (-936.863) -- 0:00:23
613500 -- (-935.296) (-940.002) (-936.511) [-935.427] * [-937.014] (-938.356) (-937.833) (-938.676) -- 0:00:23
614000 -- (-935.427) [-941.353] (-935.358) (-936.557) * (-936.099) (-937.486) (-937.488) [-935.459] -- 0:00:23
614500 -- [-937.701] (-935.635) (-935.073) (-937.739) * [-938.649] (-940.051) (-937.064) (-938.044) -- 0:00:23
615000 -- (-936.334) [-936.211] (-935.853) (-938.440) * (-937.353) (-938.570) [-937.627] (-938.429) -- 0:00:23
Average standard deviation of split frequencies: 0.010762
615500 -- (-939.541) [-937.103] (-935.893) (-936.238) * (-936.159) [-938.106] (-937.577) (-937.250) -- 0:00:23
616000 -- (-937.667) (-944.112) (-940.836) [-937.208] * (-935.214) (-939.020) (-938.639) [-936.376] -- 0:00:23
616500 -- (-935.539) [-941.358] (-939.035) (-938.148) * (-936.221) (-940.061) [-936.420] (-938.082) -- 0:00:23
617000 -- (-937.259) [-934.742] (-936.629) (-936.861) * (-939.775) [-936.430] (-935.449) (-935.268) -- 0:00:22
617500 -- (-935.336) (-936.692) (-936.586) [-935.275] * (-935.731) (-936.014) [-936.147] (-939.641) -- 0:00:22
618000 -- (-938.049) (-938.106) [-938.438] (-940.054) * (-939.469) (-937.074) [-936.513] (-939.686) -- 0:00:22
618500 -- [-942.529] (-936.471) (-939.209) (-937.772) * (-937.921) [-938.435] (-937.390) (-937.080) -- 0:00:22
619000 -- (-942.100) (-936.616) [-937.274] (-936.209) * [-935.535] (-936.930) (-936.059) (-937.766) -- 0:00:23
619500 -- (-940.556) (-940.538) [-938.895] (-935.977) * (-937.102) (-937.882) (-935.575) [-937.738] -- 0:00:23
620000 -- (-941.785) (-940.221) (-937.929) [-937.942] * [-937.079] (-938.308) (-935.372) (-935.333) -- 0:00:23
Average standard deviation of split frequencies: 0.010348
620500 -- [-938.932] (-935.106) (-935.459) (-937.839) * (-939.210) [-939.954] (-935.604) (-938.441) -- 0:00:23
621000 -- [-937.768] (-935.307) (-939.515) (-936.390) * (-938.995) (-942.519) [-934.660] (-941.089) -- 0:00:23
621500 -- (-941.131) [-939.186] (-937.247) (-937.407) * [-935.854] (-938.043) (-936.141) (-937.216) -- 0:00:23
622000 -- (-943.489) [-935.544] (-936.947) (-936.243) * (-936.303) (-936.474) [-936.823] (-937.465) -- 0:00:23
622500 -- [-935.036] (-935.410) (-942.625) (-939.525) * (-935.488) [-937.011] (-937.198) (-935.590) -- 0:00:23
623000 -- [-936.829] (-940.218) (-940.655) (-942.778) * (-935.425) (-944.067) [-935.104] (-935.798) -- 0:00:22
623500 -- (-934.828) [-940.013] (-938.130) (-939.149) * (-936.478) (-942.220) (-935.368) [-937.025] -- 0:00:22
624000 -- (-935.480) [-937.268] (-938.024) (-938.122) * (-936.589) (-939.882) (-935.093) [-939.588] -- 0:00:22
624500 -- (-938.332) (-936.084) (-936.432) [-941.105] * [-936.729] (-939.521) (-935.093) (-938.812) -- 0:00:22
625000 -- (-937.677) [-939.132] (-936.181) (-936.055) * (-935.292) (-934.923) (-937.151) [-939.391] -- 0:00:22
Average standard deviation of split frequencies: 0.010872
625500 -- [-936.946] (-935.662) (-937.060) (-937.417) * (-936.673) (-940.677) [-937.362] (-937.241) -- 0:00:22
626000 -- (-937.307) (-936.150) [-935.282] (-937.407) * [-937.052] (-942.039) (-941.123) (-935.618) -- 0:00:22
626500 -- (-935.370) (-941.532) (-936.863) [-937.665] * (-941.411) [-936.624] (-937.622) (-935.134) -- 0:00:22
627000 -- (-937.924) (-940.004) (-937.281) [-936.654] * (-937.078) (-936.091) [-937.811] (-936.658) -- 0:00:22
627500 -- (-935.167) (-940.645) (-936.023) [-936.753] * (-938.087) (-936.684) [-935.966] (-938.238) -- 0:00:22
628000 -- (-935.252) [-939.957] (-936.054) (-935.957) * (-940.997) (-936.594) [-936.547] (-935.552) -- 0:00:22
628500 -- (-936.919) [-935.071] (-938.222) (-936.945) * [-935.445] (-935.268) (-943.698) (-936.453) -- 0:00:22
629000 -- (-936.079) (-943.461) [-935.901] (-938.248) * [-935.867] (-936.079) (-936.135) (-935.924) -- 0:00:22
629500 -- (-935.773) (-939.792) (-936.004) [-934.929] * (-936.888) (-936.547) (-934.965) [-937.456] -- 0:00:22
630000 -- (-936.887) (-937.486) (-936.826) [-936.150] * (-936.409) [-934.825] (-936.557) (-937.788) -- 0:00:22
Average standard deviation of split frequencies: 0.010745
630500 -- [-935.099] (-936.667) (-937.754) (-936.668) * (-936.281) (-934.728) [-936.136] (-937.424) -- 0:00:22
631000 -- (-938.194) (-938.046) [-935.243] (-936.182) * (-936.467) (-937.968) (-936.819) [-938.466] -- 0:00:22
631500 -- [-936.148] (-936.018) (-937.850) (-939.733) * [-936.633] (-935.691) (-938.266) (-936.340) -- 0:00:22
632000 -- (-936.838) [-936.782] (-938.203) (-937.624) * (-936.909) (-936.202) [-935.384] (-938.923) -- 0:00:22
632500 -- (-935.496) (-935.963) [-938.481] (-942.478) * [-939.762] (-935.476) (-935.669) (-936.777) -- 0:00:22
633000 -- (-936.499) (-939.642) (-940.709) [-938.948] * (-937.030) (-936.173) (-936.126) [-935.548] -- 0:00:22
633500 -- (-936.083) [-937.290] (-936.257) (-937.196) * (-936.655) (-937.684) [-936.741] (-936.683) -- 0:00:21
634000 -- (-936.707) (-936.770) [-938.088] (-939.030) * (-936.614) (-937.434) [-937.390] (-936.826) -- 0:00:21
634500 -- (-937.592) (-936.239) (-941.360) [-935.655] * (-939.574) (-936.581) [-935.669] (-936.006) -- 0:00:21
635000 -- (-935.236) (-941.009) (-937.976) [-935.169] * (-938.291) (-937.265) (-936.015) [-936.888] -- 0:00:21
Average standard deviation of split frequencies: 0.010420
635500 -- (-937.389) (-939.627) (-940.449) [-936.093] * (-936.364) (-942.052) (-937.885) [-937.163] -- 0:00:22
636000 -- (-935.538) (-936.375) (-937.403) [-937.947] * (-936.701) (-939.455) (-937.803) [-935.213] -- 0:00:22
636500 -- [-936.580] (-936.052) (-936.327) (-940.785) * [-935.229] (-938.086) (-937.583) (-935.804) -- 0:00:22
637000 -- (-936.713) (-936.840) (-936.026) [-936.233] * (-936.220) (-936.617) [-936.193] (-935.670) -- 0:00:22
637500 -- [-937.656] (-938.078) (-937.492) (-937.520) * [-935.536] (-938.004) (-936.465) (-940.614) -- 0:00:22
638000 -- (-934.763) (-940.019) [-935.404] (-939.084) * (-938.228) (-935.695) [-936.627] (-941.847) -- 0:00:22
638500 -- [-934.918] (-936.908) (-935.319) (-941.290) * (-935.402) [-936.339] (-940.609) (-936.730) -- 0:00:22
639000 -- [-935.022] (-936.595) (-937.099) (-939.148) * (-935.450) [-936.120] (-938.270) (-936.597) -- 0:00:22
639500 -- (-937.335) (-938.540) [-936.474] (-942.796) * (-937.232) (-938.283) [-936.474] (-937.994) -- 0:00:21
640000 -- (-939.939) (-936.873) (-935.950) [-938.082] * (-937.085) (-937.635) (-938.170) [-938.302] -- 0:00:21
Average standard deviation of split frequencies: 0.011497
640500 -- (-941.756) (-935.197) (-935.305) [-936.027] * (-937.604) [-937.641] (-937.458) (-941.952) -- 0:00:21
641000 -- [-936.672] (-936.616) (-935.580) (-937.987) * (-941.891) (-938.718) (-939.579) [-936.169] -- 0:00:21
641500 -- [-935.990] (-937.269) (-939.519) (-936.465) * (-936.801) (-936.020) (-936.489) [-935.739] -- 0:00:21
642000 -- [-937.495] (-937.078) (-936.891) (-936.009) * (-938.928) (-939.785) [-937.632] (-939.224) -- 0:00:21
642500 -- [-937.129] (-937.120) (-935.612) (-935.542) * (-936.197) (-939.830) (-937.802) [-941.332] -- 0:00:21
643000 -- (-940.120) [-938.535] (-935.097) (-936.009) * (-936.516) (-938.557) [-935.319] (-936.500) -- 0:00:21
643500 -- (-942.063) (-940.667) [-935.230] (-936.221) * (-938.965) (-938.335) (-935.232) [-941.393] -- 0:00:21
644000 -- [-938.646] (-941.537) (-939.651) (-937.902) * (-939.386) (-936.801) (-935.730) [-938.560] -- 0:00:21
644500 -- (-938.666) (-937.888) (-935.970) [-937.667] * (-939.030) [-936.280] (-937.132) (-937.641) -- 0:00:21
645000 -- (-936.522) (-937.301) (-936.667) [-936.450] * (-939.131) (-936.588) (-937.256) [-937.348] -- 0:00:21
Average standard deviation of split frequencies: 0.010903
645500 -- (-936.773) (-938.111) [-937.130] (-936.854) * (-935.631) (-938.632) [-937.288] (-939.038) -- 0:00:21
646000 -- (-934.845) (-935.524) [-935.205] (-936.531) * (-937.753) (-937.665) (-937.524) [-936.680] -- 0:00:21
646500 -- (-937.352) [-935.452] (-936.269) (-934.954) * (-935.511) [-939.005] (-935.862) (-938.161) -- 0:00:21
647000 -- [-939.604] (-938.408) (-935.765) (-935.588) * (-935.277) (-935.442) [-936.736] (-937.309) -- 0:00:21
647500 -- (-937.248) (-935.252) (-937.472) [-937.468] * (-936.359) (-938.203) (-934.896) [-936.597] -- 0:00:21
648000 -- [-937.158] (-936.128) (-936.230) (-936.592) * (-935.284) (-937.503) [-934.910] (-936.146) -- 0:00:21
648500 -- (-936.032) (-939.247) [-936.297] (-937.579) * [-935.332] (-942.161) (-937.463) (-936.133) -- 0:00:21
649000 -- (-936.652) (-939.217) (-937.959) [-936.119] * (-936.236) (-938.482) [-936.224] (-936.037) -- 0:00:21
649500 -- (-938.668) [-935.978] (-936.633) (-942.599) * (-938.990) [-934.833] (-936.464) (-935.653) -- 0:00:21
650000 -- (-937.393) (-938.780) [-938.186] (-943.299) * [-937.222] (-935.553) (-938.362) (-935.523) -- 0:00:21
Average standard deviation of split frequencies: 0.011320
650500 -- [-936.712] (-935.773) (-939.254) (-939.237) * (-940.049) [-938.628] (-937.122) (-935.317) -- 0:00:20
651000 -- (-936.802) [-936.605] (-936.693) (-937.109) * [-935.541] (-938.948) (-937.490) (-936.682) -- 0:00:20
651500 -- (-935.680) [-937.016] (-937.078) (-936.711) * (-936.230) [-939.095] (-941.999) (-935.545) -- 0:00:20
652000 -- (-935.977) (-935.245) (-937.247) [-938.921] * (-936.485) [-937.672] (-938.262) (-934.811) -- 0:00:21
652500 -- (-935.884) (-941.629) [-938.278] (-936.647) * (-936.239) (-942.125) (-938.116) [-934.967] -- 0:00:21
653000 -- (-938.153) (-937.582) [-936.319] (-936.728) * (-936.172) (-939.125) [-938.782] (-938.237) -- 0:00:21
653500 -- (-938.240) (-940.961) (-934.895) [-936.564] * [-938.362] (-934.751) (-940.243) (-938.172) -- 0:00:21
654000 -- (-938.485) (-937.691) [-937.719] (-936.182) * (-937.078) [-935.188] (-937.227) (-937.078) -- 0:00:21
654500 -- [-939.104] (-941.574) (-939.183) (-936.478) * (-937.055) [-935.490] (-936.159) (-938.531) -- 0:00:21
655000 -- [-938.344] (-936.546) (-936.675) (-941.010) * (-936.702) (-938.594) [-938.446] (-941.896) -- 0:00:21
Average standard deviation of split frequencies: 0.010779
655500 -- (-938.335) (-936.830) [-937.785] (-938.981) * [-936.975] (-935.025) (-937.308) (-939.450) -- 0:00:21
656000 -- (-937.872) [-938.836] (-935.030) (-938.348) * (-937.762) [-934.941] (-935.319) (-935.403) -- 0:00:20
656500 -- (-936.131) [-937.099] (-934.891) (-935.493) * (-935.577) (-939.258) (-938.096) [-935.453] -- 0:00:20
657000 -- (-935.998) (-939.361) (-936.576) [-935.087] * (-935.817) (-935.670) (-937.156) [-936.216] -- 0:00:20
657500 -- (-937.797) [-935.013] (-938.746) (-939.757) * [-937.068] (-945.808) (-937.267) (-936.901) -- 0:00:20
658000 -- [-937.535] (-935.039) (-938.723) (-936.113) * (-937.520) (-936.923) [-938.290] (-937.915) -- 0:00:20
658500 -- (-936.567) (-936.706) (-937.170) [-936.371] * (-939.124) [-935.908] (-935.461) (-938.885) -- 0:00:20
659000 -- (-935.959) [-937.207] (-938.079) (-935.500) * (-936.253) (-935.807) [-936.663] (-937.031) -- 0:00:20
659500 -- [-936.490] (-939.244) (-941.010) (-936.752) * (-937.527) [-937.875] (-937.575) (-937.033) -- 0:00:20
660000 -- [-938.535] (-937.992) (-938.645) (-937.893) * (-935.313) (-936.869) [-938.301] (-939.862) -- 0:00:20
Average standard deviation of split frequencies: 0.010703
660500 -- (-935.360) [-936.992] (-937.201) (-937.455) * (-935.297) (-936.153) (-942.213) [-935.172] -- 0:00:20
661000 -- (-936.844) (-937.423) [-935.451] (-937.734) * (-937.308) [-938.085] (-940.331) (-935.609) -- 0:00:20
661500 -- (-938.228) [-936.393] (-938.093) (-938.179) * (-936.564) [-936.706] (-936.684) (-935.110) -- 0:00:20
662000 -- (-936.840) [-936.308] (-938.396) (-937.046) * (-937.365) (-936.369) [-938.826] (-935.288) -- 0:00:20
662500 -- (-937.317) [-936.109] (-936.657) (-938.211) * (-936.801) (-936.720) (-937.486) [-937.981] -- 0:00:20
663000 -- [-938.222] (-935.963) (-935.827) (-940.597) * (-937.575) (-938.764) (-934.850) [-935.933] -- 0:00:20
663500 -- (-939.869) (-935.087) [-936.136] (-939.025) * [-935.111] (-937.046) (-937.347) (-936.710) -- 0:00:20
664000 -- [-939.667] (-936.496) (-938.792) (-936.181) * [-935.102] (-940.080) (-945.355) (-935.504) -- 0:00:20
664500 -- (-937.505) (-935.608) [-938.915] (-940.926) * (-937.845) (-939.499) [-937.683] (-936.152) -- 0:00:20
665000 -- (-936.797) (-936.655) (-935.908) [-938.975] * [-936.182] (-940.125) (-938.902) (-935.622) -- 0:00:20
Average standard deviation of split frequencies: 0.011281
665500 -- (-939.010) (-939.903) [-938.340] (-938.257) * [-935.959] (-935.447) (-941.377) (-938.053) -- 0:00:20
666000 -- [-937.844] (-940.384) (-935.887) (-938.310) * (-935.391) (-935.815) [-939.542] (-937.659) -- 0:00:20
666500 -- (-941.905) [-937.114] (-935.273) (-935.593) * (-936.811) [-938.045] (-936.620) (-937.750) -- 0:00:20
667000 -- (-935.845) (-937.276) [-936.425] (-935.060) * (-937.873) (-937.660) [-935.962] (-943.033) -- 0:00:19
667500 -- (-937.697) (-937.552) [-936.368] (-937.252) * (-935.480) [-935.475] (-937.135) (-937.666) -- 0:00:19
668000 -- (-935.340) [-939.525] (-935.751) (-940.040) * (-936.643) (-935.128) (-937.488) [-935.001] -- 0:00:19
668500 -- (-939.249) [-935.797] (-935.502) (-935.632) * (-935.479) (-936.516) (-938.240) [-935.835] -- 0:00:19
669000 -- [-936.636] (-938.329) (-937.799) (-938.123) * (-940.254) (-937.074) [-936.816] (-936.334) -- 0:00:20
669500 -- (-942.027) (-936.236) (-936.533) [-936.729] * (-940.080) (-938.882) [-935.327] (-938.567) -- 0:00:20
670000 -- (-938.058) (-936.835) [-937.512] (-939.188) * (-940.725) (-937.188) (-936.048) [-936.953] -- 0:00:20
Average standard deviation of split frequencies: 0.011027
670500 -- [-937.082] (-937.753) (-942.498) (-939.348) * (-938.723) (-935.495) [-938.871] (-937.363) -- 0:00:20
671000 -- (-937.390) (-937.775) (-936.883) [-938.990] * (-937.514) [-937.425] (-938.258) (-938.190) -- 0:00:20
671500 -- (-936.963) [-935.512] (-938.647) (-937.131) * (-937.671) [-937.560] (-939.506) (-938.108) -- 0:00:20
672000 -- (-937.617) [-936.389] (-935.878) (-937.292) * [-939.659] (-935.900) (-937.999) (-935.911) -- 0:00:20
672500 -- [-935.992] (-938.390) (-936.280) (-935.605) * (-939.234) (-935.836) [-935.365] (-935.690) -- 0:00:19
673000 -- (-934.912) [-938.102] (-936.780) (-938.607) * [-937.523] (-936.281) (-934.631) (-935.609) -- 0:00:19
673500 -- (-934.932) [-935.615] (-937.618) (-938.249) * (-940.129) [-935.941] (-939.972) (-937.132) -- 0:00:19
674000 -- [-934.962] (-935.657) (-935.796) (-936.321) * (-938.721) [-935.805] (-939.710) (-935.163) -- 0:00:19
674500 -- (-935.457) (-935.273) [-937.869] (-937.335) * [-937.472] (-937.508) (-936.054) (-937.330) -- 0:00:19
675000 -- (-937.469) (-935.462) (-937.474) [-935.912] * (-937.173) [-936.098] (-939.530) (-936.603) -- 0:00:19
Average standard deviation of split frequencies: 0.010940
