--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:31:44 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/9res/ML2549/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -902.90 -905.92 2 -902.86 -906.73 -------------------------------------- TOTAL -902.88 -906.41 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.900085 0.086810 0.364986 1.485150 0.876266 1470.59 1485.80 1.000 r(A<->C){all} 0.165179 0.019621 0.000206 0.449193 0.127813 242.09 246.20 1.000 r(A<->G){all} 0.161530 0.018828 0.000073 0.446694 0.126348 154.97 224.71 1.000 r(A<->T){all} 0.170599 0.021596 0.000029 0.462935 0.130659 188.84 229.58 1.002 r(C<->G){all} 0.170709 0.020564 0.000078 0.465641 0.137172 119.13 170.27 1.000 r(C<->T){all} 0.178678 0.022792 0.000135 0.474154 0.137515 173.76 205.51 1.000 r(G<->T){all} 0.153305 0.018400 0.000286 0.430436 0.113441 102.56 169.12 1.000 pi(A){all} 0.201013 0.000227 0.173085 0.231266 0.200608 1002.31 1251.66 1.000 pi(C){all} 0.328521 0.000321 0.294139 0.362698 0.328388 1278.18 1389.59 1.000 pi(G){all} 0.295660 0.000304 0.259928 0.327965 0.295468 1295.75 1368.93 1.000 pi(T){all} 0.174806 0.000201 0.148244 0.203000 0.174650 1276.61 1388.81 1.000 alpha{1,2} 0.427412 0.223720 0.000148 1.363470 0.268030 1139.92 1140.19 1.001 alpha{3} 0.470963 0.255221 0.000153 1.451667 0.308488 1018.19 1259.59 1.000 pinvar{all} 0.997697 0.000008 0.992245 0.999998 0.998542 1232.14 1278.08 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -880.231713 Model 2: PositiveSelection -880.231711 Model 0: one-ratio -880.231712 Model 7: beta -880.231761 Model 8: beta&w>1 -880.231699 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 1.2399999991430377E-4
>C1 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >C2 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >C3 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >C4 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >C5 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >C6 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=222 C1 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA C2 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA C3 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA C4 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA C5 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA C6 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA ************************************************** C1 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV C2 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV C3 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV C4 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV C5 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV C6 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV ************************************************** C1 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD C2 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD C3 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD C4 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD C5 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD C6 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD ************************************************** C1 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL C2 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL C3 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL C4 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL C5 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL C6 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL ************************************************** C1 WDTNRPNPALLTQGMWVQFRAT C2 WDTNRPNPALLTQGMWVQFRAT C3 WDTNRPNPALLTQGMWVQFRAT C4 WDTNRPNPALLTQGMWVQFRAT C5 WDTNRPNPALLTQGMWVQFRAT C6 WDTNRPNPALLTQGMWVQFRAT ********************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [6660] Library Relaxation: Multi_proc [96] Relaxation Summary: [6660]--->[6660] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.486 Mb, Max= 30.769 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA C2 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA C3 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA C4 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA C5 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA C6 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA ************************************************** C1 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV C2 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV C3 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV C4 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV C5 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV C6 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV ************************************************** C1 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD C2 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD C3 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD C4 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD C5 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD C6 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD ************************************************** C1 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL C2 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL C3 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL C4 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL C5 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL C6 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL ************************************************** C1 WDTNRPNPALLTQGMWVQFRAT C2 WDTNRPNPALLTQGMWVQFRAT C3 WDTNRPNPALLTQGMWVQFRAT C4 WDTNRPNPALLTQGMWVQFRAT C5 WDTNRPNPALLTQGMWVQFRAT C6 WDTNRPNPALLTQGMWVQFRAT ********************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG C2 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG C3 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG C4 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG C5 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG C6 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG ************************************************** C1 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG C2 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG C3 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG C4 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG C5 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG C6 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG ************************************************** C1 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA C2 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA C3 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA C4 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA C5 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA C6 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA ************************************************** C1 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA C2 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA C3 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA C4 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA C5 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA C6 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ************************************************** C1 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC C2 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC C3 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC C4 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC C5 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC C6 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC ************************************************** C1 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG C2 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG C3 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG C4 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG C5 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG C6 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG ************************************************** C1 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC C2 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC C3 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC C4 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC C5 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC C6 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC ************************************************** C1 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT C2 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT C3 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT C4 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT C5 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT C6 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT ************************************************** C1 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC C2 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC C3 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC C4 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC C5 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC C6 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC ************************************************** C1 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT C2 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT C3 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT C4 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT C5 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT C6 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT ************************************************** C1 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC C2 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC C3 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC C4 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC C5 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC C6 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC ************************************************** C1 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG C2 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG C3 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG C4 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG C5 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG C6 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG ************************************************** C1 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT C2 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT C3 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT C4 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT C5 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT C6 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT ************************************************** C1 GCAGTTCCGTGCCACG C2 GCAGTTCCGTGCCACG C3 GCAGTTCCGTGCCACG C4 GCAGTTCCGTGCCACG C5 GCAGTTCCGTGCCACG C6 GCAGTTCCGTGCCACG **************** >C1 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >C2 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >C3 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >C4 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >C5 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >C6 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >C1 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >C2 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >C3 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >C4 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >C5 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >C6 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 666 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579858225 Setting output file names to "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 77135722 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5413048695 Seed = 2014946875 Swapseed = 1579858225 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1490.539932 -- -24.965149 Chain 2 -- -1490.539932 -- -24.965149 Chain 3 -- -1490.539705 -- -24.965149 Chain 4 -- -1490.539705 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1490.539932 -- -24.965149 Chain 2 -- -1490.539705 -- -24.965149 Chain 3 -- -1490.539932 -- -24.965149 Chain 4 -- -1490.539847 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1490.540] (-1490.540) (-1490.540) (-1490.540) * [-1490.540] (-1490.540) (-1490.540) (-1490.540) 500 -- (-920.926) (-918.792) (-921.883) [-912.564] * (-920.730) [-910.219] (-923.696) (-935.826) -- 0:00:00 1000 -- (-914.121) (-910.275) (-912.023) [-916.195] * (-922.959) (-909.513) (-918.121) [-918.125] -- 0:00:00 1500 -- (-909.571) (-909.657) (-918.291) [-910.963] * (-914.223) [-907.166] (-918.287) (-928.396) -- 0:00:00 2000 -- [-913.665] (-907.677) (-913.505) (-912.092) * [-909.863] (-919.611) (-914.023) (-914.698) -- 0:00:00 2500 -- (-911.372) [-913.289] (-919.405) (-912.836) * (-906.912) (-915.685) (-916.031) [-909.618] -- 0:00:00 3000 -- (-913.176) [-919.770] (-907.802) (-914.430) * (-913.264) (-913.247) [-917.190] (-915.420) -- 0:00:00 3500 -- (-913.284) [-909.645] (-905.570) (-914.821) * (-920.190) (-914.456) (-912.400) [-916.734] -- 0:00:00 4000 -- (-908.781) (-924.513) [-912.075] (-917.501) * (-914.146) [-907.883] (-915.677) (-909.208) -- 0:00:00 4500 -- [-909.374] (-917.285) (-910.792) (-918.668) * (-909.115) (-909.522) (-917.135) [-913.860] -- 0:00:00 5000 -- (-917.132) (-911.814) [-908.110] (-917.085) * (-914.321) (-907.656) [-913.500] (-912.236) -- 0:00:00 Average standard deviation of split frequencies: 0.081983 5500 -- (-914.787) (-916.240) [-914.253] (-913.544) * (-914.819) (-911.756) (-909.127) [-915.801] -- 0:00:00 6000 -- (-906.801) (-906.032) (-908.044) [-912.463] * [-915.422] (-914.587) (-911.898) (-912.446) -- 0:00:00 6500 -- (-914.379) (-914.643) (-912.269) [-911.580] * [-912.072] (-912.817) (-911.443) (-917.269) -- 0:02:32 7000 -- (-921.738) (-910.604) [-909.406] (-912.872) * [-912.276] (-911.627) (-914.193) (-916.075) -- 0:02:21 7500 -- [-909.456] (-910.005) (-928.357) (-917.930) * (-917.246) [-908.812] (-916.147) (-912.694) -- 0:02:12 8000 -- (-915.028) (-918.105) (-917.338) [-911.621] * (-912.377) (-912.639) [-917.363] (-908.922) -- 0:02:04 8500 -- (-919.540) (-909.429) [-914.129] (-911.158) * (-909.616) (-914.724) [-913.702] (-914.018) -- 0:01:56 9000 -- (-905.745) (-908.141) [-914.259] (-912.212) * (-916.907) (-912.665) (-906.387) [-906.733] -- 0:01:50 9500 -- [-909.247] (-925.568) (-919.650) (-918.280) * (-911.812) (-908.695) [-906.564] (-918.797) -- 0:01:44 10000 -- [-911.057] (-908.087) (-908.974) (-914.821) * (-908.446) [-914.713] (-906.571) (-916.558) -- 0:01:39 Average standard deviation of split frequencies: 0.083969 10500 -- (-913.370) [-910.974] (-915.607) (-910.744) * [-908.364] (-919.579) (-906.735) (-915.215) -- 0:01:34 11000 -- [-908.622] (-914.219) (-915.166) (-913.636) * (-913.541) [-906.807] (-904.259) (-913.146) -- 0:01:29 11500 -- (-911.965) [-909.724] (-916.082) (-913.697) * (-916.540) [-902.041] (-905.951) (-915.148) -- 0:01:25 12000 -- [-906.808] (-912.007) (-913.588) (-911.681) * (-913.787) [-904.765] (-903.714) (-909.367) -- 0:01:22 12500 -- (-910.457) (-909.290) (-917.555) [-911.599] * (-912.272) (-903.553) [-902.624] (-909.422) -- 0:01:19 13000 -- (-912.165) (-925.304) [-909.883] (-907.840) * (-911.272) [-904.893] (-902.375) (-916.964) -- 0:01:15 13500 -- [-917.950] (-918.104) (-913.902) (-926.465) * [-909.523] (-902.670) (-905.393) (-913.698) -- 0:01:13 14000 -- (-915.108) [-911.496] (-919.492) (-910.409) * (-918.998) [-903.979] (-902.432) (-914.685) -- 0:01:10 14500 -- (-915.064) [-905.519] (-916.108) (-913.224) * [-908.530] (-903.926) (-906.504) (-915.102) -- 0:01:07 15000 -- [-907.177] (-919.947) (-919.657) (-917.279) * (-912.284) [-903.181] (-905.019) (-908.101) -- 0:01:05 Average standard deviation of split frequencies: 0.054274 15500 -- (-908.665) (-921.533) [-915.284] (-921.097) * [-908.828] (-903.044) (-904.313) (-912.886) -- 0:01:03 16000 -- [-915.906] (-908.006) (-915.032) (-916.491) * (-915.666) (-903.013) [-902.769] (-917.561) -- 0:01:01 16500 -- (-915.435) (-914.746) (-909.000) [-902.607] * [-915.983] (-902.856) (-906.947) (-913.538) -- 0:00:59 17000 -- (-912.818) [-916.213] (-908.261) (-902.823) * (-919.008) (-902.887) [-903.409] (-913.690) -- 0:00:57 17500 -- (-910.423) (-917.709) (-914.967) [-906.611] * [-909.785] (-904.150) (-902.205) (-917.923) -- 0:00:56 18000 -- [-907.411] (-915.163) (-913.953) (-904.531) * (-911.167) [-903.213] (-903.053) (-917.196) -- 0:00:54 18500 -- (-920.099) (-918.133) (-908.225) [-903.247] * [-907.716] (-906.710) (-902.672) (-916.220) -- 0:00:53 19000 -- (-918.342) (-915.692) (-918.126) [-903.689] * (-911.655) [-902.977] (-903.604) (-913.493) -- 0:00:51 19500 -- [-906.519] (-911.855) (-926.169) (-906.439) * (-911.012) [-903.090] (-906.071) (-906.905) -- 0:00:50 20000 -- (-912.348) (-915.676) (-920.590) [-905.524] * (-921.656) [-903.993] (-902.445) (-901.433) -- 0:00:49 Average standard deviation of split frequencies: 0.055224 20500 -- (-920.060) (-914.948) [-908.280] (-906.639) * (-918.154) (-904.613) (-906.968) [-902.002] -- 0:00:47 21000 -- (-913.639) [-913.169] (-909.974) (-902.713) * (-921.736) (-903.595) (-902.767) [-902.427] -- 0:00:46 21500 -- (-914.034) [-914.607] (-915.507) (-906.586) * (-910.473) [-901.707] (-907.861) (-902.470) -- 0:00:45 22000 -- [-916.132] (-912.110) (-908.789) (-903.987) * (-923.388) [-902.908] (-905.928) (-903.416) -- 0:00:44 22500 -- [-913.152] (-913.261) (-914.208) (-904.570) * (-917.378) [-904.152] (-901.576) (-904.102) -- 0:01:26 23000 -- (-911.648) (-917.606) [-909.605] (-901.593) * (-917.345) (-904.462) [-901.293] (-909.719) -- 0:01:24 23500 -- (-913.721) [-911.759] (-922.712) (-903.309) * [-905.087] (-903.846) (-904.397) (-907.936) -- 0:01:23 24000 -- (-916.231) [-915.621] (-919.516) (-904.461) * (-902.618) [-902.059] (-903.529) (-907.270) -- 0:01:21 24500 -- [-908.889] (-915.274) (-911.747) (-902.005) * [-901.902] (-906.401) (-907.657) (-906.096) -- 0:01:19 25000 -- [-918.281] (-916.000) (-911.784) (-904.428) * (-902.034) [-902.556] (-903.153) (-902.390) -- 0:01:18 Average standard deviation of split frequencies: 0.037086 25500 -- (-913.377) (-911.001) [-904.687] (-904.976) * (-904.454) [-902.541] (-902.985) (-901.935) -- 0:01:16 26000 -- (-908.887) (-914.999) [-904.149] (-903.551) * [-902.771] (-902.810) (-902.803) (-902.249) -- 0:01:14 26500 -- (-918.154) (-916.554) (-905.439) [-904.031] * (-904.334) (-903.282) [-904.672] (-901.492) -- 0:01:13 27000 -- (-910.424) (-912.959) [-904.568] (-903.377) * (-903.455) (-905.391) (-905.224) [-902.181] -- 0:01:12 27500 -- (-914.868) (-914.720) [-903.576] (-906.082) * (-902.869) [-902.936] (-906.128) (-902.062) -- 0:01:10 28000 -- (-908.627) (-916.500) (-903.135) [-903.418] * (-902.918) (-904.882) (-908.343) [-905.440] -- 0:01:09 28500 -- (-914.048) [-911.658] (-903.551) (-903.767) * (-903.038) [-903.133] (-905.644) (-902.933) -- 0:01:08 29000 -- (-911.825) [-916.804] (-902.286) (-905.933) * (-904.381) [-902.997] (-902.107) (-904.965) -- 0:01:06 29500 -- (-912.812) (-930.178) (-905.560) [-905.629] * [-904.798] (-904.554) (-903.836) (-904.882) -- 0:01:05 30000 -- (-910.269) [-910.102] (-905.615) (-908.446) * (-906.625) (-902.934) [-903.178] (-902.359) -- 0:01:04 Average standard deviation of split frequencies: 0.039198 30500 -- (-911.238) [-903.067] (-904.771) (-907.329) * [-902.789] (-904.522) (-902.113) (-902.549) -- 0:01:03 31000 -- (-913.303) (-904.055) (-907.777) [-904.069] * (-903.202) [-906.162] (-903.083) (-908.524) -- 0:01:02 31500 -- [-908.932] (-901.326) (-903.207) (-902.168) * (-904.416) (-905.220) [-902.315] (-905.696) -- 0:01:01 32000 -- [-915.711] (-903.443) (-903.100) (-904.028) * (-904.069) (-902.902) (-905.054) [-905.124] -- 0:01:00 32500 -- (-915.257) (-903.866) [-902.676] (-902.520) * [-902.965] (-902.129) (-902.180) (-901.436) -- 0:00:59 33000 -- [-913.427] (-902.907) (-902.547) (-905.231) * (-903.049) (-903.348) (-904.977) [-902.058] -- 0:00:58 33500 -- (-912.490) (-903.771) [-902.454] (-908.165) * (-903.029) (-904.457) (-903.460) [-902.008] -- 0:00:57 34000 -- (-909.148) (-902.999) [-906.124] (-910.692) * (-906.209) [-902.047] (-904.636) (-902.863) -- 0:00:56 34500 -- (-918.717) [-902.353] (-904.639) (-908.584) * (-907.747) [-902.049] (-903.226) (-902.227) -- 0:00:55 35000 -- [-906.117] (-905.469) (-903.979) (-905.378) * (-904.563) (-904.898) [-901.911] (-901.937) -- 0:00:55 Average standard deviation of split frequencies: 0.034919 35500 -- (-915.261) (-902.040) (-904.465) [-906.689] * [-914.030] (-903.747) (-904.887) (-901.991) -- 0:00:54 36000 -- (-918.049) [-902.850] (-904.278) (-905.566) * (-906.327) [-903.022] (-902.573) (-902.303) -- 0:00:53 36500 -- (-913.995) [-903.936] (-903.163) (-902.361) * (-904.663) (-903.717) (-902.520) [-903.076] -- 0:00:52 37000 -- (-910.980) (-905.590) (-902.088) [-905.354] * (-904.650) (-904.012) [-903.156] (-901.930) -- 0:00:52 37500 -- (-913.754) (-902.929) [-901.575] (-904.465) * (-902.381) (-903.997) (-904.316) [-903.474] -- 0:00:51 38000 -- (-912.956) (-903.707) [-901.698] (-905.713) * [-902.162] (-901.313) (-903.796) (-905.114) -- 0:00:50 38500 -- (-917.960) (-902.534) [-902.925] (-903.557) * (-907.271) (-901.247) (-901.549) [-901.798] -- 0:00:49 39000 -- (-911.098) [-902.416] (-903.073) (-903.166) * (-903.579) (-902.439) [-903.377] (-905.890) -- 0:00:49 39500 -- (-915.375) (-902.286) [-901.630] (-904.001) * [-903.361] (-901.490) (-903.915) (-903.955) -- 0:01:12 40000 -- [-910.321] (-902.467) (-902.574) (-906.564) * [-902.794] (-902.578) (-904.281) (-906.292) -- 0:01:12 Average standard deviation of split frequencies: 0.032730 40500 -- (-908.638) [-902.773] (-902.456) (-907.697) * (-906.284) (-902.018) [-901.669] (-901.632) -- 0:01:11 41000 -- (-915.207) (-903.428) (-901.824) [-903.584] * (-904.540) (-907.296) [-904.361] (-902.212) -- 0:01:10 41500 -- (-908.766) [-905.027] (-902.663) (-902.289) * (-904.465) (-904.968) [-902.472] (-905.248) -- 0:01:09 42000 -- (-910.789) (-905.098) [-902.863] (-901.728) * (-906.109) [-902.666] (-903.289) (-904.533) -- 0:01:08 42500 -- (-913.534) (-903.771) [-902.199] (-902.116) * [-903.130] (-905.725) (-904.742) (-904.683) -- 0:01:07 43000 -- (-914.203) (-905.346) (-905.189) [-903.823] * [-901.640] (-904.389) (-904.075) (-903.931) -- 0:01:06 43500 -- (-914.213) [-905.401] (-904.223) (-903.166) * (-903.481) (-909.777) [-904.442] (-903.078) -- 0:01:05 44000 -- (-909.628) (-905.348) [-907.246] (-904.840) * (-903.488) (-905.166) [-904.274] (-901.733) -- 0:01:05 44500 -- (-916.682) (-906.737) [-904.821] (-904.540) * [-902.553] (-904.321) (-904.839) (-904.487) -- 0:01:04 45000 -- (-917.004) (-905.499) (-904.223) [-902.074] * (-906.942) (-901.562) (-903.945) [-904.605] -- 0:01:03 Average standard deviation of split frequencies: 0.025620 45500 -- (-916.702) (-903.459) [-903.582] (-902.033) * (-902.334) (-901.568) [-904.804] (-903.342) -- 0:01:02 46000 -- (-911.351) [-907.137] (-906.223) (-903.717) * (-903.348) [-902.708] (-907.072) (-901.848) -- 0:01:02 46500 -- [-912.617] (-903.085) (-903.626) (-902.725) * (-902.763) (-903.143) [-906.406] (-901.847) -- 0:01:01 47000 -- (-905.328) [-904.806] (-904.583) (-903.878) * (-902.665) [-902.669] (-905.106) (-902.042) -- 0:01:00 47500 -- (-907.842) (-903.318) [-903.091] (-903.928) * (-905.435) (-901.577) [-904.019] (-901.991) -- 0:01:00 48000 -- (-910.519) (-904.964) [-902.486] (-905.305) * (-902.470) [-904.615] (-903.141) (-901.918) -- 0:00:59 48500 -- (-917.520) (-903.768) [-902.484] (-903.996) * (-903.717) [-901.828] (-905.843) (-903.521) -- 0:00:58 49000 -- (-915.012) (-903.928) (-902.069) [-902.275] * [-905.418] (-902.795) (-908.186) (-904.825) -- 0:00:58 49500 -- (-918.912) [-902.605] (-901.778) (-902.521) * (-902.702) (-904.593) [-904.130] (-902.926) -- 0:00:57 50000 -- (-911.204) [-903.671] (-903.094) (-902.221) * [-903.079] (-904.811) (-902.696) (-905.535) -- 0:00:57 Average standard deviation of split frequencies: 0.027447 50500 -- (-909.160) [-903.376] (-902.550) (-902.610) * (-905.329) [-904.311] (-902.251) (-902.522) -- 0:00:56 51000 -- (-908.761) [-903.021] (-902.393) (-903.989) * [-902.783] (-904.249) (-902.604) (-903.669) -- 0:00:55 51500 -- [-913.533] (-903.047) (-905.930) (-902.915) * (-905.867) (-904.237) (-905.233) [-902.353] -- 0:00:55 52000 -- (-913.732) [-901.759] (-903.419) (-904.938) * (-902.064) [-902.371] (-905.818) (-908.290) -- 0:00:54 52500 -- [-911.810] (-904.614) (-901.948) (-903.986) * (-901.859) (-906.321) [-907.144] (-902.628) -- 0:00:54 53000 -- (-920.756) (-902.389) (-903.586) [-902.913] * (-903.798) (-903.774) (-906.831) [-902.069] -- 0:00:53 53500 -- [-914.387] (-902.501) (-906.114) (-902.941) * (-902.647) [-903.418] (-904.700) (-903.892) -- 0:00:53 54000 -- (-913.174) (-902.432) (-904.340) [-903.011] * (-904.709) [-902.341] (-905.018) (-904.188) -- 0:00:52 54500 -- (-919.318) (-904.318) (-904.262) [-904.340] * (-903.304) (-903.739) (-905.238) [-904.202] -- 0:00:52 55000 -- (-918.510) (-903.666) (-903.944) [-902.897] * (-906.449) [-901.644] (-904.011) (-904.369) -- 0:00:51 Average standard deviation of split frequencies: 0.026937 55500 -- (-907.229) (-904.448) [-903.435] (-902.923) * (-909.352) (-906.858) [-903.186] (-902.260) -- 0:01:08 56000 -- (-908.684) (-902.980) [-904.374] (-904.020) * (-904.863) [-903.550] (-904.679) (-902.823) -- 0:01:07 56500 -- [-909.753] (-902.830) (-907.579) (-908.616) * (-904.848) [-901.546] (-902.677) (-903.865) -- 0:01:06 57000 -- (-904.910) [-903.754] (-908.930) (-904.144) * (-908.408) [-902.063] (-902.765) (-904.439) -- 0:01:06 57500 -- (-904.303) (-902.174) (-904.685) [-902.248] * (-904.614) [-902.388] (-901.656) (-902.263) -- 0:01:05 58000 -- (-906.427) [-902.543] (-904.209) (-902.250) * (-903.255) (-903.012) [-902.820] (-902.632) -- 0:01:04 58500 -- (-905.284) [-904.499] (-902.873) (-903.499) * (-904.270) [-902.027] (-901.822) (-903.705) -- 0:01:04 59000 -- (-902.318) (-904.658) [-902.279] (-903.143) * (-904.819) (-905.941) [-903.658] (-903.147) -- 0:01:03 59500 -- (-904.324) (-903.107) [-903.077] (-903.046) * [-904.973] (-905.160) (-902.286) (-902.409) -- 0:01:03 60000 -- [-902.979] (-903.046) (-902.367) (-908.421) * (-904.990) (-902.292) [-902.301] (-902.541) -- 0:01:02 Average standard deviation of split frequencies: 0.022923 60500 -- [-903.508] (-903.048) (-906.498) (-905.733) * (-902.107) (-902.168) (-907.270) [-902.975] -- 0:01:02 61000 -- (-902.560) (-903.249) (-903.622) [-904.449] * (-903.333) (-901.934) [-906.878] (-902.865) -- 0:01:01 61500 -- (-904.589) [-904.010] (-905.980) (-903.929) * (-903.247) (-905.151) [-902.122] (-905.030) -- 0:01:01 62000 -- (-902.994) (-901.813) (-904.058) [-903.906] * (-904.328) (-903.258) [-902.382] (-903.136) -- 0:01:00 62500 -- [-903.523] (-904.042) (-903.752) (-903.194) * [-902.717] (-902.314) (-903.010) (-903.075) -- 0:01:00 63000 -- (-904.496) (-902.732) [-903.106] (-903.614) * (-903.212) [-903.065] (-903.174) (-901.860) -- 0:00:59 63500 -- (-903.503) (-903.440) [-903.957] (-912.946) * [-902.708] (-902.786) (-901.946) (-902.603) -- 0:00:58 64000 -- [-902.814] (-901.687) (-904.360) (-919.075) * [-905.273] (-903.641) (-903.617) (-902.182) -- 0:00:58 64500 -- (-905.535) [-901.771] (-905.420) (-904.321) * (-903.660) (-902.876) (-901.894) [-901.597] -- 0:00:58 65000 -- (-903.500) [-902.774] (-909.263) (-907.414) * (-902.916) (-902.341) [-903.987] (-901.635) -- 0:00:57 Average standard deviation of split frequencies: 0.025323 65500 -- (-902.818) [-903.318] (-903.255) (-904.221) * (-903.708) (-906.114) [-903.063] (-902.524) -- 0:00:57 66000 -- (-903.145) (-903.812) [-902.951] (-903.918) * (-903.387) (-906.108) [-901.884] (-901.777) -- 0:00:56 66500 -- (-904.007) (-905.251) (-906.507) [-904.070] * [-903.267] (-904.382) (-901.714) (-902.481) -- 0:00:56 67000 -- (-904.539) [-903.701] (-904.069) (-902.371) * (-904.206) [-909.840] (-901.714) (-902.381) -- 0:00:55 67500 -- (-906.625) [-902.164] (-903.306) (-902.578) * (-907.196) [-904.120] (-903.946) (-903.597) -- 0:00:55 68000 -- (-903.434) (-906.110) (-904.289) [-902.384] * [-905.549] (-902.660) (-904.944) (-902.836) -- 0:00:54 68500 -- [-903.036] (-907.380) (-902.934) (-902.873) * (-907.907) (-902.454) [-905.419] (-902.982) -- 0:00:54 69000 -- (-904.317) (-903.037) (-903.387) [-902.936] * [-905.192] (-903.911) (-905.532) (-902.867) -- 0:00:53 69500 -- (-904.686) [-903.419] (-903.041) (-902.779) * [-904.945] (-905.077) (-909.982) (-907.191) -- 0:00:53 70000 -- (-908.165) (-902.390) (-904.217) [-902.343] * [-903.442] (-903.098) (-907.093) (-905.245) -- 0:00:53 Average standard deviation of split frequencies: 0.024348 70500 -- [-901.649] (-902.273) (-908.242) (-901.563) * (-904.340) (-902.705) [-909.030] (-903.578) -- 0:00:52 71000 -- (-905.050) (-902.092) (-909.747) [-902.176] * (-905.881) [-905.214] (-906.276) (-902.625) -- 0:00:52 71500 -- (-903.550) (-903.381) (-907.270) [-901.632] * (-901.954) [-910.766] (-905.001) (-905.403) -- 0:00:51 72000 -- (-907.488) (-902.778) (-911.624) [-901.640] * (-901.953) (-906.924) (-901.859) [-903.730] -- 0:01:04 72500 -- (-908.366) [-903.134] (-908.928) (-902.367) * (-902.260) (-902.500) (-902.810) [-901.775] -- 0:01:03 73000 -- (-909.053) [-903.224] (-905.935) (-905.358) * (-902.498) [-901.547] (-903.205) (-901.692) -- 0:01:03 73500 -- (-905.625) (-902.766) [-904.911] (-903.519) * (-903.217) (-902.045) [-902.909] (-903.236) -- 0:01:03 74000 -- (-902.075) (-902.299) (-904.804) [-901.994] * (-904.202) [-901.959] (-902.550) (-902.930) -- 0:01:02 74500 -- (-904.407) [-903.318] (-904.674) (-903.611) * (-902.229) (-908.080) [-904.027] (-902.853) -- 0:01:02 75000 -- [-904.421] (-903.080) (-907.253) (-901.580) * (-902.229) [-909.656] (-903.127) (-903.139) -- 0:01:01 Average standard deviation of split frequencies: 0.027749 75500 -- (-907.685) (-905.040) [-907.174] (-903.355) * (-910.711) (-904.730) [-901.636] (-904.457) -- 0:01:01 76000 -- (-904.002) (-903.775) (-903.306) [-903.056] * (-904.296) [-906.564] (-902.723) (-905.580) -- 0:01:00 76500 -- (-902.317) (-903.336) (-902.250) [-902.409] * (-903.727) (-903.996) [-904.090] (-905.960) -- 0:01:00 77000 -- (-906.924) (-903.841) [-902.490] (-901.309) * [-903.039] (-903.710) (-904.733) (-906.036) -- 0:00:59 77500 -- (-902.461) (-903.208) [-902.393] (-903.400) * [-903.751] (-905.425) (-903.264) (-903.660) -- 0:00:59 78000 -- [-903.715] (-909.254) (-901.805) (-905.734) * [-902.683] (-904.076) (-903.612) (-906.138) -- 0:00:59 78500 -- [-902.767] (-902.657) (-901.389) (-905.563) * (-903.478) (-904.957) (-904.483) [-905.668] -- 0:00:58 79000 -- (-903.421) [-903.172] (-901.551) (-903.304) * (-902.424) [-905.892] (-902.718) (-907.660) -- 0:00:58 79500 -- (-904.624) (-904.878) (-901.976) [-902.395] * (-903.608) (-902.298) [-903.136] (-905.724) -- 0:00:57 80000 -- (-904.243) (-903.648) [-902.598] (-902.395) * (-904.129) (-901.955) (-905.720) [-904.664] -- 0:00:57 Average standard deviation of split frequencies: 0.030843 80500 -- (-904.654) (-903.638) [-901.399] (-904.680) * [-902.281] (-904.975) (-902.225) (-904.015) -- 0:00:57 81000 -- (-902.829) (-901.827) [-902.402] (-903.656) * (-902.703) [-903.014] (-905.860) (-904.185) -- 0:00:56 81500 -- (-903.431) (-905.219) [-902.320] (-901.878) * (-903.039) (-905.835) (-905.623) [-906.270] -- 0:00:56 82000 -- (-904.063) (-904.343) [-903.322] (-906.273) * [-902.313] (-906.426) (-907.796) (-903.407) -- 0:00:55 82500 -- (-906.286) [-903.256] (-901.882) (-903.293) * (-904.109) (-903.581) (-904.464) [-903.512] -- 0:00:55 83000 -- (-902.994) [-904.131] (-903.563) (-904.409) * [-902.497] (-903.491) (-904.383) (-903.845) -- 0:00:55 83500 -- [-904.895] (-903.674) (-905.371) (-904.109) * (-901.908) (-904.930) [-902.630] (-908.365) -- 0:00:54 84000 -- (-902.891) (-904.946) [-905.230] (-904.750) * (-902.501) [-907.617] (-908.900) (-906.392) -- 0:00:54 84500 -- (-903.005) [-904.900] (-904.216) (-903.611) * (-905.995) (-905.050) [-902.103] (-904.067) -- 0:00:54 85000 -- (-903.794) [-904.474] (-907.574) (-901.828) * (-905.976) [-905.415] (-902.333) (-907.253) -- 0:00:53 Average standard deviation of split frequencies: 0.026830 85500 -- (-902.975) [-902.567] (-903.095) (-902.758) * [-902.370] (-905.725) (-903.417) (-904.765) -- 0:00:53 86000 -- (-902.804) [-903.424] (-903.365) (-903.819) * (-903.306) (-904.562) [-902.711] (-906.353) -- 0:00:53 86500 -- (-901.641) (-901.700) (-904.624) [-902.748] * (-904.305) [-902.413] (-902.454) (-905.750) -- 0:00:52 87000 -- [-901.836] (-903.358) (-904.488) (-902.909) * [-902.582] (-902.105) (-904.770) (-904.351) -- 0:00:52 87500 -- (-902.147) [-902.395] (-902.938) (-902.180) * (-902.566) [-902.386] (-904.666) (-903.214) -- 0:00:52 88000 -- (-901.659) [-902.585] (-904.247) (-902.728) * [-902.033] (-901.497) (-908.150) (-904.312) -- 0:00:51 88500 -- (-901.944) [-904.590] (-904.104) (-901.734) * (-904.477) (-902.331) [-903.562] (-905.462) -- 0:01:01 89000 -- (-902.364) (-904.315) [-906.734] (-906.469) * (-901.660) [-902.306] (-904.830) (-905.572) -- 0:01:01 89500 -- (-902.883) (-902.121) [-904.356] (-906.402) * (-901.518) [-902.759] (-903.745) (-904.239) -- 0:01:01 90000 -- (-904.580) (-902.042) [-903.934] (-903.894) * (-903.185) (-904.174) (-902.838) [-902.193] -- 0:01:00 Average standard deviation of split frequencies: 0.028076 90500 -- (-902.551) (-903.064) (-903.368) [-905.263] * (-902.718) [-904.248] (-906.819) (-904.518) -- 0:01:00 91000 -- (-903.650) (-902.133) (-902.390) [-905.265] * (-902.834) (-906.602) (-901.737) [-901.526] -- 0:00:59 91500 -- (-902.469) (-902.257) [-903.097] (-901.621) * (-904.181) (-905.053) [-903.939] (-902.653) -- 0:00:59 92000 -- (-902.052) (-904.776) (-905.801) [-902.178] * (-905.398) [-903.585] (-903.290) (-903.552) -- 0:00:59 92500 -- (-902.328) (-903.217) (-903.946) [-903.603] * (-903.238) (-902.166) (-904.532) [-903.425] -- 0:00:58 93000 -- [-903.876] (-903.062) (-905.046) (-902.503) * (-902.690) [-903.314] (-906.183) (-902.147) -- 0:00:58 93500 -- (-903.881) (-904.450) [-906.038] (-913.912) * (-902.089) (-904.545) (-914.424) [-903.166] -- 0:00:58 94000 -- (-904.493) (-904.249) [-902.977] (-901.843) * (-902.505) (-901.824) (-904.086) [-903.193] -- 0:00:57 94500 -- (-907.239) [-903.805] (-903.684) (-904.526) * (-901.667) (-902.804) [-905.566] (-908.214) -- 0:00:57 95000 -- [-903.051] (-903.683) (-903.382) (-903.746) * [-903.015] (-902.544) (-902.828) (-910.410) -- 0:00:57 Average standard deviation of split frequencies: 0.026361 95500 -- [-902.999] (-904.657) (-903.015) (-905.551) * (-903.994) [-903.637] (-907.801) (-905.733) -- 0:00:56 96000 -- (-903.709) [-903.097] (-907.675) (-903.161) * (-902.295) [-904.671] (-902.448) (-905.341) -- 0:00:56 96500 -- (-902.063) (-906.122) [-906.709] (-903.370) * [-905.408] (-903.444) (-902.035) (-907.015) -- 0:00:56 97000 -- (-902.508) (-903.328) (-904.370) [-901.557] * (-909.671) (-903.556) [-903.561] (-904.065) -- 0:00:55 97500 -- [-901.882] (-906.824) (-903.115) (-901.777) * (-901.623) (-903.648) (-908.995) [-904.963] -- 0:00:55 98000 -- (-904.352) (-906.428) (-902.838) [-904.991] * [-902.159] (-902.594) (-903.975) (-904.254) -- 0:00:55 98500 -- (-905.336) [-905.462] (-903.194) (-906.450) * (-902.581) (-905.593) (-902.149) [-902.091] -- 0:00:54 99000 -- (-906.316) (-906.803) [-901.950] (-904.921) * (-902.480) [-904.004] (-902.110) (-904.224) -- 0:00:54 99500 -- (-904.593) (-904.932) [-901.605] (-901.550) * (-901.987) (-907.366) (-904.537) [-903.864] -- 0:00:54 100000 -- (-904.524) (-905.618) (-903.069) [-908.140] * (-903.319) [-906.808] (-901.456) (-902.399) -- 0:00:54 Average standard deviation of split frequencies: 0.023934 100500 -- (-902.796) [-904.793] (-903.511) (-903.403) * (-905.854) (-907.224) (-905.101) [-902.581] -- 0:00:53 101000 -- (-904.312) (-905.363) [-902.039] (-905.056) * [-903.265] (-907.695) (-903.991) (-903.132) -- 0:00:53 101500 -- (-902.480) [-903.453] (-903.078) (-904.065) * [-905.745] (-903.771) (-904.720) (-905.127) -- 0:00:53 102000 -- [-901.822] (-903.365) (-903.340) (-901.770) * (-901.922) (-905.066) [-906.443] (-904.961) -- 0:00:52 102500 -- [-904.843] (-905.065) (-903.184) (-904.718) * (-903.455) (-909.812) (-910.672) [-906.080] -- 0:00:52 103000 -- [-903.613] (-904.513) (-904.326) (-902.026) * [-902.394] (-903.527) (-905.777) (-906.296) -- 0:00:52 103500 -- (-906.145) (-903.949) (-904.974) [-904.329] * (-903.657) (-904.145) (-903.867) [-906.484] -- 0:00:51 104000 -- (-907.484) [-901.590] (-905.618) (-902.810) * (-902.804) (-909.506) (-902.538) [-903.626] -- 0:00:51 104500 -- (-904.979) (-902.385) [-907.774] (-902.444) * (-902.177) (-905.367) (-904.887) [-904.884] -- 0:00:51 105000 -- (-901.969) (-901.482) [-904.007] (-904.504) * (-902.034) (-905.639) (-902.061) [-902.075] -- 0:00:51 Average standard deviation of split frequencies: 0.023172 105500 -- [-903.998] (-904.791) (-902.905) (-903.433) * (-902.137) (-903.814) [-904.463] (-903.275) -- 0:00:59 106000 -- [-902.645] (-905.662) (-903.339) (-902.955) * (-901.926) (-905.831) [-903.685] (-905.073) -- 0:00:59 106500 -- (-905.783) [-903.244] (-903.156) (-906.892) * (-901.873) [-904.834] (-904.263) (-902.748) -- 0:00:58 107000 -- (-901.960) [-901.789] (-902.976) (-902.594) * (-902.747) [-902.087] (-902.338) (-905.736) -- 0:00:58 107500 -- (-901.930) [-901.961] (-906.656) (-903.263) * (-902.614) (-901.326) [-903.586] (-902.563) -- 0:00:58 108000 -- (-906.029) (-906.196) (-904.779) [-902.680] * (-903.888) [-904.324] (-905.051) (-911.899) -- 0:00:57 108500 -- (-905.069) [-903.986] (-902.986) (-904.165) * (-902.757) [-902.770] (-903.450) (-910.488) -- 0:00:57 109000 -- (-901.989) (-901.965) [-902.087] (-904.043) * (-905.047) (-903.097) (-905.616) [-905.040] -- 0:00:57 109500 -- (-903.217) (-903.840) (-903.142) [-902.575] * (-902.376) (-903.696) (-905.409) [-903.712] -- 0:00:56 110000 -- (-907.799) [-903.049] (-901.954) (-903.287) * (-903.192) [-906.429] (-906.165) (-903.326) -- 0:00:56 Average standard deviation of split frequencies: 0.024437 110500 -- (-905.493) [-904.604] (-901.964) (-906.219) * [-902.924] (-902.342) (-903.778) (-902.294) -- 0:00:56 111000 -- (-909.084) [-905.094] (-902.285) (-905.152) * (-903.830) (-902.046) [-903.212] (-901.844) -- 0:00:56 111500 -- [-903.336] (-906.909) (-906.971) (-903.126) * (-902.111) (-902.410) (-904.431) [-901.818] -- 0:00:55 112000 -- (-905.450) (-903.911) (-906.325) [-902.698] * (-907.189) [-904.840] (-903.336) (-902.232) -- 0:00:55 112500 -- (-903.257) (-902.654) [-902.565] (-902.685) * [-901.872] (-903.067) (-903.184) (-902.511) -- 0:00:55 113000 -- [-905.038] (-903.781) (-904.523) (-905.456) * (-903.347) (-902.410) (-905.121) [-903.979] -- 0:00:54 113500 -- (-903.181) (-906.666) [-902.923] (-908.674) * (-903.818) (-902.410) [-903.628] (-903.437) -- 0:00:54 114000 -- (-907.522) [-902.135] (-905.061) (-903.510) * (-903.120) (-902.600) (-903.876) [-905.537] -- 0:00:54 114500 -- (-904.747) (-902.219) (-907.992) [-904.505] * (-901.837) (-902.854) [-902.488] (-903.444) -- 0:00:54 115000 -- [-903.352] (-904.460) (-905.290) (-907.398) * (-905.593) (-902.533) (-903.295) [-903.172] -- 0:00:53 Average standard deviation of split frequencies: 0.020996 115500 -- (-903.119) (-904.168) (-906.828) [-904.291] * (-906.686) [-903.522] (-905.000) (-903.174) -- 0:00:53 116000 -- [-902.428] (-905.118) (-903.557) (-902.956) * (-906.732) (-902.184) (-905.355) [-904.135] -- 0:00:53 116500 -- (-904.100) [-903.505] (-904.890) (-901.660) * (-906.303) (-904.740) (-903.011) [-904.562] -- 0:00:53 117000 -- (-903.176) (-909.090) [-906.825] (-901.450) * (-903.471) [-905.045] (-902.574) (-904.842) -- 0:00:52 117500 -- (-902.517) (-903.315) [-903.344] (-901.476) * (-905.533) (-907.391) (-904.449) [-903.583] -- 0:00:52 118000 -- [-904.261] (-902.280) (-901.967) (-904.166) * [-907.987] (-906.838) (-906.051) (-904.957) -- 0:00:52 118500 -- (-905.885) [-904.608] (-902.530) (-906.254) * (-905.349) (-905.659) (-906.243) [-905.658] -- 0:00:52 119000 -- (-906.586) (-903.859) [-901.964] (-903.153) * (-903.508) (-905.042) [-904.265] (-907.635) -- 0:00:51 119500 -- (-905.194) [-902.873] (-904.224) (-902.556) * (-905.309) [-903.450] (-904.766) (-908.536) -- 0:00:51 120000 -- (-905.579) (-904.688) [-906.200] (-901.847) * [-903.185] (-902.021) (-903.987) (-904.713) -- 0:00:51 Average standard deviation of split frequencies: 0.018014 120500 -- [-903.064] (-905.931) (-901.657) (-901.822) * (-905.384) (-904.575) (-908.838) [-904.631] -- 0:00:51 121000 -- [-903.648] (-905.496) (-901.508) (-901.767) * [-902.129] (-912.354) (-904.763) (-905.202) -- 0:00:50 121500 -- (-903.095) (-904.143) (-905.194) [-902.490] * [-905.993] (-906.126) (-904.917) (-905.276) -- 0:00:57 122000 -- (-905.174) [-904.591] (-904.863) (-904.859) * (-903.274) (-906.709) (-904.204) [-902.926] -- 0:00:57 122500 -- (-904.808) (-902.551) (-903.778) [-904.127] * (-904.163) (-904.383) [-902.713] (-901.420) -- 0:00:57 123000 -- (-905.346) (-902.434) [-903.445] (-902.748) * (-903.807) (-903.976) (-904.183) [-901.517] -- 0:00:57 123500 -- (-906.974) [-903.321] (-904.180) (-903.712) * (-906.647) (-904.015) [-907.397] (-901.714) -- 0:00:56 124000 -- (-905.478) (-903.100) [-904.549] (-902.171) * [-906.482] (-905.800) (-902.302) (-901.482) -- 0:00:56 124500 -- (-903.058) (-902.483) (-903.900) [-903.358] * (-908.024) [-907.527] (-909.199) (-908.161) -- 0:00:56 125000 -- (-906.232) (-902.665) [-904.180] (-902.669) * (-907.539) (-907.151) (-904.275) [-905.719] -- 0:00:56 Average standard deviation of split frequencies: 0.020676 125500 -- (-905.439) (-902.752) (-904.996) [-903.259] * (-903.699) (-903.325) (-903.052) [-903.003] -- 0:00:55 126000 -- (-902.618) (-903.564) (-903.347) [-903.216] * (-903.992) [-903.942] (-902.207) (-903.307) -- 0:00:55 126500 -- [-901.566] (-904.769) (-902.045) (-908.395) * (-906.789) (-903.855) (-902.532) [-903.109] -- 0:00:55 127000 -- [-902.179] (-903.806) (-903.585) (-903.773) * (-904.104) [-905.646] (-903.067) (-902.958) -- 0:00:54 127500 -- [-904.513] (-901.874) (-902.854) (-905.049) * (-904.213) (-903.679) (-904.749) [-903.649] -- 0:00:54 128000 -- [-904.943] (-904.254) (-902.498) (-903.115) * (-904.410) (-906.180) (-902.130) [-903.737] -- 0:00:54 128500 -- [-902.692] (-903.122) (-906.517) (-902.666) * (-904.389) (-902.254) (-905.707) [-905.327] -- 0:00:54 129000 -- (-902.398) [-902.966] (-903.627) (-903.249) * (-906.504) (-902.478) (-906.734) [-906.412] -- 0:00:54 129500 -- [-902.328] (-902.047) (-903.217) (-905.069) * [-902.404] (-902.402) (-903.891) (-905.636) -- 0:00:53 130000 -- (-903.243) [-905.082] (-901.932) (-903.120) * (-902.209) (-904.990) (-902.500) [-904.852] -- 0:00:53 Average standard deviation of split frequencies: 0.021456 130500 -- [-902.697] (-905.114) (-901.880) (-906.136) * (-903.449) (-902.787) [-902.654] (-912.617) -- 0:00:53 131000 -- (-905.849) (-902.581) [-904.711] (-906.495) * (-904.044) (-902.252) [-902.418] (-907.548) -- 0:00:53 131500 -- (-903.491) [-902.793] (-902.115) (-904.685) * (-903.377) [-903.015] (-901.810) (-902.055) -- 0:00:52 132000 -- [-902.887] (-902.332) (-902.112) (-904.906) * (-905.182) [-903.196] (-903.232) (-901.657) -- 0:00:52 132500 -- (-905.388) (-904.625) (-901.486) [-901.644] * (-904.294) (-903.196) [-902.715] (-902.306) -- 0:00:52 133000 -- (-902.579) (-905.603) [-902.671] (-901.474) * (-905.239) (-902.656) (-903.699) [-901.690] -- 0:00:52 133500 -- [-901.453] (-905.797) (-903.859) (-902.870) * [-902.654] (-902.124) (-902.792) (-902.727) -- 0:00:51 134000 -- [-906.344] (-907.481) (-902.138) (-901.717) * (-906.962) (-903.592) (-905.087) [-904.246] -- 0:00:51 134500 -- (-906.553) (-901.660) [-903.351] (-902.386) * (-904.124) [-905.011] (-905.889) (-902.301) -- 0:00:51 135000 -- (-904.460) [-907.033] (-904.062) (-901.873) * (-903.986) (-904.288) (-906.101) [-902.638] -- 0:00:51 Average standard deviation of split frequencies: 0.022723 135500 -- (-901.526) (-906.877) (-902.940) [-901.693] * [-902.489] (-901.232) (-905.398) (-907.369) -- 0:00:51 136000 -- [-902.394] (-906.518) (-903.081) (-906.042) * (-906.121) (-902.062) [-903.543] (-902.642) -- 0:00:50 136500 -- (-903.658) (-903.724) [-901.872] (-903.395) * (-906.231) (-904.394) [-904.801] (-904.702) -- 0:00:50 137000 -- [-902.476] (-902.689) (-902.710) (-904.241) * [-902.157] (-903.012) (-902.297) (-902.824) -- 0:00:50 137500 -- (-905.320) [-905.787] (-905.872) (-903.656) * (-905.273) [-902.007] (-904.582) (-902.390) -- 0:00:50 138000 -- (-903.405) (-905.236) (-907.009) [-902.622] * [-902.566] (-903.313) (-902.462) (-903.797) -- 0:00:56 138500 -- (-903.440) (-901.436) (-905.410) [-903.552] * (-903.746) (-905.456) (-904.887) [-903.539] -- 0:00:55 139000 -- (-904.256) (-907.128) (-903.365) [-901.722] * (-902.256) [-902.288] (-905.247) (-903.943) -- 0:00:55 139500 -- (-905.319) (-902.695) [-904.263] (-902.247) * (-901.681) (-906.337) (-906.743) [-905.038] -- 0:00:55 140000 -- [-901.390] (-903.185) (-901.941) (-901.775) * (-905.089) (-903.245) [-903.252] (-902.997) -- 0:00:55 Average standard deviation of split frequencies: 0.020666 140500 -- [-901.804] (-901.635) (-902.130) (-903.612) * [-902.883] (-906.696) (-902.426) (-902.494) -- 0:00:55 141000 -- [-903.255] (-901.945) (-904.766) (-904.870) * (-901.768) (-903.011) [-903.616] (-901.570) -- 0:00:54 141500 -- (-902.240) [-902.183] (-904.765) (-903.679) * (-901.669) [-902.786] (-904.403) (-901.410) -- 0:00:54 142000 -- (-904.882) (-905.018) [-902.042] (-907.168) * (-901.907) (-907.116) [-904.055] (-903.014) -- 0:00:54 142500 -- (-902.757) (-903.227) [-902.048] (-901.939) * (-901.959) (-905.818) [-902.130] (-903.669) -- 0:00:54 143000 -- [-903.271] (-903.659) (-902.302) (-901.983) * (-903.621) (-902.250) (-902.031) [-901.977] -- 0:00:53 143500 -- (-904.829) [-903.005] (-902.967) (-902.403) * (-904.709) (-906.062) [-903.015] (-903.123) -- 0:00:53 144000 -- (-902.105) (-902.978) [-903.051] (-904.618) * [-903.094] (-903.500) (-902.846) (-905.812) -- 0:00:53 144500 -- (-905.042) (-902.352) (-903.072) [-903.687] * (-902.931) (-906.133) [-904.470] (-905.485) -- 0:00:53 145000 -- (-903.732) (-901.781) (-905.198) [-901.583] * (-902.859) (-903.006) (-903.453) [-903.227] -- 0:00:53 Average standard deviation of split frequencies: 0.020732 145500 -- (-905.766) (-905.054) (-902.993) [-901.583] * (-905.024) [-904.835] (-901.890) (-903.145) -- 0:00:52 146000 -- (-905.853) (-902.680) [-902.172] (-901.675) * (-908.190) [-903.705] (-903.456) (-902.722) -- 0:00:52 146500 -- (-905.521) [-904.601] (-907.506) (-905.136) * (-904.147) (-903.879) [-902.284] (-903.249) -- 0:00:52 147000 -- (-906.043) [-902.732] (-905.405) (-904.117) * (-905.011) (-903.027) (-904.041) [-902.674] -- 0:00:52 147500 -- (-907.261) [-901.894] (-905.063) (-904.809) * (-902.362) [-903.056] (-901.542) (-903.228) -- 0:00:52 148000 -- [-906.034] (-907.152) (-904.540) (-905.656) * [-902.948] (-902.534) (-903.427) (-906.220) -- 0:00:51 148500 -- (-904.662) (-903.155) [-902.742] (-906.227) * (-903.196) (-904.445) (-907.550) [-902.412] -- 0:00:51 149000 -- (-905.326) [-903.233] (-906.448) (-903.018) * (-903.993) (-904.008) [-905.480] (-903.524) -- 0:00:51 149500 -- (-905.036) (-903.716) (-901.858) [-902.254] * (-902.934) (-903.638) [-903.602] (-902.973) -- 0:00:51 150000 -- [-902.545] (-902.962) (-903.023) (-904.885) * (-902.157) [-901.749] (-903.138) (-902.020) -- 0:00:51 Average standard deviation of split frequencies: 0.018443 150500 -- (-902.610) [-903.690] (-903.679) (-903.114) * (-904.062) (-904.138) (-904.379) [-902.287] -- 0:00:50 151000 -- (-902.124) (-906.910) [-904.039] (-903.641) * (-901.454) (-902.941) [-901.413] (-902.386) -- 0:00:50 151500 -- [-903.212] (-902.906) (-902.523) (-905.648) * (-901.703) (-902.753) (-904.375) [-904.737] -- 0:00:50 152000 -- (-902.347) (-902.649) [-902.894] (-903.719) * [-908.004] (-906.427) (-903.808) (-902.035) -- 0:00:50 152500 -- (-903.203) (-902.329) [-903.316] (-909.622) * (-902.216) (-904.303) (-904.971) [-902.676] -- 0:00:50 153000 -- (-906.279) (-904.347) [-903.519] (-908.554) * (-906.696) (-904.501) (-909.896) [-902.732] -- 0:00:49 153500 -- (-904.068) (-903.656) (-903.777) [-905.255] * (-906.546) [-906.122] (-902.394) (-902.835) -- 0:00:49 154000 -- (-906.894) (-906.580) (-902.666) [-902.111] * [-902.845] (-903.898) (-903.664) (-902.508) -- 0:00:49 154500 -- [-906.155] (-902.989) (-903.009) (-903.509) * [-901.544] (-904.099) (-903.509) (-903.992) -- 0:00:54 155000 -- (-909.849) [-906.857] (-902.560) (-903.597) * [-902.956] (-904.578) (-902.219) (-901.584) -- 0:00:54 Average standard deviation of split frequencies: 0.019562 155500 -- (-905.479) (-909.369) (-904.672) [-903.345] * [-901.568] (-906.042) (-901.830) (-903.724) -- 0:00:54 156000 -- [-904.818] (-906.988) (-904.988) (-905.346) * (-904.208) (-904.780) [-903.880] (-904.644) -- 0:00:54 156500 -- (-907.430) [-902.022] (-903.377) (-903.228) * (-904.649) [-902.857] (-904.161) (-905.002) -- 0:00:53 157000 -- (-906.460) (-902.287) [-904.766] (-903.554) * (-903.597) (-902.197) (-902.442) [-904.436] -- 0:00:53 157500 -- (-908.321) (-905.681) (-903.080) [-902.827] * [-902.036] (-902.996) (-903.226) (-903.864) -- 0:00:53 158000 -- (-905.118) (-913.643) (-903.296) [-903.641] * (-902.135) [-901.785] (-905.493) (-906.430) -- 0:00:53 158500 -- (-906.295) (-901.617) [-902.046] (-904.190) * (-903.764) [-904.595] (-904.440) (-905.028) -- 0:00:53 159000 -- (-904.469) [-904.691] (-904.258) (-903.761) * [-902.745] (-904.535) (-903.891) (-904.412) -- 0:00:52 159500 -- (-903.347) (-902.880) (-904.506) [-902.874] * (-902.842) (-909.453) [-907.226] (-902.244) -- 0:00:52 160000 -- (-902.554) (-904.187) [-904.399] (-901.728) * (-902.653) (-904.966) [-902.879] (-902.927) -- 