675500 -- (-935.497) (-935.085) [-936.015] (-937.494) * (-941.475) [-934.905] (-938.461) (-937.417) -- 0:00:19
676000 -- (-936.553) (-937.956) (-939.688) [-937.585] * (-935.755) (-935.118) [-941.413] (-936.404) -- 0:00:19
676500 -- (-935.801) [-935.452] (-940.717) (-938.827) * (-936.013) [-935.118] (-936.561) (-936.029) -- 0:00:19
677000 -- (-936.791) [-935.660] (-941.939) (-937.281) * (-937.190) (-937.481) [-935.402] (-935.972) -- 0:00:19
677500 -- (-937.896) (-936.898) [-937.466] (-936.766) * (-934.877) [-937.537] (-937.566) (-936.438) -- 0:00:19
678000 -- [-934.968] (-937.446) (-937.441) (-939.761) * (-936.162) (-936.028) (-938.838) [-936.285] -- 0:00:19
678500 -- [-935.081] (-936.195) (-938.184) (-936.542) * (-939.284) (-936.894) (-942.305) [-936.183] -- 0:00:19
679000 -- [-935.088] (-937.430) (-936.229) (-934.985) * (-938.594) [-935.995] (-935.241) (-935.395) -- 0:00:19
679500 -- (-938.605) (-935.445) (-937.371) [-941.126] * (-937.126) (-939.916) [-936.636] (-936.932) -- 0:00:19
680000 -- (-935.222) (-935.508) (-937.349) [-940.994] * (-937.016) (-936.443) (-936.954) [-935.666] -- 0:00:19
Average standard deviation of split frequencies: 0.010951
680500 -- (-936.043) (-935.529) (-936.835) [-937.542] * (-938.396) [-935.892] (-941.930) (-935.616) -- 0:00:19
681000 -- (-935.849) (-935.240) (-936.472) [-935.409] * (-937.289) (-935.974) [-937.644] (-937.640) -- 0:00:19
681500 -- (-936.680) (-937.840) [-938.751] (-936.034) * (-939.166) [-936.296] (-936.493) (-936.796) -- 0:00:19
682000 -- (-937.755) (-936.336) (-937.016) [-935.753] * (-940.682) (-937.971) [-936.096] (-937.097) -- 0:00:19
682500 -- [-937.222] (-936.398) (-937.332) (-936.049) * (-937.628) (-937.646) (-937.566) [-936.662] -- 0:00:19
683000 -- [-936.974] (-937.336) (-936.101) (-935.894) * (-938.085) [-937.357] (-937.059) (-936.949) -- 0:00:19
683500 -- (-937.740) (-938.764) [-935.735] (-935.891) * [-937.242] (-936.823) (-936.860) (-936.970) -- 0:00:18
684000 -- (-935.908) [-940.314] (-940.940) (-935.788) * (-937.302) (-936.029) (-936.186) [-937.571] -- 0:00:18
684500 -- (-937.598) [-935.403] (-941.397) (-939.400) * (-937.251) [-936.206] (-936.402) (-941.330) -- 0:00:18
685000 -- (-937.865) (-936.347) [-940.042] (-937.005) * (-935.946) (-937.682) (-939.602) [-939.095] -- 0:00:18
Average standard deviation of split frequencies: 0.011081
685500 -- (-937.559) (-935.981) (-939.497) [-936.005] * [-938.731] (-936.269) (-937.720) (-937.398) -- 0:00:19
686000 -- (-938.617) (-938.363) [-936.057] (-937.318) * (-936.566) [-936.223] (-939.962) (-940.581) -- 0:00:19
686500 -- (-934.786) (-940.948) (-936.400) [-935.271] * [-938.786] (-936.482) (-938.173) (-936.656) -- 0:00:19
687000 -- (-937.397) (-936.203) [-939.140] (-935.712) * (-934.743) (-938.504) (-937.744) [-936.318] -- 0:00:19
687500 -- (-943.991) (-936.532) (-935.277) [-938.353] * [-936.845] (-937.819) (-939.754) (-938.951) -- 0:00:19
688000 -- (-938.619) [-938.694] (-937.198) (-938.292) * (-936.604) [-939.102] (-938.380) (-942.541) -- 0:00:19
688500 -- (-936.504) (-938.827) (-938.725) [-936.999] * (-935.262) (-938.871) (-935.624) [-940.685] -- 0:00:19
689000 -- (-935.626) (-943.270) (-938.061) [-935.882] * (-935.979) (-938.476) (-935.215) [-937.545] -- 0:00:18
689500 -- (-937.735) (-938.569) [-936.056] (-935.329) * (-938.598) (-941.597) [-935.733] (-935.469) -- 0:00:18
690000 -- [-936.361] (-937.868) (-936.281) (-935.954) * (-940.119) [-938.019] (-935.212) (-935.850) -- 0:00:18
Average standard deviation of split frequencies: 0.010921
690500 -- (-936.394) (-935.810) (-936.654) [-935.636] * (-936.057) (-937.194) [-936.064] (-936.219) -- 0:00:18
691000 -- (-934.771) (-937.396) [-940.758] (-937.495) * (-936.368) (-937.127) (-944.636) [-937.406] -- 0:00:18
691500 -- (-935.659) (-934.882) [-939.907] (-936.575) * [-938.963] (-936.384) (-941.544) (-937.738) -- 0:00:18
692000 -- [-942.661] (-935.135) (-938.809) (-939.573) * (-935.555) (-937.804) [-938.581] (-938.452) -- 0:00:18
692500 -- (-938.406) (-935.635) [-936.517] (-936.105) * [-934.993] (-938.760) (-934.857) (-934.851) -- 0:00:18
693000 -- (-935.857) [-937.737] (-936.790) (-935.436) * (-934.846) [-936.644] (-936.814) (-936.376) -- 0:00:18
693500 -- (-936.104) (-935.260) [-939.133] (-936.827) * [-936.255] (-939.872) (-936.663) (-935.317) -- 0:00:18
694000 -- [-937.788] (-937.003) (-936.578) (-936.240) * [-936.847] (-935.950) (-937.623) (-936.028) -- 0:00:18
694500 -- (-937.286) (-937.940) [-935.945] (-938.079) * [-937.226] (-937.082) (-937.217) (-938.948) -- 0:00:18
695000 -- (-936.566) (-935.772) (-936.357) [-936.179] * (-938.025) (-935.830) (-938.281) [-940.289] -- 0:00:18
Average standard deviation of split frequencies: 0.010710
695500 -- [-937.724] (-934.950) (-936.438) (-936.737) * (-936.733) (-936.617) (-935.918) [-936.502] -- 0:00:18
696000 -- (-939.672) [-935.822] (-935.192) (-936.413) * (-936.021) [-935.975] (-936.459) (-939.034) -- 0:00:18
696500 -- (-935.962) (-936.022) [-938.072] (-934.909) * (-936.725) [-935.455] (-938.540) (-938.143) -- 0:00:18
697000 -- (-938.612) (-935.115) (-938.024) [-937.968] * (-940.985) [-934.823] (-937.502) (-935.308) -- 0:00:18
697500 -- (-940.345) (-935.107) (-936.684) [-934.763] * (-935.268) (-935.985) [-936.384] (-937.096) -- 0:00:18
698000 -- (-942.501) (-936.723) [-935.401] (-938.752) * (-938.159) [-937.651] (-938.661) (-937.543) -- 0:00:18
698500 -- [-937.311] (-935.820) (-935.428) (-937.679) * (-937.467) (-935.824) [-935.276] (-937.317) -- 0:00:18
699000 -- (-937.640) (-935.498) (-936.530) [-938.768] * (-937.236) [-935.808] (-936.835) (-938.336) -- 0:00:18
699500 -- (-937.850) [-936.034] (-937.931) (-935.839) * [-936.727] (-936.673) (-935.840) (-938.700) -- 0:00:18
700000 -- (-936.552) (-936.595) (-939.472) [-936.091] * [-935.767] (-935.668) (-937.737) (-934.976) -- 0:00:18
Average standard deviation of split frequencies: 0.010807
700500 -- (-937.899) [-935.791] (-935.547) (-937.273) * (-936.007) (-935.584) [-936.297] (-935.808) -- 0:00:17
701000 -- (-939.601) (-935.716) (-939.135) [-936.710] * (-935.170) [-936.579] (-934.896) (-935.824) -- 0:00:17
701500 -- (-938.437) [-936.838] (-939.287) (-935.687) * (-938.901) (-937.763) (-935.602) [-938.881] -- 0:00:17
702000 -- (-935.706) (-942.651) [-936.364] (-938.287) * [-935.490] (-937.583) (-940.375) (-938.909) -- 0:00:18
702500 -- (-936.090) [-940.570] (-935.668) (-940.487) * (-937.106) [-935.312] (-938.343) (-936.280) -- 0:00:18
703000 -- (-938.062) (-935.781) [-935.732] (-938.609) * (-935.624) (-935.200) [-935.870] (-937.702) -- 0:00:18
703500 -- (-937.837) (-938.649) (-935.969) [-935.500] * [-935.390] (-936.033) (-934.832) (-935.971) -- 0:00:18
704000 -- (-938.146) (-938.365) (-939.194) [-934.985] * (-936.669) (-935.550) (-938.572) [-935.484] -- 0:00:18
704500 -- (-936.354) (-942.319) [-938.112] (-936.141) * (-937.549) [-936.447] (-935.953) (-938.173) -- 0:00:18
705000 -- (-935.274) (-941.048) (-937.225) [-937.754] * [-936.979] (-935.844) (-937.458) (-935.253) -- 0:00:17
Average standard deviation of split frequencies: 0.010600
705500 -- (-938.394) (-935.638) [-936.369] (-938.051) * [-939.881] (-939.012) (-934.648) (-935.162) -- 0:00:17
706000 -- (-937.717) (-935.035) (-935.359) [-935.540] * (-936.358) (-939.361) [-937.268] (-937.855) -- 0:00:17
706500 -- (-940.033) (-937.602) (-938.609) [-935.043] * (-937.386) [-939.069] (-937.883) (-942.025) -- 0:00:17
707000 -- (-943.330) (-937.145) [-936.218] (-936.146) * (-937.949) (-936.431) (-934.952) [-936.300] -- 0:00:17
707500 -- [-939.730] (-936.221) (-936.110) (-937.854) * (-938.373) [-935.764] (-935.154) (-935.711) -- 0:00:17
708000 -- (-938.975) (-935.756) (-937.500) [-939.690] * [-936.067] (-938.734) (-939.458) (-936.535) -- 0:00:17
708500 -- [-936.565] (-938.437) (-936.516) (-937.174) * (-938.801) (-936.630) [-935.405] (-937.458) -- 0:00:17
709000 -- (-942.413) (-944.114) [-940.435] (-937.322) * (-935.855) (-937.478) [-941.753] (-938.171) -- 0:00:17
709500 -- (-935.456) (-940.461) (-937.712) [-935.500] * [-939.306] (-938.691) (-943.013) (-935.941) -- 0:00:17
710000 -- (-937.844) [-941.869] (-937.039) (-935.552) * (-936.181) [-936.365] (-938.024) (-937.201) -- 0:00:17
Average standard deviation of split frequencies: 0.010738
710500 -- [-938.334] (-937.361) (-939.267) (-937.429) * (-935.691) [-937.259] (-936.364) (-937.542) -- 0:00:17
711000 -- (-938.121) [-936.238] (-935.243) (-942.400) * [-937.301] (-935.997) (-934.939) (-937.923) -- 0:00:17
711500 -- (-940.989) (-936.196) [-934.987] (-936.134) * (-940.614) (-936.679) (-939.678) [-940.518] -- 0:00:17
712000 -- (-938.270) (-941.624) (-940.686) [-935.050] * (-939.054) (-937.141) [-938.145] (-938.241) -- 0:00:17
712500 -- (-937.336) (-938.207) (-938.380) [-937.902] * (-939.769) (-938.233) (-935.140) [-937.797] -- 0:00:17
713000 -- (-935.607) (-937.236) (-936.039) [-937.262] * (-938.377) (-938.902) (-940.647) [-937.609] -- 0:00:17
713500 -- [-936.369] (-935.284) (-937.014) (-937.131) * [-937.464] (-938.904) (-938.977) (-936.580) -- 0:00:17
714000 -- [-936.010] (-937.403) (-937.636) (-935.582) * (-935.908) (-942.698) (-941.293) [-936.861] -- 0:00:17
714500 -- (-935.272) [-935.942] (-937.093) (-935.292) * [-938.887] (-941.000) (-936.337) (-938.372) -- 0:00:17
715000 -- (-938.210) [-935.664] (-937.233) (-936.056) * [-936.188] (-940.891) (-936.629) (-937.438) -- 0:00:17
Average standard deviation of split frequencies: 0.010575
715500 -- [-937.381] (-936.403) (-938.351) (-936.936) * [-935.875] (-940.612) (-937.495) (-938.206) -- 0:00:17
716000 -- (-944.987) [-935.276] (-937.197) (-938.669) * [-936.571] (-938.400) (-942.324) (-934.872) -- 0:00:17
716500 -- [-936.996] (-935.799) (-938.128) (-940.202) * [-938.339] (-937.846) (-938.075) (-939.144) -- 0:00:17
717000 -- (-937.193) (-935.508) (-939.668) [-938.232] * (-941.252) [-937.079] (-940.190) (-938.671) -- 0:00:16
717500 -- (-939.585) [-935.110] (-938.739) (-938.622) * [-934.928] (-935.466) (-935.498) (-938.851) -- 0:00:16
718000 -- (-936.574) (-939.525) [-935.534] (-939.848) * (-937.338) (-935.319) (-938.053) [-938.530] -- 0:00:16
718500 -- (-934.946) (-939.773) [-937.305] (-938.759) * [-937.978] (-935.755) (-937.903) (-938.210) -- 0:00:16
719000 -- (-935.796) [-934.995] (-936.894) (-938.847) * [-937.812] (-937.156) (-940.584) (-940.398) -- 0:00:17
719500 -- (-935.019) [-935.507] (-939.942) (-937.054) * (-937.860) (-938.008) (-937.284) [-936.981] -- 0:00:17
720000 -- (-937.451) (-936.813) [-935.601] (-936.078) * (-936.602) (-938.800) [-935.710] (-938.758) -- 0:00:17
Average standard deviation of split frequencies: 0.010548
720500 -- (-937.358) [-936.316] (-936.422) (-936.869) * (-938.974) (-936.082) [-936.262] (-936.530) -- 0:00:17
721000 -- (-941.457) (-939.250) [-937.495] (-936.452) * (-936.755) [-936.055] (-936.363) (-936.480) -- 0:00:17
721500 -- (-939.907) (-938.062) [-937.979] (-940.294) * (-936.656) (-936.234) [-935.346] (-938.910) -- 0:00:16
722000 -- (-938.313) (-935.970) (-937.625) [-935.699] * [-936.506] (-936.695) (-940.108) (-935.629) -- 0:00:16
722500 -- (-935.750) (-936.773) (-940.533) [-939.412] * (-936.521) (-937.294) (-938.360) [-937.946] -- 0:00:16
723000 -- [-936.386] (-937.103) (-937.502) (-935.115) * (-937.057) [-939.179] (-938.556) (-935.665) -- 0:00:16
723500 -- (-939.522) (-937.110) (-937.427) [-935.116] * (-938.632) [-935.035] (-938.564) (-943.638) -- 0:00:16
724000 -- (-938.165) (-937.459) [-935.975] (-935.980) * [-935.166] (-936.894) (-935.885) (-938.486) -- 0:00:16
724500 -- (-936.820) (-936.415) (-935.640) [-938.699] * (-938.908) (-936.724) (-939.483) [-937.287] -- 0:00:16
725000 -- (-937.412) [-936.897] (-937.516) (-939.232) * [-939.565] (-935.414) (-935.922) (-935.998) -- 0:00:16
Average standard deviation of split frequencies: 0.010427
725500 -- (-937.458) (-934.961) (-937.297) [-936.311] * [-937.411] (-936.639) (-937.319) (-937.492) -- 0:00:16
726000 -- (-937.977) (-935.172) [-935.854] (-937.534) * [-940.327] (-939.188) (-935.394) (-935.931) -- 0:00:16
726500 -- (-934.794) [-938.401] (-935.893) (-937.795) * (-938.727) (-936.115) (-935.722) [-935.584] -- 0:00:16
727000 -- [-938.495] (-936.485) (-936.617) (-943.346) * (-935.941) (-936.118) [-935.279] (-935.925) -- 0:00:16
727500 -- [-934.628] (-937.310) (-935.264) (-937.207) * (-936.875) (-935.550) (-935.343) [-935.928] -- 0:00:16
728000 -- (-935.667) (-940.439) [-935.464] (-937.663) * (-935.765) [-938.311] (-935.162) (-934.622) -- 0:00:16
728500 -- (-935.997) [-936.796] (-937.684) (-939.739) * (-937.201) [-937.026] (-935.551) (-935.985) -- 0:00:16
729000 -- (-935.967) (-936.887) [-936.992] (-936.708) * (-936.310) [-938.122] (-937.276) (-936.114) -- 0:00:16
729500 -- [-936.623] (-935.322) (-936.547) (-944.236) * [-935.801] (-935.892) (-937.683) (-936.909) -- 0:00:16
730000 -- (-937.255) (-935.718) (-941.116) [-936.238] * [-935.720] (-938.027) (-939.584) (-938.413) -- 0:00:16
Average standard deviation of split frequencies: 0.009943
730500 -- [-938.312] (-939.316) (-938.030) (-939.737) * (-935.668) (-939.019) [-939.384] (-935.879) -- 0:00:16
731000 -- (-936.598) (-937.899) [-935.166] (-936.467) * (-934.988) [-936.227] (-939.185) (-936.298) -- 0:00:16
731500 -- (-936.464) [-937.560] (-937.314) (-936.958) * (-936.629) [-936.481] (-938.818) (-938.915) -- 0:00:16
732000 -- [-936.732] (-935.794) (-937.302) (-936.564) * (-936.461) (-936.080) (-946.189) [-935.835] -- 0:00:16
732500 -- (-936.479) (-938.261) [-937.857] (-937.648) * (-936.738) [-936.462] (-935.950) (-938.785) -- 0:00:16
733000 -- (-937.602) [-938.012] (-936.719) (-939.384) * (-936.312) (-936.436) (-937.574) [-935.300] -- 0:00:16
733500 -- (-935.713) [-937.795] (-935.951) (-936.940) * (-936.561) (-936.395) (-936.663) [-938.434] -- 0:00:15
734000 -- (-938.782) (-934.792) (-935.537) [-937.029] * (-936.391) [-936.483] (-937.141) (-934.878) -- 0:00:15
734500 -- (-938.169) (-935.553) [-936.321] (-935.622) * [-935.618] (-939.295) (-937.313) (-935.111) -- 0:00:15
735000 -- (-937.734) [-936.059] (-939.040) (-938.658) * (-935.452) [-938.152] (-937.510) (-936.131) -- 0:00:15
Average standard deviation of split frequencies: 0.010135
735500 -- [-937.606] (-936.893) (-936.867) (-940.862) * (-936.179) [-939.532] (-936.495) (-938.614) -- 0:00:15
736000 -- [-941.011] (-937.035) (-941.645) (-935.022) * (-935.764) (-935.468) (-936.772) [-940.222] -- 0:00:16
736500 -- (-936.872) (-935.948) [-936.359] (-944.946) * (-940.081) (-935.785) (-941.004) [-937.020] -- 0:00:16
737000 -- (-940.055) [-937.265] (-936.998) (-939.933) * (-937.545) [-941.224] (-941.425) (-936.093) -- 0:00:16
737500 -- (-937.545) (-936.171) [-935.551] (-936.706) * [-935.939] (-936.509) (-939.240) (-937.824) -- 0:00:16
738000 -- (-935.494) (-937.462) (-940.415) [-936.812] * (-934.493) [-936.109] (-938.861) (-937.915) -- 0:00:15
738500 -- [-936.275] (-935.605) (-936.374) (-940.700) * [-937.544] (-936.899) (-943.181) (-936.032) -- 0:00:15
739000 -- (-934.616) [-935.099] (-936.675) (-939.481) * (-936.558) (-936.095) [-937.607] (-936.738) -- 0:00:15
739500 -- [-935.985] (-942.116) (-938.687) (-936.052) * (-935.176) (-940.035) (-940.046) [-938.888] -- 0:00:15
740000 -- (-938.321) (-935.301) [-935.935] (-938.595) * (-935.531) (-938.132) [-936.009] (-936.228) -- 0:00:15
Average standard deviation of split frequencies: 0.009984
740500 -- (-936.970) (-935.043) [-935.516] (-939.764) * [-939.159] (-937.107) (-935.649) (-938.591) -- 0:00:15
741000 -- [-937.288] (-936.231) (-938.435) (-943.596) * (-937.124) (-935.957) [-937.494] (-936.635) -- 0:00:15
741500 -- [-934.750] (-935.813) (-938.991) (-941.189) * [-937.040] (-936.458) (-937.417) (-938.321) -- 0:00:15
742000 -- [-934.929] (-938.550) (-938.389) (-938.173) * [-936.090] (-936.563) (-941.026) (-938.241) -- 0:00:15
742500 -- [-935.533] (-941.150) (-938.032) (-935.870) * (-938.592) (-934.827) [-938.498] (-940.097) -- 0:00:15
743000 -- (-935.025) [-937.754] (-936.932) (-940.217) * (-942.023) (-935.544) [-935.663] (-941.115) -- 0:00:15
743500 -- [-935.273] (-937.589) (-938.050) (-938.805) * (-936.040) [-936.662] (-937.936) (-936.647) -- 0:00:15
744000 -- (-935.705) (-935.693) [-937.636] (-938.257) * (-935.817) [-937.467] (-938.043) (-935.324) -- 0:00:15
744500 -- (-936.210) (-937.208) (-938.451) [-941.862] * [-935.643] (-935.985) (-936.677) (-936.040) -- 0:00:15
745000 -- [-935.432] (-938.517) (-939.253) (-938.135) * [-934.870] (-935.872) (-940.264) (-935.737) -- 0:00:15
Average standard deviation of split frequencies: 0.009795
745500 -- (-935.999) [-939.492] (-936.950) (-936.806) * [-935.172] (-936.613) (-940.634) (-939.531) -- 0:00:15
746000 -- (-938.151) [-937.353] (-936.283) (-938.299) * [-935.233] (-938.981) (-939.506) (-937.616) -- 0:00:15
746500 -- (-936.258) (-937.285) [-937.664] (-936.464) * (-937.476) (-937.515) [-938.205] (-938.413) -- 0:00:15
747000 -- (-936.331) [-938.377] (-934.982) (-937.775) * [-937.723] (-941.287) (-937.792) (-938.381) -- 0:00:15
747500 -- (-936.511) [-936.070] (-938.491) (-934.881) * (-940.186) [-942.501] (-940.652) (-935.738) -- 0:00:15
748000 -- (-935.506) (-936.867) [-937.793] (-938.609) * (-935.895) [-935.590] (-938.984) (-936.198) -- 0:00:15
748500 -- (-944.956) (-945.044) (-937.939) [-935.374] * (-935.045) (-935.429) (-939.537) [-935.244] -- 0:00:15
749000 -- (-943.767) [-936.355] (-942.181) (-937.262) * (-936.978) [-935.809] (-935.618) (-936.799) -- 0:00:15
749500 -- [-936.028] (-936.774) (-936.350) (-936.182) * (-937.498) (-935.190) [-937.270] (-934.822) -- 0:00:15
750000 -- (-935.736) [-937.268] (-936.259) (-937.229) * [-937.862] (-937.924) (-935.282) (-938.006) -- 0:00:15
Average standard deviation of split frequencies: 0.009494
750500 -- (-937.556) (-935.986) [-936.784] (-936.504) * (-937.432) (-936.723) [-936.247] (-938.608) -- 0:00:14
751000 -- (-938.950) [-936.962] (-936.227) (-939.340) * (-936.474) [-936.664] (-939.170) (-940.584) -- 0:00:14
751500 -- (-936.540) [-938.002] (-936.525) (-935.841) * (-936.620) (-937.887) (-934.794) [-935.941] -- 0:00:14
752000 -- (-935.967) [-937.632] (-937.082) (-935.227) * (-937.090) (-935.537) (-935.880) [-936.105] -- 0:00:14
752500 -- (-937.874) (-939.258) [-937.165] (-944.873) * (-935.699) [-942.029] (-939.468) (-936.948) -- 0:00:15
753000 -- (-938.869) (-943.354) [-939.722] (-936.936) * (-938.426) (-947.355) (-935.807) [-938.984] -- 0:00:15
753500 -- (-936.113) (-937.093) [-936.605] (-937.374) * (-937.701) (-937.275) [-940.457] (-936.647) -- 0:00:15
754000 -- [-937.165] (-937.233) (-937.134) (-936.608) * (-942.282) (-936.277) (-937.437) [-936.414] -- 0:00:15
754500 -- [-936.023] (-934.639) (-935.232) (-935.818) * (-938.802) (-936.436) (-938.799) [-936.129] -- 0:00:14
755000 -- [-935.941] (-935.938) (-938.779) (-937.409) * [-936.438] (-939.031) (-938.285) (-936.271) -- 0:00:14
Average standard deviation of split frequencies: 0.009610
755500 -- (-936.164) (-935.628) (-938.567) [-937.327] * [-937.823] (-935.864) (-939.661) (-935.338) -- 0:00:14
756000 -- (-936.884) [-936.407] (-936.073) (-937.065) * (-935.819) (-935.283) (-938.608) [-938.429] -- 0:00:14
756500 -- (-935.946) [-936.120] (-938.775) (-937.127) * [-935.835] (-937.561) (-936.948) (-937.113) -- 0:00:14
757000 -- (-936.644) [-939.324] (-937.157) (-934.724) * (-935.439) (-942.514) [-935.762] (-936.350) -- 0:00:14
757500 -- (-936.977) (-935.325) [-937.435] (-936.641) * [-934.582] (-943.509) (-936.885) (-936.923) -- 0:00:14
758000 -- [-936.013] (-935.006) (-935.498) (-938.173) * [-934.669] (-945.453) (-937.411) (-934.776) -- 0:00:14
758500 -- [-936.380] (-936.230) (-935.579) (-936.664) * [-935.878] (-936.285) (-938.283) (-936.007) -- 0:00:14
759000 -- (-937.113) [-940.717] (-943.801) (-936.605) * (-939.932) (-935.304) [-937.382] (-937.059) -- 0:00:14
759500 -- [-938.035] (-939.613) (-942.778) (-938.302) * (-937.893) [-935.468] (-936.462) (-937.066) -- 0:00:14
760000 -- (-938.732) (-936.007) (-936.601) [-937.612] * (-935.543) (-937.046) (-936.767) [-935.752] -- 0:00:14
Average standard deviation of split frequencies: 0.009877
760500 -- (-935.498) (-935.571) [-936.622] (-936.377) * (-936.324) [-936.779] (-936.087) (-935.542) -- 0:00:14
761000 -- (-935.690) [-938.865] (-936.529) (-937.401) * [-935.129] (-935.802) (-937.920) (-940.986) -- 0:00:14
761500 -- (-936.350) (-934.786) (-937.745) [-936.000] * [-935.103] (-935.802) (-938.376) (-946.330) -- 0:00:14
762000 -- [-935.851] (-938.495) (-936.205) (-938.574) * [-935.011] (-937.576) (-936.796) (-938.783) -- 0:00:14
762500 -- (-935.851) [-936.768] (-937.144) (-936.134) * (-935.011) (-937.680) [-938.830] (-938.499) -- 0:00:14
763000 -- (-939.071) [-935.661] (-935.319) (-939.295) * (-936.762) (-936.731) [-937.238] (-936.177) -- 0:00:14
763500 -- (-941.790) (-936.087) (-940.758) [-934.972] * (-938.263) [-935.040] (-938.789) (-938.746) -- 0:00:14
764000 -- (-934.879) (-935.514) (-939.616) [-936.289] * (-935.657) [-935.919] (-936.327) (-939.619) -- 0:00:14
764500 -- (-934.748) [-937.218] (-937.447) (-939.469) * (-936.780) (-937.124) (-943.192) [-935.083] -- 0:00:14
765000 -- (-938.855) [-937.849] (-940.944) (-936.455) * (-936.638) [-938.337] (-937.526) (-934.712) -- 0:00:14
Average standard deviation of split frequencies: 0.009616
765500 -- (-936.463) [-936.258] (-936.561) (-936.321) * (-936.839) [-936.995] (-936.374) (-934.711) -- 0:00:14
766000 -- (-935.341) (-936.546) [-938.061] (-938.307) * [-940.438] (-937.866) (-934.890) (-935.614) -- 0:00:14
766500 -- [-935.337] (-936.957) (-939.377) (-939.467) * (-935.075) (-936.708) (-936.135) [-935.829] -- 0:00:14
767000 -- (-941.199) [-936.895] (-938.819) (-937.859) * (-935.881) (-937.864) (-937.818) [-938.386] -- 0:00:13
767500 -- (-940.563) [-938.838] (-939.061) (-935.153) * [-936.535] (-934.669) (-936.648) (-937.589) -- 0:00:13
768000 -- (-941.698) [-935.252] (-936.921) (-940.557) * [-937.172] (-937.907) (-935.892) (-935.076) -- 0:00:13
768500 -- (-944.540) [-936.203] (-936.210) (-940.779) * (-941.850) (-938.595) (-940.573) [-938.839] -- 0:00:13
769000 -- (-938.247) [-939.817] (-938.052) (-935.600) * (-940.554) (-937.009) (-936.474) [-935.994] -- 0:00:13
769500 -- (-936.818) (-941.331) (-938.377) [-936.443] * (-940.883) (-937.653) (-938.448) [-936.243] -- 0:00:14
770000 -- (-935.116) [-938.974] (-937.715) (-936.417) * (-936.751) (-938.433) [-936.258] (-936.117) -- 0:00:14
Average standard deviation of split frequencies: 0.009825
770500 -- (-937.962) [-937.643] (-935.740) (-936.111) * [-937.433] (-940.749) (-938.953) (-937.463) -- 0:00:13
771000 -- (-936.185) (-937.013) (-935.800) [-935.767] * [-936.289] (-939.538) (-935.024) (-938.239) -- 0:00:13
771500 -- [-937.499] (-936.870) (-935.872) (-936.512) * (-937.556) (-938.921) [-937.590] (-939.223) -- 0:00:13
772000 -- (-936.116) (-936.203) [-936.550] (-936.176) * (-936.826) (-941.363) (-935.849) [-937.544] -- 0:00:13
772500 -- (-937.408) [-937.276] (-935.979) (-938.196) * (-936.965) (-936.864) [-936.115] (-938.716) -- 0:00:13
773000 -- (-945.035) (-937.085) (-937.048) [-935.395] * (-939.207) (-942.689) (-935.760) [-935.250] -- 0:00:13
773500 -- (-936.686) [-937.813] (-937.998) (-940.633) * [-938.330] (-938.000) (-934.678) (-938.303) -- 0:00:13
774000 -- [-940.723] (-937.897) (-937.993) (-934.897) * [-940.046] (-938.653) (-934.758) (-937.806) -- 0:00:13
774500 -- (-940.690) (-935.055) [-936.720] (-935.965) * (-935.927) (-937.354) (-934.843) [-936.438] -- 0:00:13
775000 -- [-937.898] (-937.724) (-938.939) (-940.755) * (-935.181) (-937.778) [-936.191] (-937.694) -- 0:00:13
Average standard deviation of split frequencies: 0.009682
775500 -- (-935.800) (-938.767) (-939.961) [-940.887] * (-939.747) (-938.484) (-938.280) [-936.203] -- 0:00:13
776000 -- (-938.089) (-937.071) [-938.649] (-940.670) * (-937.217) (-937.439) [-936.501] (-936.061) -- 0:00:13
776500 -- [-938.113] (-935.639) (-935.847) (-937.763) * (-935.885) (-940.878) (-937.623) [-938.062] -- 0:00:13
777000 -- [-939.433] (-937.791) (-936.766) (-937.426) * (-937.724) (-935.303) [-936.197] (-937.927) -- 0:00:13
777500 -- [-938.315] (-937.660) (-937.640) (-935.767) * [-935.050] (-938.398) (-937.027) (-936.562) -- 0:00:13
778000 -- [-937.156] (-940.274) (-936.075) (-935.655) * (-938.214) [-936.813] (-935.356) (-941.119) -- 0:00:13
778500 -- (-941.430) [-938.073] (-942.171) (-937.067) * (-936.508) (-936.702) (-938.183) [-939.478] -- 0:00:13
779000 -- [-935.399] (-936.652) (-939.685) (-936.516) * (-937.405) [-935.650] (-936.069) (-941.291) -- 0:00:13
779500 -- (-937.594) (-936.371) (-935.668) [-938.368] * (-936.676) (-935.800) (-937.907) [-937.061] -- 0:00:13
780000 -- (-938.363) (-936.777) [-937.746] (-935.739) * (-938.493) (-935.998) [-936.348] (-936.334) -- 0:00:13
Average standard deviation of split frequencies: 0.009548
780500 -- [-938.682] (-936.591) (-934.986) (-936.680) * (-940.457) (-934.681) (-938.283) [-939.290] -- 0:00:13
781000 -- [-938.611] (-938.338) (-935.819) (-941.093) * (-938.888) (-936.657) (-938.375) [-935.467] -- 0:00:13
781500 -- [-936.480] (-939.967) (-935.633) (-937.248) * [-935.816] (-935.894) (-937.909) (-935.629) -- 0:00:13
782000 -- (-949.017) (-935.300) (-937.367) [-937.768] * (-935.474) (-940.116) [-938.668] (-936.320) -- 0:00:13
782500 -- [-940.381] (-939.143) (-937.089) (-935.571) * (-936.394) (-937.321) [-936.651] (-936.589) -- 0:00:13
783000 -- (-937.567) [-938.317] (-937.175) (-937.178) * [-935.482] (-936.138) (-936.375) (-935.549) -- 0:00:13
783500 -- [-939.574] (-940.583) (-936.811) (-935.942) * (-941.756) (-935.584) (-939.725) [-935.629] -- 0:00:12
784000 -- (-937.373) [-940.989] (-936.918) (-935.975) * (-941.542) (-936.045) [-941.680] (-936.299) -- 0:00:12
784500 -- [-935.674] (-935.176) (-938.874) (-941.735) * [-943.114] (-936.427) (-944.402) (-935.464) -- 0:00:12
785000 -- (-936.137) [-935.270] (-938.239) (-939.811) * (-941.291) (-939.527) (-939.453) [-935.734] -- 0:00:12
Average standard deviation of split frequencies: 0.009521
785500 -- (-936.708) [-935.126] (-936.430) (-938.342) * (-938.310) (-936.550) (-939.690) [-936.679] -- 0:00:12
786000 -- (-936.761) [-935.824] (-938.676) (-936.861) * (-936.355) (-936.478) [-939.898] (-936.523) -- 0:00:13
786500 -- (-935.808) (-937.548) [-937.659] (-937.534) * (-936.750) (-939.107) (-938.693) [-937.614] -- 0:00:13
787000 -- (-935.790) (-941.917) [-935.800] (-935.472) * (-935.750) [-938.231] (-937.792) (-935.863) -- 0:00:12
787500 -- (-935.809) (-936.143) [-937.327] (-936.050) * [-942.819] (-936.889) (-939.856) (-941.198) -- 0:00:12
788000 -- (-939.734) (-936.668) [-936.646] (-937.553) * (-937.999) (-939.135) (-936.283) [-936.164] -- 0:00:12
788500 -- (-935.345) (-936.587) (-936.562) [-939.509] * (-937.462) (-937.875) [-937.278] (-935.509) -- 0:00:12
789000 -- [-935.512] (-934.936) (-936.610) (-936.018) * (-936.602) (-936.182) (-937.324) [-936.083] -- 0:00:12
789500 -- (-936.789) (-937.912) [-935.694] (-938.270) * (-937.841) (-936.166) [-936.852] (-936.478) -- 0:00:12
790000 -- (-937.602) [-936.492] (-936.439) (-936.719) * (-940.104) [-939.162] (-935.618) (-935.230) -- 0:00:12
Average standard deviation of split frequencies: 0.009428
790500 -- [-935.631] (-938.650) (-936.196) (-939.472) * (-936.699) (-936.464) (-936.992) [-935.495] -- 0:00:12
791000 -- (-938.549) (-937.425) [-940.859] (-937.467) * (-937.471) (-935.490) (-936.162) [-936.677] -- 0:00:12
791500 -- (-941.084) [-938.849] (-937.300) (-939.928) * (-936.826) (-936.646) (-943.371) [-936.034] -- 0:00:12
792000 -- (-941.551) (-936.882) [-936.839] (-938.906) * (-941.601) (-935.748) [-938.556] (-937.634) -- 0:00:12
792500 -- (-941.992) (-936.484) [-936.988] (-937.274) * [-936.347] (-936.557) (-940.660) (-937.526) -- 0:00:12
793000 -- (-935.686) (-938.975) (-938.669) [-935.692] * (-937.841) [-936.593] (-936.545) (-942.481) -- 0:00:12
793500 -- (-939.642) [-938.059] (-939.295) (-936.001) * (-936.695) (-938.491) [-938.579] (-936.879) -- 0:00:12
794000 -- (-937.667) (-936.317) [-936.644] (-935.947) * [-937.765] (-936.189) (-935.536) (-939.015) -- 0:00:12
794500 -- (-935.291) [-936.688] (-937.972) (-939.773) * (-936.542) [-936.093] (-939.588) (-944.172) -- 0:00:12
795000 -- (-935.248) [-935.137] (-938.337) (-937.145) * [-936.929] (-938.019) (-937.016) (-937.374) -- 0:00:12
Average standard deviation of split frequencies: 0.008994
795500 -- [-937.829] (-935.603) (-936.096) (-935.746) * (-937.213) (-935.921) (-937.862) [-936.342] -- 0:00:12
796000 -- (-938.234) (-937.909) [-936.629] (-938.344) * (-937.510) (-943.203) [-937.812] (-935.510) -- 0:00:12
796500 -- (-941.336) [-936.910] (-939.939) (-936.636) * (-937.032) [-938.210] (-936.069) (-937.377) -- 0:00:12
797000 -- (-941.674) (-939.838) (-935.966) [-938.511] * [-936.054] (-937.052) (-937.056) (-935.815) -- 0:00:12
797500 -- (-935.858) [-939.989] (-936.767) (-938.033) * [-935.381] (-936.375) (-940.549) (-935.253) -- 0:00:12
798000 -- (-936.444) (-935.892) [-937.233] (-937.338) * (-936.361) (-936.673) [-935.846] (-935.540) -- 0:00:12
798500 -- [-935.105] (-937.185) (-938.459) (-938.158) * (-937.264) [-938.126] (-935.527) (-935.524) -- 0:00:12
799000 -- (-935.291) [-936.538] (-936.397) (-937.843) * [-935.283] (-940.273) (-935.095) (-935.930) -- 0:00:12
799500 -- (-935.363) (-939.901) (-940.214) [-940.496] * [-936.975] (-937.141) (-938.368) (-935.574) -- 0:00:12
800000 -- (-936.140) [-936.894] (-936.719) (-935.265) * [-938.964] (-936.093) (-937.461) (-936.393) -- 0:00:12
Average standard deviation of split frequencies: 0.008611
800500 -- (-938.965) (-937.155) (-940.594) [-937.033] * (-937.244) (-935.144) (-938.626) [-936.350] -- 0:00:11
801000 -- [-936.216] (-937.904) (-936.147) (-940.089) * (-937.352) (-936.328) (-937.563) [-935.401] -- 0:00:11
801500 -- (-935.085) (-937.105) [-935.490] (-940.445) * [-938.082] (-935.196) (-937.616) (-935.565) -- 0:00:11
802000 -- [-937.374] (-935.888) (-936.825) (-941.518) * (-935.734) (-936.804) (-935.271) [-938.172] -- 0:00:11
802500 -- (-935.898) [-940.081] (-935.175) (-941.863) * (-937.941) (-939.351) [-935.488] (-939.366) -- 0:00:12
803000 -- (-937.502) (-934.876) (-937.832) [-936.134] * [-937.054] (-936.814) (-935.095) (-939.096) -- 0:00:12
803500 -- (-938.862) (-936.752) [-935.432] (-938.106) * (-935.065) [-937.571] (-937.767) (-935.907) -- 0:00:11
804000 -- [-936.010] (-939.031) (-935.392) (-939.585) * (-937.763) (-936.513) [-940.787] (-934.898) -- 0:00:11
804500 -- [-936.455] (-935.239) (-936.954) (-938.913) * (-937.500) [-935.844] (-937.703) (-938.933) -- 0:00:11
805000 -- (-938.036) (-938.828) (-935.189) [-936.558] * (-937.218) (-938.663) [-936.223] (-937.728) -- 0:00:11
Average standard deviation of split frequencies: 0.008919
805500 -- (-940.539) [-936.069] (-935.055) (-941.718) * (-938.049) (-935.255) (-935.129) [-938.004] -- 0:00:11
806000 -- [-941.727] (-936.819) (-937.036) (-943.845) * (-938.107) [-942.142] (-939.186) (-938.237) -- 0:00:11
806500 -- [-934.626] (-938.749) (-937.428) (-938.105) * (-938.342) [-938.495] (-937.291) (-936.221) -- 0:00:11
807000 -- (-939.428) [-936.629] (-936.740) (-939.864) * (-934.862) (-937.327) (-935.296) [-937.658] -- 0:00:11
807500 -- (-936.989) [-937.268] (-937.037) (-937.655) * (-938.890) [-936.249] (-938.662) (-936.394) -- 0:00:11
808000 -- (-935.714) [-935.811] (-935.517) (-937.870) * (-937.755) [-936.337] (-938.340) (-941.893) -- 0:00:11
808500 -- [-935.953] (-937.265) (-939.792) (-939.155) * [-939.875] (-941.343) (-938.503) (-936.316) -- 0:00:11
809000 -- (-939.379) (-935.860) (-940.764) [-937.006] * (-937.344) (-935.935) (-936.153) [-936.818] -- 0:00:11
809500 -- [-936.196] (-936.428) (-934.769) (-939.849) * (-938.277) (-937.399) [-936.787] (-938.858) -- 0:00:11
810000 -- (-936.203) [-938.188] (-935.278) (-941.584) * (-944.024) (-938.384) [-940.478] (-936.030) -- 0:00:11
Average standard deviation of split frequencies: 0.008614
810500 -- (-937.656) (-934.924) (-939.251) [-936.323] * [-938.514] (-938.338) (-938.959) (-935.706) -- 0:00:11
811000 -- (-939.316) (-937.815) [-938.151] (-936.984) * (-937.048) (-937.158) [-936.200] (-935.037) -- 0:00:11
811500 -- (-936.186) (-940.065) [-936.073] (-936.174) * (-937.717) [-936.376] (-940.615) (-935.803) -- 0:00:11
812000 -- (-937.676) [-935.483] (-938.451) (-935.637) * (-944.035) (-937.516) (-939.773) [-935.280] -- 0:00:11
812500 -- (-941.806) [-938.247] (-938.188) (-939.693) * (-940.778) [-938.559] (-939.742) (-936.611) -- 0:00:11
813000 -- (-935.070) (-938.092) [-935.066] (-938.457) * [-941.334] (-940.006) (-936.267) (-937.849) -- 0:00:11
813500 -- (-937.666) (-935.437) [-935.571] (-937.335) * (-942.281) (-936.544) [-935.651] (-937.214) -- 0:00:11
814000 -- (-938.868) (-936.711) [-935.120] (-935.008) * (-936.378) (-940.647) [-935.627] (-935.263) -- 0:00:11
814500 -- (-936.942) (-942.502) [-935.688] (-935.214) * (-937.885) [-936.404] (-938.143) (-936.589) -- 0:00:11
815000 -- (-937.360) [-941.098] (-938.266) (-937.109) * (-937.285) (-938.018) [-937.373] (-939.338) -- 0:00:11
Average standard deviation of split frequencies: 0.008088
815500 -- [-936.006] (-939.633) (-936.256) (-938.580) * [-937.006] (-938.088) (-937.311) (-935.628) -- 0:00:11
816000 -- (-935.567) [-938.619] (-938.537) (-937.185) * (-935.543) (-940.806) (-936.942) [-940.770] -- 0:00:11
816500 -- [-936.340] (-938.308) (-937.162) (-935.483) * [-935.844] (-938.233) (-938.725) (-939.375) -- 0:00:11
817000 -- (-937.454) [-935.163] (-935.796) (-935.526) * (-935.745) (-936.655) (-936.619) [-935.701] -- 0:00:10
817500 -- (-936.908) (-935.150) [-935.653] (-936.457) * [-938.044] (-937.508) (-936.525) (-941.533) -- 0:00:10
818000 -- (-936.103) (-936.263) [-935.287] (-939.507) * (-936.019) (-936.847) [-939.188] (-942.484) -- 0:00:10
818500 -- (-936.156) (-935.618) [-935.447] (-936.307) * [-936.139] (-935.829) (-937.690) (-935.054) -- 0:00:10
819000 -- (-936.275) [-935.645] (-936.057) (-936.986) * [-937.537] (-936.240) (-935.393) (-937.441) -- 0:00:11
819500 -- (-947.848) (-938.096) (-937.289) [-939.477] * (-937.514) (-935.559) (-937.641) [-935.586] -- 0:00:11
820000 -- (-940.384) [-939.415] (-936.685) (-938.133) * (-937.718) (-939.975) (-936.601) [-934.707] -- 0:00:10
Average standard deviation of split frequencies: 0.007898
820500 -- (-940.178) [-934.909] (-936.831) (-935.173) * (-935.623) [-937.479] (-940.655) (-937.693) -- 0:00:10
821000 -- (-939.776) (-936.662) [-937.317] (-938.705) * (-937.215) (-935.772) [-939.001] (-935.751) -- 0:00:10
821500 -- (-937.863) (-936.745) (-935.503) [-936.701] * (-937.989) (-937.640) (-939.361) [-935.783] -- 0:00:10
822000 -- (-936.046) [-940.231] (-938.024) (-937.903) * (-937.356) (-935.274) [-936.227] (-938.460) -- 0:00:10
822500 -- (-936.123) [-937.791] (-938.105) (-937.088) * (-936.540) [-935.826] (-935.425) (-938.628) -- 0:00:10
823000 -- [-935.861] (-936.958) (-940.001) (-937.848) * (-935.720) (-935.978) (-938.529) [-936.751] -- 0:00:10
823500 -- (-935.661) (-937.086) (-937.327) [-937.660] * (-935.496) [-935.859] (-937.879) (-938.892) -- 0:00:10
824000 -- (-936.695) [-935.046] (-935.655) (-936.128) * (-938.383) [-936.074] (-936.488) (-939.058) -- 0:00:10
824500 -- (-940.225) [-936.305] (-936.673) (-935.839) * [-939.779] (-935.561) (-935.024) (-937.440) -- 0:00:10
825000 -- [-938.508] (-939.219) (-935.923) (-936.710) * (-937.246) (-936.983) (-939.894) [-935.181] -- 0:00:10
Average standard deviation of split frequencies: 0.007990
825500 -- (-939.091) [-936.761] (-935.611) (-937.490) * (-937.319) (-935.003) (-935.840) [-937.847] -- 0:00:10
826000 -- (-936.862) (-940.559) (-935.185) [-936.997] * (-937.189) [-934.638] (-936.373) (-937.864) -- 0:00:10
826500 -- (-936.730) (-937.679) (-940.409) [-935.478] * (-937.282) (-935.777) [-935.826] (-936.210) -- 0:00:10
827000 -- [-937.760] (-939.307) (-940.228) (-939.436) * (-936.086) (-936.221) (-935.541) [-938.478] -- 0:00:10
827500 -- (-938.662) (-937.065) [-940.833] (-939.474) * [-937.040] (-940.100) (-935.671) (-935.775) -- 0:00:10
828000 -- [-938.660] (-936.667) (-937.016) (-936.519) * (-938.634) [-935.869] (-936.840) (-936.571) -- 0:00:10
828500 -- (-935.603) [-936.938] (-936.739) (-939.833) * (-937.894) (-937.997) [-936.612] (-935.124) -- 0:00:10
829000 -- (-937.653) [-939.585] (-939.113) (-938.751) * (-937.550) (-942.347) (-938.492) [-935.690] -- 0:00:10
829500 -- (-936.640) (-940.388) [-939.215] (-937.498) * (-935.327) (-943.278) [-935.858] (-937.580) -- 0:00:10
830000 -- (-935.858) (-935.105) [-942.882] (-938.697) * [-936.036] (-937.397) (-935.851) (-940.800) -- 0:00:10
Average standard deviation of split frequencies: 0.008406
830500 -- (-937.138) (-934.959) (-942.967) [-936.080] * [-937.343] (-936.723) (-935.600) (-937.426) -- 0:00:10
831000 -- (-940.111) (-935.132) (-940.839) [-939.602] * (-938.705) (-938.366) (-937.251) [-938.189] -- 0:00:10
831500 -- (-938.664) (-937.058) (-936.845) [-936.249] * (-934.841) (-938.358) (-935.465) [-939.816] -- 0:00:10
832000 -- [-938.405] (-938.062) (-935.255) (-937.714) * (-938.169) (-938.329) [-936.564] (-938.556) -- 0:00:10
832500 -- (-936.686) [-935.242] (-936.325) (-936.104) * (-936.190) (-938.339) (-935.856) [-936.841] -- 0:00:10
833000 -- (-936.575) [-936.053] (-936.586) (-936.541) * (-937.910) (-938.594) [-935.420] (-935.438) -- 0:00:10
833500 -- (-940.283) (-937.808) [-936.371] (-936.638) * [-937.480] (-937.687) (-935.689) (-935.798) -- 0:00:09
834000 -- (-940.275) [-935.839] (-935.016) (-938.439) * (-936.870) [-937.434] (-939.542) (-935.514) -- 0:00:09
834500 -- (-936.202) (-935.005) [-935.501] (-936.728) * (-937.351) (-934.884) (-936.300) [-934.749] -- 0:00:09
835000 -- (-939.336) [-934.800] (-937.494) (-934.695) * (-935.743) [-938.689] (-941.444) (-937.128) -- 0:00:09
Average standard deviation of split frequencies: 0.008724
835500 -- (-938.163) (-934.923) (-941.745) [-936.390] * (-938.185) (-935.694) (-938.699) [-935.635] -- 0:00:10
836000 -- (-938.562) [-938.300] (-936.146) (-937.926) * (-939.215) (-935.933) (-938.873) [-935.493] -- 0:00:10
836500 -- (-936.443) (-938.596) [-936.877] (-935.525) * [-936.209] (-937.220) (-935.450) (-934.834) -- 0:00:09
837000 -- (-938.458) (-941.188) (-935.963) [-935.933] * (-938.326) (-937.249) [-938.345] (-936.275) -- 0:00:09
837500 -- [-937.583] (-936.033) (-939.608) (-938.006) * (-936.441) (-936.255) [-937.291] (-935.250) -- 0:00:09
838000 -- (-939.724) [-935.574] (-937.819) (-939.224) * (-937.456) (-937.728) (-935.643) [-935.261] -- 0:00:09
838500 -- (-936.455) [-936.517] (-937.091) (-937.637) * (-936.305) (-936.297) [-936.154] (-936.305) -- 0:00:09
839000 -- (-940.621) (-937.059) (-936.605) [-936.234] * [-935.564] (-935.470) (-935.906) (-939.624) -- 0:00:09
839500 -- (-935.722) (-940.434) [-937.360] (-936.287) * (-940.103) (-935.398) [-940.892] (-935.935) -- 0:00:09
840000 -- [-939.185] (-943.735) (-936.494) (-936.914) * [-935.881] (-938.224) (-935.589) (-937.315) -- 0:00:09
Average standard deviation of split frequencies: 0.008376
840500 -- [-935.019] (-940.327) (-939.454) (-937.713) * (-937.219) [-936.622] (-936.271) (-936.480) -- 0:00:09
841000 -- (-942.173) (-937.315) [-936.745] (-938.045) * (-938.354) (-936.574) [-935.577] (-936.586) -- 0:00:09
841500 -- (-937.473) [-937.646] (-936.622) (-936.555) * (-937.692) [-937.052] (-936.212) (-937.204) -- 0:00:09
842000 -- (-935.899) (-937.820) (-937.356) [-936.423] * (-936.252) (-938.890) [-934.678] (-937.318) -- 0:00:09
842500 -- (-938.779) [-938.033] (-937.703) (-937.730) * (-940.337) (-936.936) [-935.914] (-938.957) -- 0:00:09
843000 -- [-936.644] (-943.429) (-943.220) (-935.227) * (-937.436) (-936.029) (-936.981) [-938.015] -- 0:00:09
843500 -- [-936.677] (-939.213) (-942.428) (-936.036) * [-937.468] (-936.032) (-936.082) (-941.649) -- 0:00:09
844000 -- (-940.265) (-937.240) [-939.272] (-937.360) * [-938.279] (-941.795) (-935.359) (-938.804) -- 0:00:09
844500 -- (-940.574) (-939.465) (-938.418) [-937.298] * (-939.955) (-938.322) (-936.939) [-941.245] -- 0:00:09
845000 -- (-937.809) (-938.617) (-941.633) [-937.824] * (-935.424) [-936.322] (-936.643) (-939.382) -- 0:00:09
Average standard deviation of split frequencies: 0.008149
845500 -- [-935.820] (-936.438) (-935.740) (-938.866) * (-935.616) [-936.086] (-935.865) (-936.654) -- 0:00:09
846000 -- [-935.829] (-940.098) (-936.459) (-934.837) * (-939.487) (-939.448) [-937.114] (-934.924) -- 0:00:09
846500 -- (-936.085) (-935.917) (-936.176) [-935.277] * (-939.183) (-934.792) (-936.485) [-935.970] -- 0:00:09
847000 -- [-936.002] (-935.079) (-935.779) (-936.645) * [-937.307] (-936.194) (-939.259) (-934.625) -- 0:00:09
847500 -- (-937.597) [-936.226] (-936.060) (-938.112) * (-944.291) (-935.745) (-935.391) [-936.183] -- 0:00:09
848000 -- (-937.233) (-935.973) (-938.354) [-936.455] * (-937.901) (-937.625) (-935.328) [-936.720] -- 0:00:09
848500 -- [-938.013] (-938.957) (-936.870) (-936.167) * (-936.424) (-935.264) [-936.068] (-938.644) -- 0:00:09
849000 -- [-935.552] (-938.810) (-941.189) (-938.213) * (-936.833) (-935.913) [-935.993] (-936.186) -- 0:00:09
849500 -- (-935.670) (-936.425) [-937.341] (-935.940) * (-943.389) [-935.423] (-938.286) (-935.790) -- 0:00:09
850000 -- (-936.874) (-938.553) [-936.899] (-938.267) * (-937.821) (-937.271) [-937.323] (-944.615) -- 0:00:09
Average standard deviation of split frequencies: 0.008312
850500 -- (-937.497) (-938.669) [-937.625] (-939.831) * (-936.737) [-936.584] (-936.170) (-936.442) -- 0:00:08
851000 -- (-937.542) (-937.758) [-939.359] (-937.255) * [-936.545] (-938.243) (-935.684) (-937.454) -- 0:00:08
851500 -- (-936.121) (-937.754) (-939.912) [-937.540] * (-937.191) [-938.156] (-937.065) (-942.759) -- 0:00:08
852000 -- [-936.866] (-936.952) (-937.691) (-936.127) * (-936.581) (-941.513) [-937.121] (-938.258) -- 0:00:08
852500 -- [-937.314] (-935.987) (-939.349) (-935.198) * (-935.224) [-935.415] (-936.144) (-937.327) -- 0:00:08
853000 -- [-942.750] (-937.644) (-936.519) (-934.689) * (-935.224) [-935.087] (-935.016) (-939.072) -- 0:00:08
853500 -- (-938.947) (-937.862) [-936.032] (-938.209) * [-935.643] (-936.490) (-938.914) (-936.751) -- 0:00:08
854000 -- (-938.821) [-938.057] (-935.318) (-940.044) * (-940.745) [-936.032] (-940.280) (-936.757) -- 0:00:08
854500 -- (-936.433) (-939.160) (-935.416) [-939.300] * [-937.940] (-935.111) (-936.650) (-945.766) -- 0:00:08
855000 -- (-936.961) (-936.505) (-937.559) [-936.092] * (-935.802) [-937.539] (-935.880) (-939.649) -- 0:00:08
Average standard deviation of split frequencies: 0.007744
855500 -- (-941.204) (-935.997) (-938.684) [-938.061] * (-936.063) (-938.246) (-939.032) [-936.665] -- 0:00:08
856000 -- (-937.247) [-935.011] (-936.460) (-938.738) * (-936.335) [-936.634] (-934.833) (-937.373) -- 0:00:08
856500 -- (-937.084) (-935.957) [-937.474] (-937.030) * [-934.997] (-938.725) (-936.010) (-941.192) -- 0:00:08
857000 -- (-936.378) (-936.330) (-936.973) [-938.951] * (-934.991) (-941.477) (-937.220) [-935.101] -- 0:00:08
857500 -- (-938.638) (-938.239) [-940.227] (-939.101) * (-934.997) (-939.441) (-936.150) [-935.993] -- 0:00:08
858000 -- (-935.990) (-937.802) (-937.359) [-938.726] * (-937.498) (-940.384) [-936.369] (-938.653) -- 0:00:08
858500 -- [-937.431] (-935.519) (-937.516) (-935.718) * (-940.471) [-937.836] (-936.350) (-937.226) -- 0:00:08
859000 -- (-941.502) (-935.963) (-937.687) [-937.865] * (-938.254) [-936.192] (-935.529) (-937.204) -- 0:00:08
859500 -- (-936.439) [-935.022] (-935.346) (-940.046) * (-937.485) [-936.033] (-937.827) (-938.251) -- 0:00:08
860000 -- (-936.741) [-934.754] (-935.142) (-938.898) * (-938.541) [-935.578] (-935.282) (-935.260) -- 0:00:08
Average standard deviation of split frequencies: 0.007702
860500 -- (-940.571) (-935.621) (-935.057) [-938.809] * (-936.862) (-937.238) [-935.551] (-938.174) -- 0:00:08
861000 -- (-937.666) (-937.170) [-935.182] (-936.964) * (-939.988) [-936.343] (-938.357) (-942.440) -- 0:00:08
861500 -- [-935.962] (-938.024) (-935.283) (-938.418) * (-939.592) [-936.273] (-937.241) (-938.062) -- 0:00:08
862000 -- (-936.700) (-940.965) [-937.182] (-938.262) * (-938.511) [-935.509] (-942.347) (-938.968) -- 0:00:08
862500 -- (-937.853) (-942.385) [-935.890] (-935.308) * (-938.204) (-935.764) (-940.132) [-939.154] -- 0:00:08
863000 -- (-940.169) (-939.664) (-938.490) [-937.445] * (-937.709) (-939.806) [-936.374] (-936.723) -- 0:00:08
863500 -- (-939.618) (-936.627) [-940.816] (-935.965) * (-936.820) (-939.011) [-942.086] (-937.038) -- 0:00:08
864000 -- [-934.955] (-937.753) (-934.837) (-938.843) * (-935.170) [-934.966] (-937.336) (-937.087) -- 0:00:08
864500 -- (-936.874) [-937.537] (-937.327) (-938.777) * [-935.371] (-936.303) (-937.461) (-935.786) -- 0:00:08
865000 -- [-937.019] (-935.643) (-934.871) (-938.293) * [-935.663] (-939.802) (-936.618) (-936.751) -- 0:00:08
Average standard deviation of split frequencies: 0.007995
865500 -- (-937.864) [-935.877] (-935.067) (-936.494) * (-938.043) (-936.987) (-937.916) [-935.258] -- 0:00:08
866000 -- (-938.278) (-935.857) (-936.258) [-937.419] * [-938.825] (-938.071) (-941.635) (-937.001) -- 0:00:08
866500 -- (-941.088) (-935.819) (-936.637) [-936.759] * [-937.978] (-939.908) (-939.311) (-937.136) -- 0:00:08
867000 -- (-939.667) [-935.785] (-940.137) (-935.526) * (-938.111) (-939.894) (-941.210) [-937.040] -- 0:00:07
867500 -- [-939.388] (-936.423) (-943.498) (-938.825) * (-937.909) (-938.204) (-937.540) [-936.161] -- 0:00:07
868000 -- (-942.566) (-937.580) (-937.899) [-935.595] * (-935.668) [-939.925] (-936.191) (-939.943) -- 0:00:07
868500 -- (-942.214) (-935.328) (-936.007) [-937.604] * (-935.085) [-936.796] (-935.892) (-937.700) -- 0:00:07
869000 -- (-937.220) (-937.067) (-935.976) [-938.776] * (-934.935) (-936.410) [-936.589] (-936.160) -- 0:00:07
869500 -- (-937.633) (-939.126) [-937.605] (-936.957) * (-938.763) (-941.106) [-935.424] (-936.129) -- 0:00:07
870000 -- [-934.815] (-936.790) (-940.232) (-936.903) * (-936.622) [-938.859] (-934.879) (-938.163) -- 0:00:07
Average standard deviation of split frequencies: 0.007851
870500 -- [-937.683] (-936.356) (-936.394) (-936.857) * [-935.598] (-939.602) (-937.754) (-936.919) -- 0:00:07
871000 -- (-938.514) (-937.975) [-935.071] (-936.238) * (-936.134) (-936.524) (-940.125) [-938.954] -- 0:00:07
871500 -- (-936.006) (-938.198) (-937.811) [-935.336] * [-935.797] (-937.546) (-940.015) (-936.341) -- 0:00:07
872000 -- (-935.918) (-934.987) [-937.710] (-938.265) * [-936.106] (-935.511) (-935.720) (-937.838) -- 0:00:07
872500 -- [-934.983] (-936.847) (-937.652) (-938.440) * (-936.464) (-936.507) [-935.119] (-937.942) -- 0:00:07
873000 -- (-934.980) [-935.741] (-935.913) (-941.098) * (-939.724) (-935.338) [-935.349] (-937.931) -- 0:00:07
873500 -- [-940.050] (-936.473) (-935.300) (-936.126) * [-936.402] (-937.730) (-935.373) (-939.503) -- 0:00:07
874000 -- (-938.143) [-939.161] (-936.840) (-935.241) * (-936.251) (-935.835) [-934.982] (-939.345) -- 0:00:07
874500 -- (-938.039) (-935.720) [-936.695] (-940.561) * (-935.348) [-935.566] (-935.112) (-939.116) -- 0:00:07
875000 -- [-938.417] (-936.597) (-939.595) (-936.966) * (-937.657) (-936.577) [-937.699] (-936.948) -- 0:00:07
Average standard deviation of split frequencies: 0.008135
875500 -- (-937.393) (-937.729) [-936.043] (-940.556) * (-938.368) (-936.699) (-936.133) [-937.689] -- 0:00:07
876000 -- (-936.266) (-937.389) [-935.753] (-935.650) * [-936.198] (-938.534) (-936.655) (-935.625) -- 0:00:07
876500 -- (-936.616) (-936.332) (-937.320) [-938.024] * (-935.255) [-937.236] (-936.040) (-937.823) -- 0:00:07
877000 -- (-935.425) (-936.084) [-935.549] (-937.296) * (-935.425) (-937.555) (-935.239) [-937.961] -- 0:00:07
877500 -- (-937.747) [-937.065] (-937.599) (-940.059) * [-937.233] (-938.691) (-935.955) (-938.663) -- 0:00:07
878000 -- (-936.171) [-937.987] (-937.626) (-937.293) * (-935.933) (-939.453) [-936.637] (-938.291) -- 0:00:07
878500 -- (-937.622) [-938.884] (-937.253) (-936.013) * [-936.184] (-935.261) (-936.376) (-936.211) -- 0:00:07
879000 -- (-934.958) [-938.073] (-938.823) (-940.896) * (-942.074) (-939.114) [-935.766] (-937.584) -- 0:00:07
879500 -- (-937.203) (-940.399) (-938.895) [-936.730] * (-936.416) [-937.247] (-936.405) (-939.431) -- 0:00:07
880000 -- [-940.665] (-937.057) (-935.954) (-935.554) * (-937.753) [-937.062] (-938.358) (-936.790) -- 0:00:07
Average standard deviation of split frequencies: 0.007929
880500 -- (-936.648) (-937.463) (-936.342) [-939.016] * (-938.421) (-937.056) (-939.079) [-937.927] -- 0:00:07
881000 -- (-938.037) (-939.407) (-938.487) [-938.004] * [-936.013] (-939.115) (-935.471) (-935.389) -- 0:00:07
881500 -- (-936.910) (-938.585) (-936.035) [-937.827] * (-938.050) [-936.482] (-938.431) (-941.513) -- 0:00:07
882000 -- [-936.650] (-936.106) (-936.474) (-938.164) * [-936.923] (-936.735) (-935.542) (-938.840) -- 0:00:07
882500 -- (-939.481) (-937.392) [-935.451] (-937.331) * (-939.908) (-937.245) [-935.899] (-936.366) -- 0:00:07
883000 -- (-935.947) (-935.080) (-938.312) [-936.323] * (-935.455) (-936.483) (-935.271) [-937.261] -- 0:00:07
883500 -- (-941.201) [-936.897] (-934.986) (-938.077) * (-934.972) [-935.804] (-936.233) (-936.518) -- 0:00:06
884000 -- (-944.445) (-941.636) (-935.105) [-936.873] * (-937.766) (-937.182) [-936.586] (-936.650) -- 0:00:06
884500 -- (-941.328) (-935.933) (-934.787) [-937.114] * (-936.627) (-935.797) (-935.774) [-935.860] -- 0:00:06
885000 -- [-935.499] (-936.038) (-935.876) (-935.731) * [-937.710] (-937.099) (-935.935) (-940.264) -- 0:00:06
Average standard deviation of split frequencies: 0.008012
885500 -- (-938.114) (-935.440) (-938.217) [-935.422] * (-938.995) (-942.955) (-935.086) [-937.683] -- 0:00:06
886000 -- (-938.384) (-941.268) [-936.425] (-938.406) * (-938.060) (-938.739) (-935.129) [-941.416] -- 0:00:06
886500 -- (-937.062) [-936.786] (-937.147) (-938.715) * (-939.527) (-938.397) (-935.939) [-939.126] -- 0:00:06
887000 -- (-939.330) (-935.550) [-940.565] (-936.854) * (-938.685) (-935.897) [-936.984] (-936.309) -- 0:00:06
887500 -- [-942.376] (-935.880) (-937.594) (-937.494) * (-943.429) [-936.203] (-938.292) (-935.970) -- 0:00:06
888000 -- (-942.191) (-936.863) [-935.910] (-939.004) * (-938.570) [-936.106] (-934.997) (-935.760) -- 0:00:06
888500 -- [-935.527] (-938.750) (-935.221) (-939.172) * (-938.148) (-938.340) [-935.036] (-936.837) -- 0:00:06
889000 -- (-935.505) [-939.896] (-943.375) (-938.160) * (-937.610) [-936.304] (-935.297) (-936.605) -- 0:00:06
889500 -- [-936.841] (-938.083) (-939.510) (-939.031) * (-935.974) (-937.292) [-935.406] (-935.297) -- 0:00:06
890000 -- (-936.790) (-940.071) (-937.327) [-937.424] * (-937.816) (-937.968) (-936.370) [-935.302] -- 0:00:06
Average standard deviation of split frequencies: 0.008188
890500 -- (-939.939) (-937.589) [-935.461] (-937.617) * (-935.569) [-936.699] (-936.425) (-935.203) -- 0:00:06
891000 -- [-935.611] (-939.359) (-935.091) (-937.100) * (-936.142) (-940.778) (-937.735) [-935.196] -- 0:00:06
891500 -- [-939.020] (-937.990) (-944.653) (-936.910) * (-936.063) [-938.161] (-935.231) (-935.386) -- 0:00:06
892000 -- [-935.985] (-938.487) (-942.224) (-935.528) * (-941.380) (-935.109) (-935.814) [-938.149] -- 0:00:06
892500 -- (-938.865) (-943.721) [-941.448] (-936.074) * (-937.316) (-938.903) [-935.684] (-935.693) -- 0:00:06
893000 -- (-935.270) (-941.280) [-935.188] (-937.150) * (-941.265) (-941.408) (-936.090) [-936.087] -- 0:00:06
893500 -- (-937.385) (-939.068) [-937.636] (-936.056) * (-943.316) [-937.931] (-939.688) (-937.250) -- 0:00:06
894000 -- (-935.314) (-947.380) (-935.536) [-936.017] * (-938.621) [-936.046] (-938.227) (-936.153) -- 0:00:06
894500 -- [-937.084] (-937.269) (-936.691) (-937.506) * (-938.315) (-936.809) [-939.148] (-941.922) -- 0:00:06
895000 -- (-937.108) (-937.251) [-936.605] (-938.971) * (-936.837) [-937.853] (-939.343) (-938.419) -- 0:00:06
Average standard deviation of split frequencies: 0.007954
895500 -- (-937.076) [-936.041] (-936.147) (-937.772) * (-936.609) (-935.262) (-937.666) [-936.984] -- 0:00:06
896000 -- (-937.000) (-936.653) [-936.127] (-939.206) * (-937.480) (-935.667) [-935.770] (-936.243) -- 0:00:06
896500 -- [-937.249] (-940.844) (-936.354) (-936.681) * (-935.376) (-937.246) (-943.663) [-936.935] -- 0:00:06
897000 -- (-937.615) (-937.127) [-935.529] (-937.180) * (-935.961) (-936.685) (-937.891) [-938.178] -- 0:00:06
897500 -- [-937.305] (-935.002) (-935.339) (-940.927) * (-937.398) [-936.014] (-937.417) (-936.922) -- 0:00:06
898000 -- (-938.533) (-936.014) [-935.024] (-935.334) * [-936.910] (-938.110) (-937.532) (-936.781) -- 0:00:06
898500 -- [-937.034] (-934.740) (-934.943) (-936.271) * (-935.050) [-939.987] (-938.737) (-938.933) -- 0:00:06
899000 -- [-936.185] (-936.389) (-934.895) (-939.863) * (-936.994) (-941.075) (-936.462) [-940.488] -- 0:00:06
899500 -- (-940.726) (-936.930) [-935.601] (-937.071) * (-938.547) (-935.919) (-936.630) [-938.600] -- 0:00:06
900000 -- (-936.155) (-937.668) (-937.550) [-936.864] * (-940.029) (-938.476) [-936.426] (-938.528) -- 0:00:06
Average standard deviation of split frequencies: 0.008251
900500 -- (-936.828) [-935.243] (-936.010) (-937.634) * (-936.657) [-935.158] (-938.765) (-939.858) -- 0:00:05
901000 -- (-937.848) [-936.369] (-936.115) (-937.488) * (-935.176) (-938.207) [-937.375] (-935.462) -- 0:00:05
901500 -- (-938.444) [-937.218] (-935.338) (-937.948) * (-936.573) (-937.534) (-939.360) [-935.535] -- 0:00:05
902000 -- (-939.257) [-938.094] (-936.633) (-939.009) * (-940.413) (-941.061) [-936.001] (-935.984) -- 0:00:05
902500 -- (-938.965) [-937.680] (-935.873) (-935.529) * (-937.902) (-938.330) (-936.073) [-935.388] -- 0:00:05
903000 -- (-938.024) (-935.912) (-935.502) [-934.803] * (-938.912) (-940.643) (-937.239) [-939.005] -- 0:00:05
903500 -- (-935.771) (-943.476) [-935.116] (-937.997) * (-936.216) [-936.850] (-935.800) (-935.991) -- 0:00:05
904000 -- [-935.870] (-936.345) (-935.864) (-937.583) * (-937.434) (-938.003) (-936.502) [-936.496] -- 0:00:05
904500 -- [-935.299] (-935.470) (-935.167) (-937.298) * [-936.361] (-938.636) (-939.836) (-941.117) -- 0:00:05
905000 -- (-935.870) [-935.686] (-937.757) (-938.907) * (-939.530) [-936.565] (-935.193) (-936.331) -- 0:00:05
Average standard deviation of split frequencies: 0.008019
905500 -- (-936.216) (-936.206) (-938.300) [-936.864] * (-937.166) [-939.029] (-935.428) (-936.322) -- 0:00:05
906000 -- (-935.312) (-938.564) [-935.896] (-938.163) * (-937.648) (-937.787) (-937.322) [-936.133] -- 0:00:05
906500 -- (-937.737) (-935.722) [-935.299] (-938.972) * (-936.247) [-937.245] (-935.282) (-935.918) -- 0:00:05
907000 -- [-936.181] (-935.866) (-935.821) (-934.979) * (-935.574) (-944.965) [-936.061] (-940.764) -- 0:00:05
907500 -- [-937.568] (-941.310) (-936.834) (-936.250) * (-937.888) [-937.762] (-936.955) (-939.053) -- 0:00:05
908000 -- (-939.148) (-935.793) [-938.036] (-942.566) * (-944.937) (-937.940) [-938.482] (-939.600) -- 0:00:05
908500 -- (-937.883) (-937.036) (-942.749) [-939.151] * (-937.838) (-936.762) (-935.682) [-936.848] -- 0:00:05
909000 -- (-936.834) [-936.456] (-941.442) (-939.480) * (-941.341) (-935.377) [-938.146] (-935.560) -- 0:00:05
909500 -- (-935.699) (-936.258) [-934.697] (-935.715) * (-936.671) (-936.246) (-937.530) [-936.552] -- 0:00:05
910000 -- (-936.946) (-937.305) [-935.641] (-936.869) * (-936.859) (-936.003) [-935.692] (-941.692) -- 0:00:05
Average standard deviation of split frequencies: 0.008252
910500 -- (-935.790) (-940.354) [-936.080] (-938.175) * (-938.407) [-939.265] (-936.641) (-941.051) -- 0:00:05
911000 -- (-938.993) (-938.301) (-939.151) [-936.347] * [-937.402] (-935.476) (-938.573) (-940.561) -- 0:00:05
911500 -- (-937.559) (-938.349) [-940.170] (-934.580) * (-937.749) (-935.390) (-937.752) [-938.668] -- 0:00:05
912000 -- (-935.766) [-938.969] (-942.001) (-935.950) * [-936.376] (-937.839) (-938.848) (-937.928) -- 0:00:05
912500 -- (-939.659) (-938.056) (-936.889) [-936.261] * (-935.291) (-939.539) [-935.801] (-935.450) -- 0:00:05
913000 -- (-935.301) (-942.755) [-937.380] (-935.838) * (-937.126) (-935.977) [-935.940] (-935.535) -- 0:00:05
913500 -- (-936.776) (-941.429) (-936.632) [-935.742] * (-938.581) [-937.691] (-935.295) (-936.028) -- 0:00:05
914000 -- (-938.060) (-937.510) (-935.336) [-936.364] * (-938.124) (-937.464) (-936.610) [-935.514] -- 0:00:05
914500 -- (-936.517) (-936.236) (-937.488) [-938.118] * (-935.952) (-935.437) (-935.033) [-936.897] -- 0:00:05
915000 -- (-936.211) [-937.948] (-937.638) (-937.534) * [-936.914] (-936.674) (-938.906) (-937.796) -- 0:00:05
Average standard deviation of split frequencies: 0.008113
915500 -- (-935.994) [-935.423] (-936.937) (-937.018) * [-937.338] (-935.970) (-938.624) (-936.285) -- 0:00:05
916000 -- (-938.416) (-935.929) [-935.281] (-938.587) * [-938.951] (-935.836) (-939.435) (-940.035) -- 0:00:05
916500 -- (-935.685) [-935.115] (-937.245) (-940.066) * (-936.421) (-936.603) (-937.617) [-935.897] -- 0:00:05
917000 -- (-939.498) [-937.203] (-937.082) (-938.818) * (-936.278) (-937.039) [-937.336] (-935.823) -- 0:00:04
917500 -- (-939.351) (-937.676) (-938.384) [-936.198] * (-936.932) (-935.953) (-937.510) [-936.199] -- 0:00:04
918000 -- (-937.498) (-938.094) (-938.100) [-936.758] * [-935.705] (-936.107) (-937.364) (-942.852) -- 0:00:04
918500 -- (-935.994) [-938.962] (-936.918) (-937.290) * [-936.205] (-936.758) (-938.474) (-940.858) -- 0:00:04
919000 -- (-941.479) [-936.154] (-937.419) (-936.541) * (-936.750) (-939.963) (-936.950) [-937.870] -- 0:00:04
919500 -- (-936.131) (-937.506) [-937.518] (-937.575) * [-935.712] (-936.184) (-939.521) (-938.154) -- 0:00:04
920000 -- (-935.718) (-936.157) [-937.460] (-937.442) * (-936.666) [-935.356] (-936.904) (-936.343) -- 0:00:04
Average standard deviation of split frequencies: 0.007951
920500 -- (-943.173) (-936.638) [-936.413] (-937.666) * (-938.803) (-935.555) (-935.489) [-937.347] -- 0:00:04
921000 -- (-936.617) (-938.675) (-936.490) [-936.747] * (-936.633) (-935.856) [-935.849] (-937.207) -- 0:00:04
921500 -- (-937.640) (-937.346) [-936.944] (-935.899) * (-939.610) [-936.879] (-936.509) (-937.007) -- 0:00:04
922000 -- (-937.611) (-939.500) [-936.649] (-938.898) * (-935.575) (-935.978) (-935.867) [-935.765] -- 0:00:04
922500 -- (-938.188) (-941.894) [-936.186] (-937.024) * (-936.491) (-939.572) (-939.129) [-935.639] -- 0:00:04
923000 -- [-938.228] (-938.337) (-939.039) (-934.834) * (-935.935) [-937.535] (-941.606) (-936.876) -- 0:00:04
923500 -- (-935.733) (-940.147) [-936.016] (-935.960) * (-935.792) [-937.697] (-936.150) (-938.629) -- 0:00:04
924000 -- [-936.431] (-940.028) (-938.701) (-941.762) * (-935.847) (-937.965) [-936.236] (-941.166) -- 0:00:04
924500 -- (-937.678) [-939.669] (-936.777) (-936.849) * (-935.651) [-935.609] (-937.588) (-937.849) -- 0:00:04
925000 -- [-941.912] (-939.540) (-936.893) (-940.831) * [-939.135] (-936.336) (-935.578) (-936.644) -- 0:00:04
Average standard deviation of split frequencies: 0.007726
925500 -- (-943.897) (-938.592) [-936.039] (-936.550) * (-939.699) [-937.608] (-938.874) (-935.885) -- 0:00:04
926000 -- (-939.679) (-938.070) [-942.516] (-937.025) * (-938.209) [-935.660] (-936.709) (-936.555) -- 0:00:04
926500 -- (-937.935) [-937.493] (-937.282) (-935.464) * [-935.262] (-935.790) (-936.980) (-937.244) -- 0:00:04
927000 -- (-937.376) [-935.954] (-935.375) (-935.777) * (-935.609) (-935.196) (-936.293) [-938.082] -- 0:00:04
927500 -- [-935.158] (-936.672) (-935.342) (-936.632) * (-937.713) [-935.653] (-936.901) (-939.203) -- 0:00:04
928000 -- (-940.204) [-938.412] (-940.458) (-935.219) * (-936.568) (-935.760) (-943.331) [-938.695] -- 0:00:04
928500 -- (-935.806) (-936.434) (-937.021) [-936.070] * [-934.988] (-935.279) (-939.899) (-936.462) -- 0:00:04
929000 -- (-936.468) (-937.366) (-939.970) [-938.017] * (-937.758) (-937.680) [-935.829] (-937.209) -- 0:00:04
929500 -- (-935.133) (-938.053) (-938.922) [-936.180] * [-936.996] (-937.372) (-935.125) (-939.721) -- 0:00:04
930000 -- (-940.049) (-936.161) [-936.490] (-940.375) * (-942.758) (-936.479) (-936.059) [-937.202] -- 0:00:04
Average standard deviation of split frequencies: 0.007777
930500 -- (-938.207) [-941.976] (-937.710) (-940.876) * (-940.950) (-939.155) (-935.842) [-935.186] -- 0:00:04
931000 -- (-938.788) (-937.415) [-937.209] (-940.388) * (-944.886) (-935.285) (-936.476) [-934.812] -- 0:00:04
931500 -- (-937.875) (-934.903) [-937.472] (-940.111) * (-948.745) (-935.961) (-936.692) [-935.753] -- 0:00:04
932000 -- (-935.773) (-934.906) [-940.508] (-947.229) * (-947.193) [-935.694] (-936.587) (-936.403) -- 0:00:04
932500 -- [-938.999] (-935.890) (-938.662) (-934.894) * (-939.677) (-938.642) [-936.793] (-937.927) -- 0:00:04
933000 -- (-936.959) (-938.822) (-937.656) [-935.678] * (-936.622) [-935.545] (-939.460) (-935.429) -- 0:00:04
933500 -- (-937.520) (-936.985) [-936.782] (-936.226) * (-936.198) (-939.743) [-938.620] (-937.316) -- 0:00:03
934000 -- (-940.636) [-937.130] (-935.327) (-937.877) * [-936.108] (-939.935) (-936.028) (-937.330) -- 0:00:03
934500 -- (-936.196) (-940.102) [-938.777] (-937.412) * [-942.467] (-938.361) (-943.158) (-934.981) -- 0:00:03
935000 -- (-939.686) (-945.601) (-937.507) [-937.878] * (-940.897) (-935.023) [-937.880] (-936.316) -- 0:00:03
Average standard deviation of split frequencies: 0.007429
935500 -- (-938.785) (-944.092) (-936.560) [-940.642] * (-940.610) [-935.810] (-936.968) (-935.302) -- 0:00:03
936000 -- (-938.905) (-938.037) (-938.873) [-935.546] * (-939.715) [-936.914] (-938.969) (-939.266) -- 0:00:03
936500 -- [-936.288] (-938.789) (-934.798) (-936.264) * (-937.844) (-935.719) [-935.742] (-935.889) -- 0:00:03
937000 -- (-939.910) (-937.243) [-935.373] (-937.425) * (-937.307) (-935.814) [-939.789] (-936.344) -- 0:00:03
937500 -- (-937.536) (-936.544) [-935.181] (-940.039) * [-935.763] (-936.158) (-938.371) (-935.984) -- 0:00:03
938000 -- [-939.768] (-937.298) (-935.239) (-939.711) * (-938.271) [-936.500] (-935.817) (-935.763) -- 0:00:03
938500 -- (-937.940) (-935.598) [-934.914] (-940.058) * (-935.950) (-936.203) [-937.070] (-938.768) -- 0:00:03
939000 -- (-939.667) [-939.888] (-938.142) (-939.037) * (-935.609) (-938.477) [-937.110] (-938.382) -- 0:00:03
939500 -- (-935.987) (-940.495) (-936.506) [-939.262] * [-936.956] (-940.698) (-936.621) (-938.687) -- 0:00:03
940000 -- [-935.244] (-937.941) (-937.980) (-935.836) * [-935.206] (-936.968) (-942.371) (-939.122) -- 0:00:03
Average standard deviation of split frequencies: 0.007454
940500 -- (-936.295) (-938.918) [-936.386] (-936.054) * (-935.017) (-935.916) (-935.471) [-936.265] -- 0:00:03
941000 -- (-937.186) [-936.672] (-939.154) (-938.288) * (-937.993) (-935.736) [-934.976] (-935.872) -- 0:00:03
941500 -- (-937.797) (-936.718) [-942.872] (-935.535) * (-939.823) (-935.750) [-936.160] (-935.872) -- 0:00:03
942000 -- [-938.068] (-936.772) (-935.358) (-935.372) * (-937.213) (-936.653) [-934.670] (-936.934) -- 0:00:03
942500 -- (-936.729) [-937.862] (-936.245) (-935.320) * [-936.188] (-937.145) (-937.507) (-935.592) -- 0:00:03
943000 -- [-938.471] (-938.934) (-936.277) (-937.862) * (-937.088) (-936.908) [-936.223] (-936.184) -- 0:00:03
943500 -- (-937.634) (-936.007) (-937.048) [-935.951] * (-935.380) (-936.384) (-935.313) [-939.834] -- 0:00:03
944000 -- (-935.272) (-935.633) [-935.701] (-942.712) * (-936.139) [-935.306] (-936.065) (-937.350) -- 0:00:03
944500 -- (-935.699) (-935.271) [-936.353] (-941.586) * [-936.278] (-935.535) (-938.093) (-936.909) -- 0:00:03
945000 -- (-936.100) [-937.505] (-936.387) (-938.625) * (-935.231) [-935.232] (-936.234) (-936.269) -- 0:00:03
Average standard deviation of split frequencies: 0.007444
945500 -- [-936.330] (-938.286) (-936.668) (-938.244) * (-936.627) [-937.513] (-937.678) (-940.586) -- 0:00:03
946000 -- [-935.374] (-941.460) (-936.231) (-937.632) * (-937.240) [-935.598] (-938.874) (-941.447) -- 0:00:03
946500 -- (-937.173) (-937.679) [-936.263] (-938.162) * (-937.150) [-936.531] (-936.952) (-936.395) -- 0:00:03
947000 -- (-944.894) [-937.746] (-938.505) (-940.413) * (-935.058) (-936.227) [-938.171] (-937.767) -- 0:00:03
947500 -- (-946.957) (-936.485) [-936.475] (-936.869) * (-934.916) (-937.254) [-937.950] (-936.547) -- 0:00:03
948000 -- (-938.714) (-940.161) (-937.557) [-936.673] * (-936.892) [-936.011] (-940.060) (-938.954) -- 0:00:03
948500 -- (-938.338) (-938.421) [-935.262] (-937.854) * [-936.261] (-936.571) (-938.864) (-938.095) -- 0:00:03
949000 -- (-938.735) [-936.141] (-938.856) (-939.624) * (-935.628) (-935.105) (-937.060) [-936.308] -- 0:00:03
949500 -- (-935.571) [-937.085] (-934.808) (-936.366) * (-936.855) (-935.286) (-939.274) [-937.395] -- 0:00:03
950000 -- (-935.049) (-937.727) [-937.751] (-937.610) * (-935.835) [-936.849] (-941.429) (-940.016) -- 0:00:03
Average standard deviation of split frequencies: 0.007438
950500 -- [-937.272] (-942.384) (-936.199) (-936.622) * (-936.858) (-941.308) (-936.986) [-942.997] -- 0:00:02
951000 -- [-941.826] (-939.162) (-936.090) (-939.009) * (-935.958) (-939.169) [-937.041] (-942.568) -- 0:00:02
951500 -- (-937.064) [-937.380] (-934.962) (-935.137) * (-935.152) (-935.577) (-939.412) [-937.775] -- 0:00:02
952000 -- (-936.180) (-937.498) [-935.502] (-936.445) * (-935.959) (-935.600) [-938.709] (-937.762) -- 0:00:02
952500 -- (-939.488) (-938.538) (-936.240) [-936.131] * (-938.068) (-941.183) [-936.178] (-934.862) -- 0:00:02
953000 -- (-938.857) (-938.041) [-935.590] (-940.183) * (-938.228) (-935.338) [-936.541] (-936.315) -- 0:00:02
953500 -- (-935.446) [-937.006] (-935.987) (-937.593) * (-939.114) [-935.082] (-937.382) (-938.065) -- 0:00:02
954000 -- [-936.684] (-938.235) (-936.809) (-939.619) * [-937.120] (-937.589) (-937.126) (-939.418) -- 0:00:02
954500 -- [-935.831] (-937.704) (-935.938) (-938.480) * (-935.785) (-934.941) [-937.931] (-938.187) -- 0:00:02
955000 -- (-935.478) (-937.308) (-937.265) [-936.435] * (-939.104) (-936.078) [-938.938] (-936.113) -- 0:00:02
Average standard deviation of split frequencies: 0.007335
955500 -- (-940.199) (-936.173) (-937.874) [-935.956] * (-938.200) [-936.289] (-935.854) (-936.211) -- 0:00:02
956000 -- (-942.545) (-938.987) [-936.280] (-937.352) * (-937.661) (-938.955) [-935.535] (-939.707) -- 0:00:02
956500 -- (-938.846) [-935.019] (-937.258) (-937.224) * (-936.011) (-935.620) (-936.729) [-937.133] -- 0:00:02
957000 -- (-939.851) (-935.693) [-935.377] (-937.305) * (-938.451) [-935.918] (-937.578) (-939.779) -- 0:00:02
957500 -- [-937.537] (-939.029) (-941.330) (-935.269) * (-938.368) (-939.989) [-937.437] (-937.314) -- 0:00:02
958000 -- (-937.794) (-937.208) (-940.770) [-938.380] * (-934.959) (-937.984) [-937.261] (-935.099) -- 0:00:02
958500 -- (-943.448) (-936.718) [-936.034] (-939.809) * (-936.722) (-938.952) (-940.096) [-936.670] -- 0:00:02
959000 -- [-935.220] (-936.340) (-934.718) (-936.909) * (-936.822) (-940.229) (-940.420) [-935.519] -- 0:00:02
959500 -- [-936.863] (-939.719) (-937.401) (-938.443) * (-935.475) (-936.093) [-934.675] (-936.928) -- 0:00:02
960000 -- [-934.718] (-935.532) (-935.571) (-937.894) * (-936.976) (-938.364) (-936.866) [-935.912] -- 0:00:02
Average standard deviation of split frequencies: 0.007299
960500 -- (-940.573) [-936.573] (-936.354) (-937.589) * (-936.678) (-940.702) [-939.137] (-937.913) -- 0:00:02
961000 -- (-938.982) [-938.758] (-935.222) (-945.902) * (-937.053) [-938.075] (-938.388) (-938.054) -- 0:00:02
961500 -- [-939.813] (-938.641) (-936.077) (-936.815) * (-936.975) (-935.682) [-936.041] (-937.674) -- 0:00:02
962000 -- (-940.214) (-938.888) (-936.733) [-935.567] * [-936.321] (-935.641) (-936.346) (-940.470) -- 0:00:02
962500 -- [-935.987] (-937.836) (-935.604) (-936.358) * [-936.042] (-938.517) (-936.296) (-937.043) -- 0:00:02
963000 -- (-936.408) (-937.821) [-935.618] (-935.144) * (-936.578) (-937.046) (-937.982) [-935.531] -- 0:00:02
963500 -- (-937.858) (-935.632) [-935.175] (-935.641) * (-941.977) (-939.503) [-936.655] (-935.506) -- 0:00:02
964000 -- (-940.925) (-935.734) (-937.714) [-938.504] * (-938.332) (-940.222) [-937.244] (-940.336) -- 0:00:02
964500 -- [-936.243] (-935.639) (-937.767) (-938.752) * (-937.095) [-939.666] (-937.207) (-937.061) -- 0:00:02
965000 -- (-937.779) [-935.460] (-940.121) (-939.456) * (-941.547) (-935.714) [-938.914] (-934.980) -- 0:00:02
Average standard deviation of split frequencies: 0.007259
965500 -- [-935.755] (-937.517) (-935.552) (-936.469) * (-940.228) (-936.901) (-936.121) [-936.473] -- 0:00:02
966000 -- (-935.834) [-936.654] (-935.446) (-937.361) * [-937.654] (-936.407) (-937.640) (-938.258) -- 0:00:02
966500 -- (-935.482) (-939.117) (-936.521) [-938.889] * [-934.786] (-937.054) (-937.600) (-936.546) -- 0:00:02
967000 -- (-934.988) (-936.012) [-935.910] (-937.844) * (-934.835) [-939.684] (-937.561) (-936.926) -- 0:00:01
967500 -- [-935.169] (-935.865) (-937.985) (-937.256) * (-943.606) [-940.127] (-936.364) (-936.899) -- 0:00:01
968000 -- [-936.368] (-935.704) (-938.539) (-935.353) * (-936.924) (-935.753) (-937.235) [-935.394] -- 0:00:01
968500 -- (-936.300) (-938.533) (-935.687) [-935.162] * [-938.211] (-936.569) (-938.269) (-935.460) -- 0:00:01
969000 -- (-936.157) (-936.311) [-936.926] (-936.681) * (-940.952) [-936.523] (-937.947) (-935.221) -- 0:00:01
969500 -- (-940.057) (-939.540) (-937.014) [-935.358] * (-938.230) (-938.273) (-941.174) [-935.657] -- 0:00:01
970000 -- (-935.441) (-935.798) (-935.580) [-936.531] * (-935.351) (-940.092) [-936.086] (-938.636) -- 0:00:01
Average standard deviation of split frequencies: 0.007012
970500 -- (-939.441) (-935.505) [-936.010] (-937.572) * [-936.628] (-938.304) (-935.238) (-936.661) -- 0:00:01
971000 -- (-936.718) [-935.651] (-938.769) (-936.805) * (-935.839) [-940.263] (-938.301) (-938.435) -- 0:00:01
971500 -- [-940.176] (-939.691) (-936.268) (-935.534) * (-936.322) [-936.380] (-935.986) (-935.932) -- 0:00:01
972000 -- (-936.876) (-940.849) (-934.824) [-938.496] * (-943.154) (-936.860) (-935.609) [-937.604] -- 0:00:01
972500 -- [-935.375] (-937.844) (-938.382) (-942.332) * (-936.306) [-937.641] (-935.315) (-942.727) -- 0:00:01
973000 -- [-935.880] (-935.686) (-938.348) (-938.697) * (-936.222) [-942.928] (-935.814) (-936.344) -- 0:00:01
973500 -- (-937.877) (-938.519) (-938.951) [-939.615] * (-937.206) (-938.980) (-940.406) [-940.432] -- 0:00:01
974000 -- (-935.568) [-937.961] (-937.306) (-939.382) * (-937.356) (-935.850) [-937.648] (-937.942) -- 0:00:01
974500 -- [-935.918] (-939.099) (-936.745) (-940.892) * (-937.390) (-935.662) (-934.912) [-936.492] -- 0:00:01
975000 -- (-940.125) (-936.444) [-935.838] (-937.866) * (-935.924) (-936.079) (-935.006) [-944.524] -- 0:00:01
Average standard deviation of split frequencies: 0.006847
975500 -- (-938.153) [-935.735] (-938.345) (-936.247) * [-935.724] (-935.683) (-936.233) (-937.375) -- 0:00:01
976000 -- (-938.722) (-937.772) (-936.497) [-937.400] * (-936.275) [-935.072] (-936.877) (-939.090) -- 0:00:01
976500 -- (-938.219) (-940.474) [-935.541] (-941.688) * (-935.227) (-936.450) [-937.293] (-936.351) -- 0:00:01
977000 -- (-937.033) (-939.939) (-935.718) [-937.405] * (-935.096) (-936.066) (-935.348) [-934.801] -- 0:00:01
977500 -- (-935.838) (-935.935) [-935.570] (-936.544) * (-936.143) (-938.055) [-938.598] (-936.126) -- 0:00:01
978000 -- (-936.858) (-937.125) (-937.673) [-935.815] * (-934.879) (-938.025) (-936.785) [-934.942] -- 0:00:01
978500 -- (-938.963) (-936.450) [-941.607] (-937.972) * (-938.003) (-937.317) (-936.924) [-935.508] -- 0:00:01
979000 -- (-939.469) (-938.393) (-937.627) [-937.759] * [-937.338] (-937.467) (-935.981) (-941.209) -- 0:00:01
979500 -- (-937.830) [-940.028] (-935.566) (-937.425) * [-934.785] (-937.406) (-942.307) (-935.923) -- 0:00:01
980000 -- (-934.905) (-938.537) [-936.844] (-936.841) * (-935.158) [-935.417] (-949.282) (-937.428) -- 0:00:01
Average standard deviation of split frequencies: 0.006970
980500 -- [-935.428] (-936.778) (-935.347) (-937.576) * (-935.997) [-935.472] (-937.145) (-938.750) -- 0:00:01
981000 -- (-934.835) [-935.691] (-938.010) (-936.438) * (-935.631) (-935.343) (-939.886) [-935.445] -- 0:00:01
981500 -- (-935.532) [-935.905] (-936.952) (-935.683) * (-938.583) [-939.738] (-939.248) (-935.311) -- 0:00:01
982000 -- [-934.522] (-941.454) (-935.069) (-937.207) * (-939.331) [-936.659] (-937.455) (-934.798) -- 0:00:01
982500 -- (-935.925) (-940.934) (-935.260) [-936.577] * (-937.284) (-935.518) [-937.860] (-940.211) -- 0:00:01
983000 -- (-937.502) [-936.501] (-938.240) (-938.545) * (-937.044) (-934.911) (-937.211) [-936.647] -- 0:00:01
983500 -- (-936.122) (-934.981) [-938.927] (-936.647) * (-936.107) (-935.682) (-935.616) [-936.370] -- 0:00:00
984000 -- (-936.361) (-935.219) [-938.033] (-935.116) * [-937.391] (-938.439) (-936.651) (-936.007) -- 0:00:00
984500 -- (-936.331) (-939.341) (-938.093) [-937.102] * [-937.849] (-941.040) (-938.098) (-938.463) -- 0:00:00
985000 -- (-938.895) (-937.836) (-936.824) [-936.391] * (-939.700) (-935.789) (-936.308) [-936.849] -- 0:00:00
Average standard deviation of split frequencies: 0.007112
985500 -- (-937.238) (-935.853) (-936.028) [-936.309] * [-937.771] (-935.984) (-936.121) (-935.552) -- 0:00:00
986000 -- [-936.253] (-937.010) (-940.007) (-934.907) * (-939.314) [-937.933] (-936.791) (-936.260) -- 0:00:00
986500 -- (-938.825) (-938.985) [-935.927] (-937.810) * (-935.889) (-936.950) (-935.445) [-936.023] -- 0:00:00
987000 -- (-938.460) (-937.205) [-935.665] (-940.678) * [-936.928] (-936.101) (-937.398) (-937.284) -- 0:00:00
987500 -- [-939.227] (-937.337) (-938.280) (-938.325) * (-942.952) (-938.888) (-936.257) [-937.288] -- 0:00:00
988000 -- (-940.216) (-936.041) [-938.540] (-935.923) * [-941.560] (-938.701) (-936.992) (-939.918) -- 0:00:00
988500 -- (-939.153) (-940.442) [-938.753] (-935.571) * (-938.228) [-939.044] (-936.376) (-939.592) -- 0:00:00
989000 -- (-935.182) (-937.036) (-935.394) [-935.906] * (-937.331) (-939.916) [-936.852] (-943.571) -- 0:00:00
989500 -- (-934.784) [-938.364] (-937.876) (-936.465) * (-939.225) [-935.688] (-936.977) (-935.685) -- 0:00:00
990000 -- [-936.441] (-936.614) (-941.602) (-936.546) * (-936.664) (-935.849) (-938.321) [-936.910] -- 0:00:00
Average standard deviation of split frequencies: 0.007048
990500 -- [-934.959] (-942.403) (-935.855) (-937.211) * (-941.751) (-936.217) [-937.310] (-938.659) -- 0:00:00
991000 -- (-935.999) (-937.854) [-937.367] (-939.820) * (-940.513) (-937.190) [-939.392] (-937.166) -- 0:00:00
991500 -- [-935.207] (-935.597) (-936.929) (-937.030) * (-938.922) [-940.214] (-937.616) (-936.243) -- 0:00:00
992000 -- (-939.329) (-936.522) (-939.197) [-936.960] * (-937.494) (-940.522) [-935.793] (-943.472) -- 0:00:00
992500 -- (-934.984) (-938.576) (-939.342) [-936.967] * [-937.980] (-938.877) (-936.812) (-939.131) -- 0:00:00
993000 -- (-936.762) [-937.184] (-937.090) (-936.148) * (-935.221) (-937.669) (-935.221) [-936.776] -- 0:00:00
993500 -- (-938.858) (-936.179) [-937.066] (-937.375) * (-937.294) [-936.321] (-935.027) (-936.460) -- 0:00:00
994000 -- [-936.849] (-940.520) (-935.691) (-939.212) * (-936.903) (-941.871) (-935.590) [-938.044] -- 0:00:00
994500 -- (-938.115) [-937.602] (-936.975) (-935.651) * [-936.746] (-940.139) (-937.556) (-936.393) -- 0:00:00
995000 -- (-938.594) [-938.224] (-937.142) (-938.852) * (-939.391) [-936.291] (-940.003) (-935.858) -- 0:00:00
Average standard deviation of split frequencies: 0.007155
995500 -- (-936.739) (-936.595) (-936.057) [-937.740] * [-936.248] (-937.152) (-936.692) (-938.279) -- 0:00:00
996000 -- (-935.326) (-938.720) (-937.293) [-938.170] * [-935.092] (-938.078) (-937.440) (-940.124) -- 0:00:00
996500 -- (-938.193) (-935.400) [-938.908] (-936.496) * (-935.197) (-938.842) (-936.365) [-937.950] -- 0:00:00
997000 -- (-937.274) [-935.014] (-935.691) (-936.803) * [-935.197] (-937.556) (-936.167) (-941.692) -- 0:00:00
997500 -- [-936.159] (-934.517) (-935.521) (-935.995) * (-939.179) (-937.998) [-938.321] (-938.768) -- 0:00:00
998000 -- (-938.783) (-937.574) (-935.627) [-934.760] * [-936.898] (-936.638) (-935.290) (-937.552) -- 0:00:00
998500 -- (-940.818) [-938.647] (-936.958) (-935.860) * (-940.223) [-937.617] (-938.206) (-939.677) -- 0:00:00
999000 -- (-938.187) [-935.387] (-936.883) (-937.764) * [-939.300] (-935.873) (-942.266) (-937.456) -- 0:00:00
999500 -- (-935.652) [-939.736] (-935.830) (-935.633) * (-942.373) [-935.706] (-938.429) (-936.339) -- 0:00:00
1000000 -- (-937.301) (-935.615) (-936.266) [-935.518] * (-938.699) (-937.312) (-939.997) [-935.288] -- 0:00:00
Average standard deviation of split frequencies: 0.006831
Analysis completed in 60 seconds
Analysis used 58.96 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -934.50
Likelihood of best state for "cold" chain of run 2 was -934.50
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.1 % ( 28 %) Dirichlet(Pi{all})
30.2 % ( 29 %) Slider(Pi{all})
78.6 % ( 58 %) Multiplier(Alpha{1,2})
77.7 % ( 48 %) Multiplier(Alpha{3})
21.2 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.4 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.3 % ( 95 %) Nodeslider(V{all})
30.5 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.1 % ( 24 %) Dirichlet(Pi{all})
30.2 % ( 29 %) Slider(Pi{all})
78.7 % ( 46 %) Multiplier(Alpha{1,2})
77.3 % ( 54 %) Multiplier(Alpha{3})
21.0 % ( 22 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 40 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167122 0.83 0.67
3 | 166373 166459 0.84
4 | 166145 167271 166630
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166651 0.82 0.67
3 | 166245 167461 0.84
4 | 167104 165826 166713
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -936.34
| 2 |
| 2 2 2 2 |
| 2 * 1 2 1 1 12 1 |
|1 * 1 2 *1 2 12 2 |
| 22 * 12 11 * 2 1 1 1 |
|2 * 2 1 1 1 2 2 2 2 2 2 |
| 1 2 2 *2 1 22 121 1 1 1 *2 |
| 1 1 1 11* 1 1 2 2 2 2 12 1|
| 2 2 11 2 |
| 2 2 1 1 21 1 2|
| 2 2 2 1 |
| 1 1 1 1 1 |
| 2 2 1 1 2 2 |
| 1 |
| 2 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -937.86
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -936.24 -939.61
2 -936.21 -939.30
--------------------------------------
TOTAL -936.23 -939.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889810 0.086692 0.377000 1.477674 0.852056 1501.00 1501.00 1.000
r(A<->C){all} 0.169106 0.021086 0.000020 0.467647 0.132679 150.26 172.70 1.002
r(A<->G){all} 0.148017 0.016597 0.000053 0.408366 0.109741 228.50 336.54 1.000
r(A<->T){all} 0.173098 0.021337 0.000075 0.465865 0.135925 241.62 293.49 1.000
r(C<->G){all} 0.165762 0.019859 0.000044 0.446801 0.129728 231.27 259.01 1.000
r(C<->T){all} 0.164467 0.018159 0.000128 0.423977 0.133625 277.74 299.68 1.001
r(G<->T){all} 0.179549 0.023153 0.000156 0.479315 0.141236 166.30 207.56 1.003
pi(A){all} 0.197203 0.000242 0.167046 0.226481 0.197280 1194.25 1237.66 1.000
pi(C){all} 0.270558 0.000284 0.237853 0.303235 0.270536 1177.48 1217.22 1.000
pi(G){all} 0.322447 0.000317 0.289098 0.357976 0.321956 1165.43 1220.05 1.000
pi(T){all} 0.209791 0.000235 0.177034 0.237451 0.209804 1293.09 1305.06 1.000
alpha{1,2} 0.417465 0.216165 0.000102 1.357231 0.257643 973.44 1002.40 1.001
alpha{3} 0.467979 0.260066 0.000110 1.494485 0.302526 1355.75 1359.31 1.000
pinvar{all} 0.997693 0.000008 0.992064 0.999999 0.998590 1156.44 1282.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- ...*.*
9 -- .**.**
10 -- ...**.
11 -- ..*.*.
12 -- .*.***
13 -- .***.*
14 -- .*.*..
15 -- .*...*
16 -- ..*..*
17 -- ..**..
18 -- .****.
19 -- .**...
20 -- ....**
21 -- ..****
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 454 0.151233 0.002827 0.149234 0.153231 2
8 451 0.150233 0.003298 0.147901 0.152565 2
9 444 0.147901 0.000000 0.147901 0.147901 2
10 443 0.147568 0.006124 0.143238 0.151899 2
11 442 0.147235 0.003769 0.144570 0.149900 2
12 439 0.146236 0.006124 0.141905 0.150566 2
13 424 0.141239 0.002827 0.139241 0.143238 2
14 423 0.140906 0.001413 0.139907 0.141905 2
15 421 0.140240 0.015546 0.129247 0.151233 2
16 418 0.139241 0.005653 0.135243 0.143238 2
17 417 0.138907 0.015546 0.127915 0.149900 2
18 416 0.138574 0.019786 0.124584 0.152565 2
19 406 0.135243 0.000942 0.134577 0.135909 2
20 402 0.133911 0.004711 0.130580 0.137242 2
21 390 0.129913 0.015075 0.119254 0.140573 2
22 304 0.101266 0.005653 0.097268 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099232 0.008989 0.000026 0.284865 0.073394 1.000 2
length{all}[2] 0.103239 0.010895 0.000017 0.310306 0.070749 1.000 2
length{all}[3] 0.098744 0.009905 0.000049 0.297358 0.067725 1.000 2
length{all}[4] 0.097790 0.009782 0.000007 0.294091 0.066550 1.000 2
length{all}[5] 0.095945 0.009200 0.000135 0.286335 0.065303 1.000 2
length{all}[6] 0.099978 0.010248 0.000032 0.298457 0.068560 1.001 2
length{all}[7] 0.100610 0.008831 0.000422 0.303557 0.070754 0.998 2
length{all}[8] 0.099371 0.011023 0.000238 0.310749 0.066934 1.002 2
length{all}[9] 0.090751 0.007491 0.000019 0.267343 0.065963 0.999 2
length{all}[10] 0.095715 0.011098 0.000092 0.277146 0.065575 0.999 2
length{all}[11] 0.100253 0.007504 0.000067 0.283979 0.079444 0.999 2
length{all}[12] 0.103906 0.010214 0.000138 0.310324 0.071854 0.999 2
length{all}[13] 0.100693 0.010033 0.000173 0.292559 0.070242 0.998 2
length{all}[14] 0.095112 0.008908 0.000331 0.266749 0.066243 1.003 2
length{all}[15] 0.100475 0.009781 0.000009 0.294684 0.064360 0.998 2
length{all}[16] 0.101669 0.009363 0.000025 0.296389 0.068288 1.007 2
length{all}[17] 0.095102 0.009519 0.000441 0.279554 0.062542 0.999 2
length{all}[18] 0.095071 0.009299 0.000131 0.273784 0.067515 0.998 2
length{all}[19] 0.102623 0.011449 0.000128 0.310603 0.067981 1.000 2
length{all}[20] 0.092054 0.007183 0.000081 0.264315 0.070425 0.999 2
length{all}[21] 0.092621 0.008284 0.000118 0.270247 0.069670 0.998 2
length{all}[22] 0.099844 0.010019 0.000199 0.270000 0.071315 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006831
Maximum standard deviation of split frequencies = 0.019786
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|----------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 684
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 228 / 228 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 228 / 228 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095149 0.065578 0.058040 0.087640 0.039434 0.082051 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -983.963787
Iterating by ming2
Initial: fx= 983.963787
x= 0.09515 0.06558 0.05804 0.08764 0.03943 0.08205 0.30000 1.30000
1 h-m-p 0.0000 0.0002 546.8383 +++ 931.275837 m 0.0002 14 | 1/8
2 h-m-p 0.0016 0.0108 53.9758 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 502.4246 ++ 910.253858 m 0.0001 45 | 2/8
4 h-m-p 0.0009 0.0314 41.8344 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 450.5862 ++ 903.400660 m 0.0000 76 | 3/8
6 h-m-p 0.0004 0.0397 33.4800 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 390.3597 ++ 892.114542 m 0.0001 106 | 4/8
8 h-m-p 0.0009 0.0523 25.4508 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 319.5630 ++ 889.548022 m 0.0000 137 | 5/8
10 h-m-p 0.0003 0.0771 17.3928 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 226.0463 ++ 887.819874 m 0.0000 167 | 6/8
12 h-m-p 0.0793 8.0000 0.0000 ++++ 887.819874 m 8.0000 180 | 6/8
13 h-m-p 1.4620 8.0000 0.0000 ++ 887.819874 m 8.0000 193 | 6/8
14 h-m-p 0.0160 8.0000 0.0424 +++++ 887.819873 m 8.0000 209 | 6/8
15 h-m-p 0.1584 0.7920 0.8111 ------------C 887.819873 0 0.0000 234 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 --Y 887.819873 0 0.0003 249 | 6/8
17 h-m-p 0.0160 8.0000 0.0000 Y 887.819873 0 0.0160 262
Out..
lnL = -887.819873
263 lfun, 263 eigenQcodon, 1578 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099233 0.070921 0.080629 0.060791 0.102938 0.035212 0.635786 0.821704 0.350359
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.449851
np = 9
lnL0 = -985.469078
Iterating by ming2
Initial: fx= 985.469078
x= 0.09923 0.07092 0.08063 0.06079 0.10294 0.03521 0.63579 0.82170 0.35036
1 h-m-p 0.0000 0.0002 517.0751 +++ 940.666659 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0002 553.0841 ++ 912.506705 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0000 18913.9228 ++ 903.412267 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0001 538.9391 ++ 896.641077 m 0.0001 51 | 4/9
5 h-m-p 0.0000 0.0000 121243.7488 ++ 888.579268 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 2781.6680 ++ 887.819804 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 887.819804 m 8.0000 87 | 6/9
8 h-m-p 0.0096 1.2286 0.0813 ++++ 887.819787 m 1.2286 104 | 7/9
9 h-m-p 0.2505 8.0000 0.0908 -----------Y 887.819787 0 0.0000 130 | 7/9
10 h-m-p 0.0160 8.0000 0.0005 +++++ 887.819786 m 8.0000 147 | 7/9
11 h-m-p 0.0126 2.4187 0.3108 -----------C 887.819786 0 0.0000 172 | 7/9
12 h-m-p 0.0160 8.0000 0.0294 -------------.. | 7/9
13 h-m-p 0.0160 8.0000 0.0002 +++++ 887.819786 m 8.0000 214 | 7/9
14 h-m-p 0.0071 2.8464 0.2798 -------------.. | 7/9
15 h-m-p 0.0160 8.0000 0.0002 +++++ 887.819785 m 8.0000 256 | 7/9
16 h-m-p 0.0072 2.8612 0.2790 ------------Y 887.819785 0 0.0000 282 | 7/9
17 h-m-p 0.0160 8.0000 0.0001 +++++ 887.819785 m 8.0000 299 | 7/9
18 h-m-p 0.0022 1.1112 0.6923 ------------.. | 7/9
19 h-m-p 0.0160 8.0000 0.0003 +++++ 887.819784 m 8.0000 340 | 7/9
20 h-m-p 0.0072 2.8783 0.2781 ---------C 887.819784 0 0.0000 363 | 7/9
21 h-m-p 0.0160 8.0000 0.0010 +++++ 887.819783 m 8.0000 380 | 7/9
22 h-m-p 0.0249 2.4968 0.3071 -----------Y 887.819783 0 0.0000 405 | 7/9
23 h-m-p 0.0160 8.0000 0.0001 -----Y 887.819783 0 0.0000 424 | 7/9
24 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9
25 h-m-p 0.0160 8.0000 0.0003 +++++ 887.819782 m 8.0000 466 | 7/9
26 h-m-p 0.0076 2.9540 0.2743 -------------.. | 7/9
27 h-m-p 0.0160 8.0000 0.0003 +++++ 887.819782 m 8.0000 508 | 7/9
28 h-m-p 0.0076 2.9675 0.2737 -------------.. | 7/9
29 h-m-p 0.0160 8.0000 0.0003 +++++ 887.819781 m 8.0000 550 | 7/9
30 h-m-p 0.0077 2.9881 0.2725 ----------Y 887.819781 0 0.0000 574 | 7/9
31 h-m-p 0.0160 8.0000 0.0047 +++++ 887.819771 m 8.0000 591 | 7/9
32 h-m-p 0.1322 2.8466 0.2823 -----------C 887.819771 0 0.0000 616 | 7/9
33 h-m-p 0.0160 8.0000 0.0005 +++++ 887.819770 m 8.0000 633 | 7/9
34 h-m-p 0.0152 3.1517 0.2559 ----------Y 887.819770 0 0.0000 657 | 7/9
35 h-m-p 0.0160 8.0000 0.0001 +++++ 887.819769 m 8.0000 674 | 7/9
36 h-m-p 0.0068 3.3938 0.2552 ----------Y 887.819769 0 0.0000 698 | 7/9
37 h-m-p 0.0160 8.0000 0.0001 -------Y 887.819769 0 0.0000 719 | 7/9
38 h-m-p 0.0160 8.0000 0.0001 ------C 887.819769 0 0.0000 739
Out..
lnL = -887.819769
740 lfun, 2220 eigenQcodon, 8880 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.020782 0.040271 0.105352 0.067050 0.028356 0.073285 0.582184 1.129446 0.365963 0.326929 1.448264
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.176137
np = 11
lnL0 = -959.988933
Iterating by ming2
Initial: fx= 959.988933
x= 0.02078 0.04027 0.10535 0.06705 0.02836 0.07329 0.58218 1.12945 0.36596 0.32693 1.44826
1 h-m-p 0.0000 0.0001 506.7627 ++ 933.991609 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0002 210.1292 ++ 925.557329 m 0.0002 30 | 2/11
3 h-m-p 0.0000 0.0001 625.9184 ++ 915.965317 m 0.0001 44 | 3/11
4 h-m-p 0.0000 0.0002 721.1144 ++ 898.460888 m 0.0002 58 | 4/11
5 h-m-p 0.0000 0.0000 148318.5879 ++ 895.576348 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0000 498718.9902 ++ 892.263259 m 0.0000 86 | 6/11
7 h-m-p 0.0047 0.1558 5.5422 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 220.1041 ++ 887.819826 m 0.0001 124 | 7/11
9 h-m-p 0.2814 8.0000 0.0000 +++ 887.819826 m 8.0000 139 | 7/11
10 h-m-p 0.0160 8.0000 0.0124 +++++ 887.819824 m 8.0000 160 | 7/11
11 h-m-p 0.0496 8.0000 1.9967 -----------C 887.819824 0 0.0000 189 | 7/11
12 h-m-p 0.0160 8.0000 0.0002 +++++ 887.819824 m 8.0000 206 | 7/11
13 h-m-p 0.0160 8.0000 10.7595 ------------Y 887.819824 0 0.0000 236 | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 887.819824 m 8.0000 253 | 7/11
15 h-m-p 0.0015 0.7343 1.2117 +++++ 887.819816 m 0.7343 274 | 8/11
16 h-m-p 1.6000 8.0000 0.4667 C 887.819814 0 1.8833 288 | 8/11
17 h-m-p 1.6000 8.0000 0.0562 Y 887.819814 0 0.8956 305 | 8/11
18 h-m-p 1.6000 8.0000 0.0004 ---------------C 887.819814 0 0.0000 337
Out..
lnL = -887.819814
338 lfun, 1352 eigenQcodon, 6084 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -887.834808 S = -887.816996 -0.006827
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:04
did 20 / 55 patterns 0:05
did 30 / 55 patterns 0:05
did 40 / 55 patterns 0:05
did 50 / 55 patterns 0:05
did 55 / 55 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.107292 0.082566 0.097561 0.054736 0.101110 0.086446 0.526816 0.864312 1.361309
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 12.124705
np = 9
lnL0 = -999.815943
Iterating by ming2
Initial: fx= 999.815943
x= 0.10729 0.08257 0.09756 0.05474 0.10111 0.08645 0.52682 0.86431 1.36131
1 h-m-p 0.0000 0.0003 490.2018 +++ 932.406655 m 0.0003 15 | 1/9
2 h-m-p 0.0015 0.0073 71.7392 ++ 902.048716 m 0.0073 27 | 2/9
3 h-m-p 0.0000 0.0000 15529.8736 ++ 898.887447 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 27398.9603 ++ 891.481671 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 1839.5944 ++ 889.639963 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 2636.4145 ++ 887.819665 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 887.819664 m 8.0000 87 | 6/9
8 h-m-p 0.0160 8.0000 0.1386 -----------Y 887.819664 0 0.0000 113 | 6/9
9 h-m-p 0.0160 8.0000 0.0015 +++++ 887.819659 m 8.0000 131 | 6/9
10 h-m-p 0.0381 8.0000 0.3212 -----------C 887.819659 0 0.0000 157 | 6/9
11 h-m-p 0.0160 8.0000 0.0002 -------------.. | 6/9
12 h-m-p 0.0160 8.0000 0.0005 +++++ 887.819657 m 8.0000 201 | 6/9
13 h-m-p 0.0160 8.0000 0.2478 ------------N 887.819657 0 0.0000 228 | 6/9
14 h-m-p 0.0000 0.0011 153.6188 ++++ 887.819546 m 0.0011 245 | 7/9
15 h-m-p 0.3463 8.0000 0.2169 --------------N 887.819546 0 0.0000 271 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 ----Y 887.819546 0 0.0000 289
Out..
lnL = -887.819546
290 lfun, 3190 eigenQcodon, 17400 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036551 0.052662 0.024176 0.054703 0.011932 0.053131 0.122194 0.900000 0.608184 1.830226 1.348824
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.149206
np = 11
lnL0 = -936.712391
Iterating by ming2
Initial: fx= 936.712391
x= 0.03655 0.05266 0.02418 0.05470 0.01193 0.05313 0.12219 0.90000 0.60818 1.83023 1.34882
1 h-m-p 0.0000 0.0001 487.9001 ++ 922.378835 m 0.0001 16 | 1/11
2 h-m-p 0.0003 0.0014 102.9158 ++ 908.739995 m 0.0014 30 | 2/11
3 h-m-p 0.0000 0.0000 5414.5295 ++ 898.236211 m 0.0000 44 | 3/11
4 h-m-p 0.0008 0.0038 39.2824 ++ 895.598755 m 0.0038 58 | 4/11
5 h-m-p 0.0000 0.0002 699.1668 ++ 893.290928 m 0.0002 72 | 5/11
6 h-m-p 0.0000 0.0001 7279.8901 ++ 891.680856 m 0.0001 86 | 6/11
7 h-m-p 0.0001 0.0003 1276.2499 ++ 887.819793 m 0.0003 100 | 7/11
8 h-m-p 1.6000 8.0000 0.0031 ++ 887.819792 m 8.0000 114 | 7/11
9 h-m-p 0.0080 0.3693 3.0884 +++ 887.819772 m 0.3693 133 | 8/11
10 h-m-p 0.5227 2.6133 0.4946 ++ 887.819750 m 2.6133 147 | 9/11
11 h-m-p 0.1230 0.6151 0.6712 ++ 887.819499 m 0.6151 164 | 10/11
12 h-m-p 0.3682 8.0000 0.6163
QuantileBeta(0.15, 0.00500, 2.62787) = 9.588423e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.35087) = 4.238814e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
+ 887.819499 m 8.0000 181
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.462336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65102) = 3.345425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65058) = 3.345663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
| 10/11
13 h-m-p 1.6000 8.0000 0.7046
QuantileBeta(0.15, 0.00500, 5.52352) = 4.093690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.36898) = 3.505748e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.58034) = 3.384208e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.63319) = 3.355127e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.64640) = 3.347935e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.64970) = 3.346141e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.65052) = 3.345693e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.65073) = 3.345581e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.65078) = 3.345553e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.65079) = 3.345546e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
N 887.819499 0 0.0000 205
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.462337e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65102) = 3.345426e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65058) = 3.345663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345545e-161 2000 rounds
| 10/11
14 h-m-p 0.7500 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345542e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
Y 887.819499 0 0.7500 220
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.462336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65102) = 3.345425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65058) = 3.345663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
| 10/11
15 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345542e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
N 887.819499 0 6.4000 236
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.462335e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65102) = 3.345424e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65058) = 3.345661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
| 10/11
16 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
Y 887.819499 0 1.6000 251
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
Out..
lnL = -887.819499
252 lfun, 3024 eigenQcodon, 16632 P(t)
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -887.880599 S = -887.820453 -0.026730
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:13
did 20 / 55 patterns 0:14
did 30 / 55 patterns 0:14
did 40 / 55 patterns 0:14
did 50 / 55 patterns 0:14
did 55 / 55 patterns 0:14
QuantileBeta(0.15, 0.00500, 6.65080) = 3.345543e-161 2000 rounds
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=228
NC_011896_1_WP_010907921_1_809_MLBR_RS03795 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
NC_002677_1_NP_301597_1_469_mtrA MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
**************************************************
NC_011896_1_WP_010907921_1_809_MLBR_RS03795 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
NC_002677_1_NP_301597_1_469_mtrA DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275 DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
**************************************************
NC_011896_1_WP_010907921_1_809_MLBR_RS03795 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
NC_002677_1_NP_301597_1_469_mtrA DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275 DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE
**************************************************
NC_011896_1_WP_010907921_1_809_MLBR_RS03795 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
NC_002677_1_NP_301597_1_469_mtrA HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275 HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
**************************************************
NC_011896_1_WP_010907921_1_809_MLBR_RS03795 LRAKVEKDPENPTVVLTVRGVGYKAGPP
NC_002677_1_NP_301597_1_469_mtrA LRAKVEKDPENPTVVLTVRGVGYKAGPP
NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955 LRAKVEKDPENPTVVLTVRGVGYKAGPP
NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890 LRAKVEKDPENPTVVLTVRGVGYKAGPP
NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220 LRAKVEKDPENPTVVLTVRGVGYKAGPP
NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275 LRAKVEKDPENPTVVLTVRGVGYKAGPP
****************************
>NC_011896_1_WP_010907921_1_809_MLBR_RS03795 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG >NC_002677_1_NP_301597_1_469_mtrA ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG >NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG >NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG >NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG >NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275 ATGGACATCATGAGGCAAAGGATTTTGGTCGTCGATGACGACGCTTCGCT GGCTGAGATGCTCACTATAGTGCTGCGTGGGGAGGGCTTCGATACCGCGG TCATCGGTGACGGTACTCAGGCCTTGACCGCGGTCCGCGAGCTACGTCCC GACTTGGTGCTACTGGACCTTATGTTGCCTGGTATGAATGGCATCGACGT GTGCAGGGTGTTGCGCGCCGACTCCGGCGTTCCGATTGTGATGCTGACCG CCAAGACCGACACTGTGGACGTGGTGCTGGGCTTAGAGTCGGGTGCTGAT GACTACATCATGAAGCCGTTCAAGCCCAAGGAACTGGTTGCTCGGGTACG GGCGCGGCTACGGCGCAACGACGACGAGCCAGCCGAGATGCTGTCCATTG CCGACGTCGACATTGACGTGCCGGCACATAAGGTCACCCGAAACGGTGAA CACATCTCATTGACACCGTTGGAATTCGACCTGCTGGTAGCGCTTGCACG CAAGCCACGCCAGGTTTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGG GCTATCGTCACCCAGCGGATACCCGCTTGGTTAACGTGCATGTCCAGCGG CTACGGGCCAAGGTCGAGAAAGACCCGGAGAACCCGACCGTGGTGTTGAC CGTTCGAGGAGTGGGATACAAGGCCGGACCCCCG
>NC_011896_1_WP_010907921_1_809_MLBR_RS03795 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR LRAKVEKDPENPTVVLTVRGVGYKAGPP >NC_002677_1_NP_301597_1_469_mtrA MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR LRAKVEKDPENPTVVLTVRGVGYKAGPP >NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR LRAKVEKDPENPTVVLTVRGVGYKAGPP >NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR LRAKVEKDPENPTVVLTVRGVGYKAGPP >NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR LRAKVEKDPENPTVVLTVRGVGYKAGPP >NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275 MDIMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVDIDVPAHKVTRNGE HISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR LRAKVEKDPENPTVVLTVRGVGYKAGPP
#NEXUS
[ID: 9495722900]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907921_1_809_MLBR_RS03795
NC_002677_1_NP_301597_1_469_mtrA
NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955
NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890
NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220
NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907921_1_809_MLBR_RS03795,
2 NC_002677_1_NP_301597_1_469_mtrA,
3 NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955,
4 NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890,
5 NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220,
6 NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07339413,2:0.07074923,3:0.0677253,4:0.06654953,5:0.06530284,6:0.06856026);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07339413,2:0.07074923,3:0.0677253,4:0.06654953,5:0.06530284,6:0.06856026);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -936.24 -939.61
2 -936.21 -939.30
--------------------------------------
TOTAL -936.23 -939.47
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mtrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889810 0.086692 0.377000 1.477674 0.852056 1501.00 1501.00 1.000
r(A<->C){all} 0.169106 0.021086 0.000020 0.467647 0.132679 150.26 172.70 1.002
r(A<->G){all} 0.148017 0.016597 0.000053 0.408366 0.109741 228.50 336.54 1.000
r(A<->T){all} 0.173098 0.021337 0.000075 0.465865 0.135925 241.62 293.49 1.000
r(C<->G){all} 0.165762 0.019859 0.000044 0.446801 0.129728 231.27 259.01 1.000
r(C<->T){all} 0.164467 0.018159 0.000128 0.423977 0.133625 277.74 299.68 1.001
r(G<->T){all} 0.179549 0.023153 0.000156 0.479315 0.141236 166.30 207.56 1.003
pi(A){all} 0.197203 0.000242 0.167046 0.226481 0.197280 1194.25 1237.66 1.000
pi(C){all} 0.270558 0.000284 0.237853 0.303235 0.270536 1177.48 1217.22 1.000
pi(G){all} 0.322447 0.000317 0.289098 0.357976 0.321956 1165.43 1220.05 1.000
pi(T){all} 0.209791 0.000235 0.177034 0.237451 0.209804 1293.09 1305.06 1.000
alpha{1,2} 0.417465 0.216165 0.000102 1.357231 0.257643 973.44 1002.40 1.001
alpha{3} 0.467979 0.260066 0.000110 1.494485 0.302526 1355.75 1359.31 1.000
pinvar{all} 0.997693 0.000008 0.992064 0.999999 0.998590 1156.44 1282.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/mtrA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 228
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 9 9 9 9 9 9 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 6 6 6 6 6 6
CTA 4 4 4 4 4 4 | CCA 3 3 3 3 3 3 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 10 10 10 10 10 10 | CCG 7 7 7 7 7 7 | CAG 4 4 4 4 4 4 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 4 4 4 4 4 4 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 5 5 5 5 5 5 | ACC 8 8 8 8 8 8 | AAC 4 4 4 4 4 4 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 8 8 8 8 8 8 | ACG 0 0 0 0 0 0 | AAG 8 8 8 8 8 8 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 4 4 4 4 4 4 | Asp GAT 5 5 5 5 5 5 | Gly GGT 5 5 5 5 5 5
GTC 8 8 8 8 8 8 | GCC 7 7 7 7 7 7 | GAC 18 18 18 18 18 18 | GGC 5 5 5 5 5 5
GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 4 4 4 4 4 4 | GGA 3 3 3 3 3 3
GTG 15 15 15 15 15 15 | GCG 5 5 5 5 5 5 | GAG 8 8 8 8 8 8 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907921_1_809_MLBR_RS03795
position 1: T:0.10526 C:0.25877 A:0.21053 G:0.42544
position 2: T:0.35088 C:0.21930 A:0.26754 G:0.16228
position 3: T:0.17105 C:0.33333 A:0.11404 G:0.38158
Average T:0.20906 C:0.27047 A:0.19737 G:0.32310
#2: NC_002677_1_NP_301597_1_469_mtrA
position 1: T:0.10526 C:0.25877 A:0.21053 G:0.42544
position 2: T:0.35088 C:0.21930 A:0.26754 G:0.16228
position 3: T:0.17105 C:0.33333 A:0.11404 G:0.38158
Average T:0.20906 C:0.27047 A:0.19737 G:0.32310
#3: NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955
position 1: T:0.10526 C:0.25877 A:0.21053 G:0.42544
position 2: T:0.35088 C:0.21930 A:0.26754 G:0.16228
position 3: T:0.17105 C:0.33333 A:0.11404 G:0.38158
Average T:0.20906 C:0.27047 A:0.19737 G:0.32310
#4: NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890
position 1: T:0.10526 C:0.25877 A:0.21053 G:0.42544
position 2: T:0.35088 C:0.21930 A:0.26754 G:0.16228
position 3: T:0.17105 C:0.33333 A:0.11404 G:0.38158
Average T:0.20906 C:0.27047 A:0.19737 G:0.32310
#5: NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220
position 1: T:0.10526 C:0.25877 A:0.21053 G:0.42544
position 2: T:0.35088 C:0.21930 A:0.26754 G:0.16228
position 3: T:0.17105 C:0.33333 A:0.11404 G:0.38158
Average T:0.20906 C:0.27047 A:0.19737 G:0.32310
#6: NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275
position 1: T:0.10526 C:0.25877 A:0.21053 G:0.42544
position 2: T:0.35088 C:0.21930 A:0.26754 G:0.16228
position 3: T:0.17105 C:0.33333 A:0.11404 G:0.38158
Average T:0.20906 C:0.27047 A:0.19737 G:0.32310
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 12 | TAC 12 | TGC 6
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 54 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 24
CTC 12 | CCC 18 | CAC 12 | CGC 36
CTA 24 | CCA 18 | Gln Q CAA 6 | CGA 12
CTG 60 | CCG 42 | CAG 24 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 24 | Asn N AAT 6 | Ser S AGT 0
ATC 30 | ACC 48 | AAC 24 | AGC 0
ATA 6 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 48 | ACG 0 | AAG 48 | AGG 18
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 24 | Asp D GAT 30 | Gly G GGT 30
GTC 48 | GCC 42 | GAC 108 | GGC 30
GTA 12 | GCA 12 | Glu E GAA 24 | GGA 18
GTG 90 | GCG 30 | GAG 48 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10526 C:0.25877 A:0.21053 G:0.42544
position 2: T:0.35088 C:0.21930 A:0.26754 G:0.16228
position 3: T:0.17105 C:0.33333 A:0.11404 G:0.38158
Average T:0.20906 C:0.27047 A:0.19737 G:0.32310
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -887.819873 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.635786 1.348824
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907921_1_809_MLBR_RS03795: 0.000004, NC_002677_1_NP_301597_1_469_mtrA: 0.000004, NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955: 0.000004, NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890: 0.000004, NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220: 0.000004, NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.63579
omega (dN/dS) = 1.34882
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 518.6 165.4 1.3488 0.0000 0.0000 0.0 0.0
7..2 0.000 518.6 165.4 1.3488 0.0000 0.0000 0.0 0.0
7..3 0.000 518.6 165.4 1.3488 0.0000 0.0000 0.0 0.0
7..4 0.000 518.6 165.4 1.3488 0.0000 0.0000 0.0 0.0
7..5 0.000 518.6 165.4 1.3488 0.0000 0.0000 0.0 0.0
7..6 0.000 518.6 165.4 1.3488 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -887.819769 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.582184 0.802048 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907921_1_809_MLBR_RS03795: 0.000004, NC_002677_1_NP_301597_1_469_mtrA: 0.000004, NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955: 0.000004, NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890: 0.000004, NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220: 0.000004, NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.58218
MLEs of dN/dS (w) for site classes (K=2)
p: 0.80205 0.19795
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 519.4 164.6 0.1980 0.0000 0.0000 0.0 0.0
7..2 0.000 519.4 164.6 0.1980 0.0000 0.0000 0.0 0.0
7..3 0.000 519.4 164.6 0.1980 0.0000 0.0000 0.0 0.0
7..4 0.000 519.4 164.6 0.1980 0.0000 0.0000 0.0 0.0
7..5 0.000 519.4 164.6 0.1980 0.0000 0.0000 0.0 0.0
7..6 0.000 519.4 164.6 0.1980 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -887.819814 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.526816 0.564078 0.252561 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907921_1_809_MLBR_RS03795: 0.000004, NC_002677_1_NP_301597_1_469_mtrA: 0.000004, NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955: 0.000004, NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890: 0.000004, NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220: 0.000004, NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.52682
MLEs of dN/dS (w) for site classes (K=3)
p: 0.56408 0.25256 0.18336
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 520.2 163.8 0.4359 0.0000 0.0000 0.0 0.0
7..2 0.000 520.2 163.8 0.4359 0.0000 0.0000 0.0 0.0
7..3 0.000 520.2 163.8 0.4359 0.0000 0.0000 0.0 0.0
7..4 0.000 520.2 163.8 0.4359 0.0000 0.0000 0.0 0.0
7..5 0.000 520.2 163.8 0.4359 0.0000 0.0000 0.0 0.0
7..6 0.000 520.2 163.8 0.4359 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907921_1_809_MLBR_RS03795)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -887.819546 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.122194 0.005000 1.441500
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907921_1_809_MLBR_RS03795: 0.000004, NC_002677_1_NP_301597_1_469_mtrA: 0.000004, NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955: 0.000004, NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890: 0.000004, NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220: 0.000004, NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.12219
Parameters in M7 (beta):
p = 0.00500 q = 1.44150
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 527.8 156.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 527.8 156.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 527.8 156.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 527.8 156.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 527.8 156.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 527.8 156.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -887.819499 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 6.650801 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907921_1_809_MLBR_RS03795: 0.000004, NC_002677_1_NP_301597_1_469_mtrA: 0.000004, NZ_LVXE01000001_1_WP_010907921_1_194_A3216_RS00955: 0.000004, NZ_LYPH01000001_1_WP_010907921_1_183_A8144_RS00890: 0.000004, NZ_CP029543_1_WP_010907921_1_830_DIJ64_RS04220: 0.000004, NZ_AP014567_1_WP_010907921_1_841_JK2ML_RS04275: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 6.65080
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 530.6 153.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 530.6 153.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 530.6 153.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 530.6 153.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 530.6 153.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 530.6 153.4 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907921_1_809_MLBR_RS03795)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Time used: 0:14
Model 1: NearlyNeutral -887.819769 Model 2: PositiveSelection -887.819814 Model 0: one-ratio -887.819873 Model 7: beta -887.819546 Model 8: beta&w>1 -887.819499 Model 0 vs 1 2.080000001569715E-4 Model 2 vs 1 9.000000000014552E-5 Model 8 vs 7 9.399999999004649E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