0:00:52 Average standard deviation of split frequencies: 0.020375 160500 -- (-903.211) [-902.300] (-907.047) (-902.698) * (-901.911) (-907.312) (-902.640) [-902.532] -- 0:00:52 161000 -- (-904.088) [-901.958] (-905.171) (-902.792) * (-902.297) (-902.664) (-904.992) [-908.477] -- 0:00:52 161500 -- (-906.268) (-901.856) (-904.470) [-902.056] * (-901.913) (-902.388) [-903.992] (-901.951) -- 0:00:51 162000 -- (-905.637) [-901.914] (-905.522) (-903.187) * (-904.556) (-904.217) [-902.264] (-902.168) -- 0:00:51 162500 -- (-904.918) (-903.801) [-905.433] (-904.141) * (-903.803) (-905.241) (-902.872) [-903.090] -- 0:00:51 163000 -- [-902.362] (-904.235) (-903.925) (-903.427) * (-905.015) [-905.224] (-904.750) (-904.184) -- 0:00:51 163500 -- (-906.898) (-905.087) (-904.047) [-901.953] * [-902.912] (-903.302) (-903.821) (-907.591) -- 0:00:51 164000 -- [-904.696] (-906.121) (-904.795) (-904.136) * (-905.129) (-908.739) (-902.211) [-905.297] -- 0:00:50 164500 -- [-904.809] (-903.161) (-902.577) (-903.712) * (-901.536) [-903.466] (-903.177) (-904.965) -- 0:00:50 165000 -- [-904.315] (-903.256) (-903.584) (-905.202) * (-901.552) (-903.029) [-903.068] (-903.694) -- 0:00:50 Average standard deviation of split frequencies: 0.019405 165500 -- (-905.933) [-905.056] (-903.492) (-906.566) * [-901.648] (-902.991) (-902.095) (-908.193) -- 0:00:50 166000 -- (-904.894) (-902.696) [-903.147] (-904.189) * (-902.507) (-904.302) [-901.685] (-905.823) -- 0:00:50 166500 -- (-905.060) (-905.133) (-908.485) [-902.842] * (-903.170) [-904.009] (-903.993) (-903.419) -- 0:00:50 167000 -- (-907.212) [-905.428] (-902.564) (-903.699) * [-904.063] (-903.335) (-903.889) (-903.291) -- 0:00:49 167500 -- (-906.108) (-902.350) [-903.325] (-905.353) * (-905.126) [-903.175] (-903.445) (-903.085) -- 0:00:49 168000 -- (-902.722) (-902.005) [-903.742] (-905.841) * (-903.049) [-904.608] (-908.246) (-902.692) -- 0:00:49 168500 -- [-904.254] (-901.571) (-904.797) (-906.997) * (-904.305) (-902.788) (-901.832) [-903.895] -- 0:00:49 169000 -- (-905.939) [-902.936] (-904.043) (-905.414) * [-904.192] (-904.986) (-903.938) (-903.389) -- 0:00:49 169500 -- (-909.240) [-902.104] (-903.622) (-902.734) * (-906.013) (-902.252) [-902.042] (-914.736) -- 0:00:48 170000 -- [-904.162] (-903.086) (-908.683) (-902.347) * (-903.417) (-902.719) (-903.101) [-905.245] -- 0:00:48 Average standard deviation of split frequencies: 0.017954 170500 -- [-905.730] (-904.562) (-901.821) (-902.645) * (-904.908) [-902.617] (-902.557) (-901.428) -- 0:00:53 171000 -- (-906.566) (-909.581) (-901.943) [-903.603] * (-907.644) [-902.719] (-905.031) (-903.417) -- 0:00:53 171500 -- (-905.914) (-903.752) (-904.759) [-903.173] * [-905.670] (-902.293) (-903.834) (-903.918) -- 0:00:53 172000 -- (-904.221) (-906.071) [-902.097] (-901.472) * (-902.425) (-902.639) [-902.259] (-904.038) -- 0:00:52 172500 -- (-902.916) (-906.209) [-902.880] (-902.618) * (-902.384) (-905.517) [-905.613] (-904.617) -- 0:00:52 173000 -- (-902.911) (-904.352) (-902.695) [-903.156] * (-903.680) (-903.459) [-904.099] (-903.159) -- 0:00:52 173500 -- [-902.206] (-907.410) (-901.925) (-904.887) * (-901.778) (-902.792) [-904.958] (-904.479) -- 0:00:52 174000 -- (-901.898) (-903.139) (-904.764) [-901.811] * (-902.178) (-903.965) [-904.217] (-911.274) -- 0:00:52 174500 -- (-901.757) [-904.802] (-906.446) (-902.650) * [-901.493] (-902.193) (-904.029) (-907.582) -- 0:00:52 175000 -- (-902.585) [-906.514] (-903.231) (-902.471) * (-902.842) [-903.119] (-903.196) (-902.042) -- 0:00:51 Average standard deviation of split frequencies: 0.016353 175500 -- (-908.178) (-903.947) [-907.776] (-903.870) * (-902.113) (-902.134) [-903.198] (-903.303) -- 0:00:51 176000 -- (-901.791) (-904.199) (-906.073) [-904.915] * [-909.208] (-901.311) (-902.513) (-903.460) -- 0:00:51 176500 -- (-903.915) (-905.264) (-909.946) [-903.604] * [-909.688] (-904.525) (-902.206) (-902.728) -- 0:00:51 177000 -- (-904.062) (-904.037) (-904.707) [-903.137] * (-903.713) [-905.615] (-902.985) (-903.221) -- 0:00:51 177500 -- (-901.898) [-903.960] (-903.179) (-903.104) * (-903.049) (-902.243) (-903.492) [-902.215] -- 0:00:50 178000 -- (-902.107) (-902.745) (-905.693) [-903.969] * (-902.302) [-905.184] (-902.763) (-903.535) -- 0:00:50 178500 -- [-903.349] (-903.035) (-905.381) (-905.305) * (-903.465) (-902.520) [-902.049] (-903.697) -- 0:00:50 179000 -- (-903.957) (-907.549) (-903.900) [-902.621] * (-907.107) (-902.284) (-902.509) [-904.985] -- 0:00:50 179500 -- (-904.527) (-908.190) [-904.633] (-903.476) * [-902.761] (-904.730) (-902.807) (-904.739) -- 0:00:50 180000 -- (-903.180) (-903.852) [-906.352] (-905.721) * (-906.388) [-902.283] (-902.416) (-902.291) -- 0:00:50 Average standard deviation of split frequencies: 0.015366 180500 -- (-903.520) [-903.078] (-903.983) (-903.678) * [-903.927] (-903.929) (-902.315) (-905.679) -- 0:00:49 181000 -- (-904.712) (-903.137) [-903.422] (-905.184) * (-904.079) (-904.439) [-903.933] (-904.550) -- 0:00:49 181500 -- [-903.525] (-901.456) (-903.200) (-903.432) * (-905.631) (-902.210) (-904.138) [-902.708] -- 0:00:49 182000 -- [-902.301] (-902.230) (-904.137) (-902.796) * (-905.899) (-904.213) (-903.603) [-902.757] -- 0:00:49 182500 -- (-902.197) (-903.340) [-904.187] (-903.855) * [-903.152] (-903.593) (-902.377) (-905.987) -- 0:00:49 183000 -- (-903.033) (-904.103) (-903.878) [-902.915] * (-905.673) [-904.111] (-902.441) (-907.336) -- 0:00:49 183500 -- (-903.818) (-902.713) (-903.357) [-904.668] * (-901.787) (-902.233) (-905.095) [-905.838] -- 0:00:48 184000 -- (-904.816) (-902.149) (-903.723) [-904.982] * [-904.200] (-902.986) (-902.979) (-906.878) -- 0:00:48 184500 -- (-902.770) (-905.292) (-902.989) [-903.713] * [-903.176] (-903.178) (-903.514) (-901.303) -- 0:00:48 185000 -- (-901.952) [-904.257] (-903.385) (-904.527) * (-903.502) [-902.339] (-903.161) (-901.621) -- 0:00:48 Average standard deviation of split frequencies: 0.016140 185500 -- (-902.863) [-905.768] (-905.197) (-902.623) * (-903.480) [-902.605] (-904.208) (-904.989) -- 0:00:48 186000 -- [-902.629] (-906.303) (-903.130) (-902.598) * [-902.257] (-905.895) (-903.569) (-905.713) -- 0:00:52 186500 -- (-902.717) [-907.723] (-905.999) (-905.878) * [-902.895] (-905.994) (-903.351) (-905.765) -- 0:00:52 187000 -- [-903.404] (-902.503) (-903.230) (-904.554) * (-903.372) (-904.173) [-903.737] (-907.097) -- 0:00:52 187500 -- (-904.189) [-901.748] (-903.001) (-904.848) * [-906.011] (-907.159) (-902.816) (-907.239) -- 0:00:52 188000 -- (-902.709) [-902.570] (-907.173) (-907.021) * (-902.839) [-903.665] (-904.066) (-903.522) -- 0:00:51 188500 -- (-905.382) (-902.114) [-905.069] (-904.167) * (-907.817) [-906.329] (-903.113) (-903.385) -- 0:00:51 189000 -- (-905.313) (-902.478) (-904.514) [-902.696] * [-903.637] (-903.903) (-904.861) (-902.699) -- 0:00:51 189500 -- [-904.626] (-902.427) (-902.974) (-905.544) * (-904.559) [-903.191] (-903.420) (-901.910) -- 0:00:51 190000 -- (-903.302) (-901.873) [-902.976] (-905.333) * [-904.850] (-902.103) (-903.769) (-904.548) -- 0:00:51 Average standard deviation of split frequencies: 0.015355 190500 -- (-901.327) (-903.831) (-903.798) [-903.448] * (-901.967) (-902.137) [-906.278] (-905.132) -- 0:00:50 191000 -- (-905.184) (-902.628) (-903.981) [-902.251] * (-903.154) (-901.876) (-902.830) [-902.517] -- 0:00:50 191500 -- (-903.658) (-902.846) [-901.974] (-901.396) * [-902.108] (-904.412) (-903.306) (-904.204) -- 0:00:50 192000 -- (-902.507) (-903.056) (-901.551) [-903.038] * (-905.395) (-904.996) [-905.586] (-905.220) -- 0:00:50 192500 -- (-904.332) (-904.074) [-903.229] (-904.254) * (-904.272) (-903.422) [-904.765] (-903.249) -- 0:00:50 193000 -- (-901.382) (-903.262) [-903.227] (-905.765) * (-906.966) (-904.096) (-903.677) [-903.722] -- 0:00:50 193500 -- (-902.617) [-903.853] (-901.789) (-901.545) * (-901.981) (-905.169) [-903.328] (-903.313) -- 0:00:50 194000 -- (-902.667) [-904.614] (-902.137) (-902.713) * [-901.785] (-904.580) (-906.313) (-904.150) -- 0:00:49 194500 -- (-903.787) (-903.403) (-901.893) [-902.925] * (-902.421) (-906.955) [-903.113] (-902.935) -- 0:00:49 195000 -- (-902.893) (-903.989) (-902.866) [-902.469] * (-904.749) (-904.452) (-902.569) [-905.081] -- 0:00:49 Average standard deviation of split frequencies: 0.014431 195500 -- (-903.962) (-902.617) (-902.286) [-906.001] * [-903.675] (-904.082) (-903.108) (-901.570) -- 0:00:49 196000 -- (-903.218) (-904.685) (-909.540) [-904.726] * (-907.007) [-904.928] (-902.553) (-903.692) -- 0:00:49 196500 -- (-902.308) (-903.098) [-906.511] (-903.473) * (-906.773) (-904.280) [-901.826] (-902.372) -- 0:00:49 197000 -- [-901.908] (-904.226) (-906.540) (-903.210) * [-903.738] (-904.611) (-903.788) (-902.036) -- 0:00:48 197500 -- (-902.870) (-903.183) [-904.864] (-903.585) * (-905.343) (-902.632) (-903.243) [-902.543] -- 0:00:48 198000 -- (-902.874) (-903.449) (-902.191) [-905.217] * (-902.528) (-902.652) (-903.545) [-902.799] -- 0:00:48 198500 -- (-904.769) [-903.291] (-903.630) (-904.912) * [-903.182] (-902.636) (-902.196) (-902.778) -- 0:00:48 199000 -- (-902.737) (-903.194) (-904.323) [-904.973] * [-903.596] (-906.639) (-902.653) (-902.673) -- 0:00:48 199500 -- (-903.818) (-906.492) (-905.021) [-901.529] * [-905.703] (-904.075) (-901.616) (-903.684) -- 0:00:48 200000 -- [-901.583] (-905.436) (-902.096) (-902.449) * (-904.244) (-905.596) [-904.796] (-905.421) -- 0:00:48 Average standard deviation of split frequencies: 0.015753 200500 -- (-902.340) (-904.700) (-902.468) [-904.004] * (-903.119) (-902.655) (-903.408) [-902.475] -- 0:00:47 201000 -- [-902.321] (-906.368) (-904.106) (-905.071) * (-904.865) (-901.811) [-908.747] (-904.142) -- 0:00:47 201500 -- (-902.780) (-906.176) (-901.930) [-903.600] * (-905.762) (-902.406) (-902.525) [-902.896] -- 0:00:51 202000 -- (-904.789) (-902.873) [-903.115] (-903.458) * (-902.033) (-902.490) [-902.023] (-904.756) -- 0:00:51 202500 -- (-907.326) [-904.577] (-906.378) (-905.196) * [-901.797] (-902.206) (-903.602) (-903.477) -- 0:00:51 203000 -- (-907.792) (-903.750) (-902.594) [-903.650] * (-904.744) (-905.836) (-905.587) [-903.641] -- 0:00:51 203500 -- [-903.422] (-903.743) (-905.166) (-904.877) * [-903.705] (-903.114) (-906.062) (-906.048) -- 0:00:50 204000 -- (-905.385) (-903.485) [-905.598] (-903.574) * (-907.233) (-903.105) [-904.534] (-906.057) -- 0:00:50 204500 -- (-904.466) (-902.337) (-903.050) [-905.305] * (-903.476) (-903.102) (-904.012) [-902.829] -- 0:00:50 205000 -- (-902.474) [-901.422] (-902.516) (-902.364) * [-903.615] (-903.973) (-903.334) (-905.402) -- 0:00:50 Average standard deviation of split frequencies: 0.014814 205500 -- [-905.637] (-903.403) (-903.706) (-902.451) * [-907.263] (-904.700) (-903.504) (-903.242) -- 0:00:50 206000 -- (-904.142) [-902.943] (-905.149) (-902.715) * [-902.761] (-904.677) (-902.453) (-905.140) -- 0:00:50 206500 -- (-903.799) (-902.572) (-907.029) [-902.264] * (-904.361) (-902.487) [-904.931] (-901.917) -- 0:00:49 207000 -- (-904.863) (-903.060) (-905.014) [-902.524] * (-905.113) (-903.715) (-904.364) [-903.602] -- 0:00:49 207500 -- (-902.116) [-901.547] (-903.634) (-905.926) * (-904.660) [-905.259] (-903.254) (-904.820) -- 0:00:49 208000 -- (-903.448) (-905.340) [-904.422] (-905.200) * [-903.175] (-902.116) (-902.363) (-903.141) -- 0:00:49 208500 -- [-904.192] (-905.860) (-906.019) (-904.341) * (-905.665) [-901.816] (-903.935) (-903.263) -- 0:00:49 209000 -- [-903.136] (-903.217) (-902.404) (-903.553) * (-906.747) (-902.498) (-903.136) [-910.015] -- 0:00:49 209500 -- (-902.256) (-906.186) [-902.376] (-901.516) * (-904.139) (-903.678) [-902.286] (-903.474) -- 0:00:49 210000 -- (-903.384) (-903.189) [-903.399] (-902.749) * (-904.455) (-903.110) [-902.871] (-903.660) -- 0:00:48 Average standard deviation of split frequencies: 0.013191 210500 -- (-903.346) (-903.692) [-903.554] (-903.759) * (-901.948) [-902.562] (-906.083) (-902.761) -- 0:00:48 211000 -- [-902.050] (-904.040) (-903.792) (-903.347) * [-903.292] (-901.743) (-903.384) (-905.416) -- 0:00:48 211500 -- (-902.523) (-904.077) [-901.821] (-905.552) * [-901.930] (-901.946) (-902.896) (-904.951) -- 0:00:48 212000 -- (-904.714) (-902.527) (-905.011) [-903.303] * (-903.457) [-901.801] (-903.878) (-906.887) -- 0:00:48 212500 -- (-904.837) [-902.095] (-903.274) (-903.259) * (-903.161) [-901.558] (-903.240) (-901.511) -- 0:00:48 213000 -- (-907.788) (-901.524) (-902.591) [-901.759] * (-903.397) (-903.907) (-905.016) [-901.349] -- 0:00:48 213500 -- [-906.974] (-903.481) (-905.355) (-904.160) * (-909.316) (-903.026) [-903.855] (-903.746) -- 0:00:47 214000 -- (-902.630) [-901.946] (-910.039) (-903.792) * (-901.668) (-901.474) [-903.643] (-901.709) -- 0:00:47 214500 -- (-902.289) [-904.095] (-903.464) (-907.530) * (-902.454) (-901.189) [-902.553] (-901.656) -- 0:00:47 215000 -- [-902.385] (-902.802) (-903.889) (-903.395) * (-902.980) (-901.320) (-903.723) [-901.717] -- 0:00:47 Average standard deviation of split frequencies: 0.013943 215500 -- [-903.348] (-903.847) (-905.916) (-903.760) * [-903.112] (-905.453) (-902.113) (-902.436) -- 0:00:47 216000 -- (-905.035) [-905.051] (-905.454) (-903.740) * (-906.871) (-914.280) (-901.551) [-901.437] -- 0:00:47 216500 -- (-904.101) (-903.963) [-903.425] (-903.916) * (-903.004) [-902.096] (-901.479) (-901.833) -- 0:00:47 217000 -- (-904.647) [-903.409] (-902.427) (-902.569) * (-903.290) [-902.790] (-904.196) (-902.142) -- 0:00:46 217500 -- (-902.618) [-904.836] (-905.530) (-907.661) * [-905.790] (-902.636) (-901.687) (-904.576) -- 0:00:46 218000 -- (-901.473) (-905.408) (-903.567) [-905.572] * (-903.468) [-902.211] (-901.558) (-903.472) -- 0:00:50 218500 -- (-902.784) [-902.874] (-902.439) (-905.231) * (-902.637) [-902.366] (-904.591) (-904.576) -- 0:00:50 219000 -- (-904.806) (-903.254) (-902.349) [-905.944] * (-903.417) (-904.855) (-903.185) [-905.280] -- 0:00:49 219500 -- (-901.867) (-905.752) (-905.154) [-904.001] * [-902.116] (-905.632) (-902.885) (-904.513) -- 0:00:49 220000 -- [-903.110] (-902.215) (-902.645) (-901.628) * [-901.662] (-902.642) (-902.168) (-904.369) -- 0:00:49 Average standard deviation of split frequencies: 0.013055 220500 -- (-904.882) (-901.551) [-903.641] (-904.135) * [-901.828] (-905.769) (-904.337) (-902.819) -- 0:00:49 221000 -- (-906.331) [-903.136] (-909.260) (-903.969) * [-904.079] (-902.464) (-904.893) (-901.956) -- 0:00:49 221500 -- [-906.570] (-901.873) (-904.918) (-903.262) * (-905.563) (-903.237) [-904.198] (-901.328) -- 0:00:49 222000 -- (-908.752) (-904.242) [-904.616] (-904.601) * (-903.570) (-902.899) (-904.664) [-901.473] -- 0:00:49 222500 -- (-903.589) [-902.244] (-906.659) (-908.273) * (-904.015) [-902.603] (-904.977) (-904.305) -- 0:00:48 223000 -- [-903.291] (-905.325) (-903.875) (-906.844) * (-912.588) (-904.006) [-905.762] (-904.857) -- 0:00:48 223500 -- (-902.359) [-902.458] (-906.409) (-902.386) * [-908.170] (-903.678) (-902.074) (-903.008) -- 0:00:48 224000 -- [-901.824] (-903.690) (-907.626) (-904.974) * (-908.610) [-904.880] (-902.303) (-902.442) -- 0:00:48 224500 -- [-903.816] (-901.533) (-907.090) (-906.759) * (-905.943) (-903.748) (-906.975) [-903.428] -- 0:00:48 225000 -- (-902.982) [-902.190] (-905.732) (-905.011) * (-904.508) (-904.805) (-906.383) [-902.740] -- 0:00:48 Average standard deviation of split frequencies: 0.012747 225500 -- (-903.423) (-902.931) [-902.586] (-907.284) * [-910.474] (-905.687) (-903.079) (-906.069) -- 0:00:48 226000 -- (-907.978) (-903.319) [-904.163] (-902.144) * (-907.408) (-903.831) (-902.018) [-902.281] -- 0:00:47 226500 -- (-905.883) (-905.007) (-903.534) [-902.417] * (-908.569) (-906.191) [-905.328] (-902.479) -- 0:00:47 227000 -- (-904.832) (-905.781) [-905.875] (-902.800) * (-905.048) (-904.071) (-904.522) [-903.790] -- 0:00:47 227500 -- (-903.008) (-913.643) [-903.721] (-907.030) * (-904.254) (-903.426) [-903.342] (-902.761) -- 0:00:47 228000 -- (-905.869) (-903.799) (-907.423) [-906.851] * (-902.217) [-901.801] (-902.808) (-903.761) -- 0:00:47 228500 -- (-905.417) (-901.469) [-904.903] (-905.781) * (-903.309) (-902.453) [-906.659] (-905.858) -- 0:00:47 229000 -- (-905.214) (-901.913) (-902.568) [-902.374] * (-907.016) (-902.352) (-902.437) [-903.729] -- 0:00:47 229500 -- (-905.156) [-904.729] (-902.458) (-904.594) * (-902.985) [-903.024] (-902.795) (-907.569) -- 0:00:47 230000 -- (-905.524) [-903.533] (-905.962) (-904.330) * (-905.857) (-902.976) [-902.627] (-907.252) -- 0:00:46 Average standard deviation of split frequencies: 0.012830 230500 -- (-906.569) (-902.382) [-902.883] (-902.451) * (-902.787) (-901.455) [-903.215] (-902.905) -- 0:00:46 231000 -- (-906.975) (-901.869) (-903.480) [-907.620] * (-907.408) (-901.553) (-903.406) [-902.306] -- 0:00:46 231500 -- (-907.928) [-904.302] (-903.160) (-902.614) * (-906.057) (-906.405) (-904.410) [-902.833] -- 0:00:46 232000 -- (-905.465) (-906.514) [-903.754] (-903.626) * (-903.529) (-901.987) [-905.843] (-905.241) -- 0:00:46 232500 -- (-906.329) (-903.891) [-904.061] (-902.763) * (-902.469) (-903.147) [-903.755] (-903.435) -- 0:00:46 233000 -- [-902.246] (-909.806) (-905.944) (-902.880) * (-905.920) (-903.262) [-902.324] (-904.744) -- 0:00:46 233500 -- (-902.101) [-901.588] (-903.425) (-901.674) * (-902.853) (-905.114) (-902.639) [-902.519] -- 0:00:45 234000 -- (-907.488) (-902.644) (-901.653) [-902.041] * (-906.404) (-904.885) (-902.351) [-902.728] -- 0:00:49 234500 -- (-907.892) [-902.226] (-901.379) (-901.911) * [-902.596] (-903.670) (-903.827) (-903.355) -- 0:00:48 235000 -- [-903.706] (-905.599) (-902.104) (-902.134) * [-903.829] (-902.301) (-902.847) (-903.371) -- 0:00:48 Average standard deviation of split frequencies: 0.011541 235500 -- (-905.558) [-905.863] (-901.672) (-904.269) * (-904.035) [-902.149] (-902.128) (-903.840) -- 0:00:48 236000 -- (-903.047) (-905.167) (-903.914) [-902.280] * (-905.676) [-905.597] (-902.469) (-905.633) -- 0:00:48 236500 -- (-904.592) (-903.229) (-904.023) [-903.408] * (-904.739) (-902.566) (-901.542) [-904.661] -- 0:00:48 237000 -- (-902.983) (-905.210) (-908.300) [-902.471] * (-902.318) (-902.376) [-903.159] (-903.129) -- 0:00:48 237500 -- (-902.912) [-903.064] (-904.397) (-907.351) * [-902.319] (-901.942) (-904.180) (-904.579) -- 0:00:48 238000 -- [-903.714] (-902.052) (-905.229) (-903.684) * (-902.149) (-902.688) (-901.962) [-910.579] -- 0:00:48 238500 -- (-904.912) [-905.096] (-905.839) (-903.596) * [-905.947] (-904.050) (-903.554) (-904.884) -- 0:00:47 239000 -- (-905.047) (-903.800) [-904.093] (-903.348) * (-902.976) [-903.485] (-903.739) (-903.796) -- 0:00:47 239500 -- [-906.516] (-904.046) (-904.664) (-909.874) * (-903.982) [-902.775] (-903.911) (-901.982) -- 0:00:47 240000 -- (-902.763) (-902.218) [-902.530] (-902.688) * (-902.812) (-905.045) (-903.952) [-903.050] -- 0:00:47 Average standard deviation of split frequencies: 0.011317 240500 -- (-902.564) (-903.209) [-902.653] (-903.074) * [-904.618] (-903.360) (-902.833) (-902.996) -- 0:00:47 241000 -- (-903.871) [-904.595] (-902.522) (-909.417) * (-905.030) (-901.862) [-911.781] (-904.158) -- 0:00:47 241500 -- (-905.606) [-904.525] (-905.263) (-903.821) * (-908.405) [-906.202] (-910.547) (-903.155) -- 0:00:47 242000 -- (-902.053) (-905.406) (-904.846) [-905.155] * (-908.222) (-903.250) (-902.682) [-903.339] -- 0:00:46 242500 -- (-903.754) [-902.756] (-905.988) (-902.738) * (-903.965) (-902.189) (-903.494) [-902.921] -- 0:00:46 243000 -- (-906.155) [-903.209] (-905.183) (-902.644) * (-901.625) [-903.277] (-905.901) (-902.524) -- 0:00:46 243500 -- (-904.319) (-905.937) (-903.995) [-904.748] * (-902.628) (-905.218) [-902.893] (-907.492) -- 0:00:46 244000 -- (-902.975) (-903.399) [-906.894] (-902.557) * (-908.168) (-904.523) [-903.548] (-902.758) -- 0:00:46 244500 -- [-902.124] (-903.149) (-907.751) (-902.501) * (-906.806) [-904.775] (-903.372) (-901.842) -- 0:00:46 245000 -- (-903.735) (-902.007) (-905.316) [-902.217] * (-903.259) (-908.734) (-907.474) [-903.690] -- 0:00:46 Average standard deviation of split frequencies: 0.011604 245500 -- (-903.399) (-904.341) [-901.822] (-904.648) * (-902.790) (-902.282) [-904.438] (-906.686) -- 0:00:46 246000 -- (-903.889) [-905.291] (-902.798) (-905.449) * (-905.447) (-904.133) (-903.995) [-904.124] -- 0:00:45 246500 -- [-904.833] (-904.084) (-901.689) (-905.098) * (-905.631) (-904.029) [-906.820] (-904.246) -- 0:00:45 247000 -- (-901.399) (-905.277) [-901.837] (-902.132) * (-904.045) (-907.439) [-903.892] (-903.914) -- 0:00:45 247500 -- (-901.755) (-904.263) [-902.151] (-902.869) * (-903.685) (-905.924) [-903.008] (-902.145) -- 0:00:45 248000 -- (-903.725) (-905.518) [-904.102] (-902.677) * (-903.720) (-904.857) [-903.488] (-902.125) -- 0:00:45 248500 -- (-903.653) [-903.658] (-904.467) (-903.799) * (-906.279) (-906.169) (-903.862) [-902.124] -- 0:00:45 249000 -- (-903.026) (-905.177) [-902.047] (-902.904) * (-907.057) (-902.840) (-902.418) [-904.919] -- 0:00:45 249500 -- (-903.983) (-906.058) [-904.534] (-902.301) * [-902.865] (-903.164) (-902.660) (-904.173) -- 0:00:48 250000 -- [-904.202] (-906.007) (-909.876) (-902.601) * (-902.859) (-901.883) (-903.161) [-902.866] -- 0:00:48 Average standard deviation of split frequencies: 0.011388 250500 -- (-905.061) [-902.153] (-904.596) (-905.397) * [-903.785] (-902.761) (-905.274) (-902.616) -- 0:00:47 251000 -- (-904.096) [-901.828] (-904.426) (-905.806) * (-903.144) [-903.271] (-901.878) (-903.475) -- 0:00:47 251500 -- (-903.395) [-901.829] (-903.054) (-902.117) * (-902.893) (-906.369) [-902.509] (-904.260) -- 0:00:47 252000 -- (-903.359) (-903.481) (-901.764) [-903.006] * [-906.089] (-904.258) (-902.392) (-902.898) -- 0:00:47 252500 -- [-903.167] (-902.915) (-903.105) (-903.430) * (-902.725) [-902.465] (-901.538) (-905.276) -- 0:00:47 253000 -- [-901.386] (-905.382) (-903.398) (-904.168) * [-901.642] (-902.072) (-902.631) (-903.125) -- 0:00:47 253500 -- (-901.628) [-904.510] (-902.603) (-906.198) * (-903.414) (-903.473) [-903.242] (-902.978) -- 0:00:47 254000 -- [-903.382] (-901.775) (-903.725) (-903.891) * (-902.211) (-902.499) (-903.067) [-906.508] -- 0:00:46 254500 -- (-903.291) (-902.289) [-903.657] (-904.883) * (-901.849) (-902.448) (-903.070) [-903.862] -- 0:00:46 255000 -- (-905.373) [-903.059] (-904.332) (-902.648) * (-906.020) [-904.171] (-901.803) (-903.336) -- 0:00:46 Average standard deviation of split frequencies: 0.011355 255500 -- (-904.754) [-904.197] (-902.426) (-903.029) * (-904.461) (-903.740) [-905.542] (-902.659) -- 0:00:46 256000 -- [-903.995] (-901.796) (-903.665) (-906.304) * (-902.685) [-903.610] (-903.169) (-904.635) -- 0:00:46 256500 -- (-903.373) [-902.593] (-905.469) (-903.233) * [-902.314] (-905.255) (-905.475) (-902.212) -- 0:00:46 257000 -- (-904.642) (-905.844) [-903.515] (-905.454) * [-903.496] (-906.932) (-904.434) (-902.415) -- 0:00:46 257500 -- (-903.156) (-904.375) (-904.939) [-904.177] * (-905.343) (-902.182) (-906.487) [-902.925] -- 0:00:46 258000 -- (-905.621) (-904.451) (-904.018) [-904.000] * (-902.675) (-901.917) [-906.324] (-905.530) -- 0:00:46 258500 -- [-902.727] (-907.289) (-904.279) (-902.431) * (-902.426) (-901.910) (-909.551) [-907.382] -- 0:00:45 259000 -- [-902.350] (-906.376) (-904.961) (-901.913) * (-904.177) (-901.658) [-906.353] (-903.911) -- 0:00:45 259500 -- (-903.655) (-903.305) [-902.810] (-901.292) * [-902.533] (-904.004) (-902.186) (-901.882) -- 0:00:45 260000 -- (-902.510) (-906.120) (-902.884) [-905.418] * (-902.195) (-902.154) [-901.936] (-904.899) -- 0:00:45 Average standard deviation of split frequencies: 0.011052 260500 -- (-902.407) (-904.447) (-902.126) [-902.198] * (-905.060) (-906.235) [-901.968] (-902.561) -- 0:00:45 261000 -- (-907.662) [-904.866] (-904.233) (-903.235) * (-904.584) (-902.734) [-902.158] (-906.270) -- 0:00:45 261500 -- (-906.052) (-903.403) (-908.666) [-902.462] * (-906.983) [-905.304] (-905.048) (-910.088) -- 0:00:45 262000 -- (-901.934) [-903.143] (-904.592) (-902.502) * (-908.736) (-902.943) [-902.305] (-904.954) -- 0:00:45 262500 -- (-902.078) [-901.479] (-904.685) (-902.895) * (-903.948) (-902.244) [-902.471] (-903.410) -- 0:00:44 263000 -- [-903.485] (-902.797) (-904.967) (-903.388) * [-901.858] (-907.291) (-902.238) (-906.857) -- 0:00:44 263500 -- (-909.982) (-903.479) [-904.285] (-905.390) * [-901.656] (-904.251) (-904.136) (-905.148) -- 0:00:44 264000 -- [-907.472] (-902.289) (-904.670) (-902.729) * (-905.300) (-904.738) (-904.366) [-902.264] -- 0:00:44 264500 -- (-904.414) (-902.619) [-903.789] (-906.404) * (-903.163) [-905.037] (-905.588) (-907.934) -- 0:00:47 265000 -- (-902.597) (-902.174) (-904.176) [-904.067] * (-907.060) (-905.066) (-902.997) [-903.751] -- 0:00:47 Average standard deviation of split frequencies: 0.010436 265500 -- [-902.104] (-902.757) (-904.754) (-904.157) * (-908.504) (-903.136) (-902.487) [-902.375] -- 0:00:47 266000 -- (-902.983) (-902.061) [-903.689] (-903.215) * [-902.044] (-902.995) (-903.975) (-902.444) -- 0:00:46 266500 -- [-903.100] (-902.643) (-902.620) (-905.887) * (-904.387) (-904.699) (-905.115) [-904.735] -- 0:00:46 267000 -- [-901.856] (-903.598) (-904.408) (-905.087) * (-902.829) (-902.870) (-903.591) [-907.243] -- 0:00:46 267500 -- (-902.286) (-903.333) [-903.677] (-907.524) * (-904.098) (-903.617) (-903.549) [-903.121] -- 0:00:46 268000 -- (-903.665) (-903.482) (-905.928) [-902.286] * (-902.120) (-906.192) (-906.401) [-902.505] -- 0:00:46 268500 -- (-904.263) (-904.189) (-903.162) [-902.863] * (-904.396) (-904.555) (-906.403) [-902.740] -- 0:00:46 269000 -- (-908.187) (-902.125) [-904.406] (-906.682) * (-906.460) (-907.558) [-902.836] (-901.817) -- 0:00:46 269500 -- [-902.332] (-901.580) (-905.324) (-906.015) * (-903.037) (-904.465) (-907.302) [-902.095] -- 0:00:46 270000 -- (-903.969) (-903.841) (-902.500) [-904.860] * (-906.099) (-905.760) [-911.532] (-907.748) -- 0:00:45 Average standard deviation of split frequencies: 0.009579 270500 -- (-909.609) (-904.743) (-905.610) [-904.887] * (-902.162) [-904.869] (-909.000) (-907.904) -- 0:00:45 271000 -- (-902.356) (-902.383) [-903.074] (-902.596) * (-902.918) [-903.692] (-906.574) (-904.635) -- 0:00:45 271500 -- (-901.681) (-902.538) (-904.739) [-902.700] * [-902.405] (-906.908) (-905.195) (-902.711) -- 0:00:45 272000 -- (-903.892) (-903.291) [-902.961] (-902.271) * (-903.518) (-902.221) (-902.835) [-902.102] -- 0:00:45 272500 -- [-904.418] (-906.897) (-903.307) (-903.964) * (-904.179) (-902.623) [-902.543] (-903.429) -- 0:00:45 273000 -- (-907.837) (-903.275) [-904.014] (-903.241) * (-903.444) (-903.026) [-902.455] (-903.274) -- 0:00:45 273500 -- (-903.363) (-903.509) [-902.404] (-907.975) * [-906.249] (-902.541) (-908.715) (-903.625) -- 0:00:45 274000 -- (-902.599) (-902.580) (-904.993) [-903.198] * (-904.083) [-905.081] (-907.588) (-903.146) -- 0:00:45 274500 -- (-902.422) (-904.283) (-904.554) [-904.202] * [-904.014] (-903.608) (-905.186) (-909.019) -- 0:00:44 275000 -- (-903.785) (-903.622) [-904.523] (-908.686) * [-903.304] (-902.639) (-903.855) (-901.680) -- 0:00:44 Average standard deviation of split frequencies: 0.009204 275500 -- (-910.267) (-907.921) (-903.658) [-902.301] * (-902.345) (-906.147) (-903.868) [-902.062] -- 0:00:44 276000 -- [-903.591] (-910.986) (-904.580) (-903.983) * (-902.375) (-902.626) (-903.275) [-904.910] -- 0:00:44 276500 -- [-901.533] (-907.988) (-904.733) (-902.178) * (-902.693) (-902.094) (-904.671) [-905.228] -- 0:00:44 277000 -- (-905.102) (-907.307) (-909.848) [-905.724] * [-902.398] (-904.213) (-908.295) (-904.184) -- 0:00:44 277500 -- (-903.093) [-902.940] (-905.323) (-901.931) * (-906.123) (-903.905) [-901.300] (-904.543) -- 0:00:44 278000 -- (-904.201) (-906.927) [-905.195] (-902.420) * [-902.991] (-904.072) (-902.808) (-902.572) -- 0:00:44 278500 -- [-905.204] (-902.562) (-907.087) (-901.918) * [-902.486] (-905.195) (-901.533) (-902.510) -- 0:00:44 279000 -- (-901.987) (-903.691) (-906.235) [-902.190] * [-902.971] (-905.518) (-905.117) (-904.041) -- 0:00:43 279500 -- [-903.749] (-903.270) (-903.793) (-903.184) * [-901.726] (-913.218) (-902.891) (-903.228) -- 0:00:43 280000 -- (-903.520) (-902.177) [-905.431] (-902.124) * [-902.165] (-904.472) (-904.549) (-903.820) -- 0:00:43 Average standard deviation of split frequencies: 0.010357 280500 -- (-904.425) (-905.893) (-904.102) [-903.324] * [-907.240] (-903.556) (-902.617) (-906.534) -- 0:00:43 281000 -- (-902.775) (-909.003) [-905.421] (-903.130) * (-902.403) (-906.085) (-902.511) [-905.977] -- 0:00:46 281500 -- [-901.953] (-908.615) (-904.794) (-903.486) * (-902.213) [-907.086] (-901.348) (-902.631) -- 0:00:45 282000 -- (-904.632) [-902.163] (-902.835) (-903.389) * (-902.364) [-902.120] (-902.439) (-903.430) -- 0:00:45 282500 -- (-902.785) (-904.299) [-902.258] (-906.651) * (-902.552) (-906.532) [-902.012] (-905.184) -- 0:00:45 283000 -- (-901.800) [-903.859] (-902.762) (-908.323) * (-903.835) (-904.015) (-903.453) [-902.864] -- 0:00:45 283500 -- [-901.816] (-905.244) (-901.711) (-902.683) * [-903.728] (-904.187) (-903.239) (-905.266) -- 0:00:45 284000 -- [-904.374] (-904.041) (-903.296) (-902.955) * (-901.771) [-903.036] (-905.341) (-903.467) -- 0:00:45 284500 -- (-902.335) (-908.121) [-903.614] (-903.853) * (-901.544) (-903.144) [-902.485] (-901.840) -- 0:00:45 285000 -- (-902.473) (-905.105) (-903.115) [-905.045] * (-902.743) (-904.656) (-902.191) [-902.193] -- 0:00:45 Average standard deviation of split frequencies: 0.009890 285500 -- (-903.271) (-909.208) (-903.338) [-904.151] * (-903.877) (-904.705) (-910.503) [-902.978] -- 0:00:45 286000 -- [-905.477] (-904.684) (-904.416) (-904.705) * (-903.120) [-902.875] (-902.445) (-903.459) -- 0:00:44 286500 -- (-904.912) (-907.179) [-904.851] (-903.246) * (-909.286) [-903.725] (-906.476) (-902.034) -- 0:00:44 287000 -- (-905.287) (-906.760) [-903.710] (-904.689) * [-902.029] (-903.524) (-905.618) (-901.362) -- 0:00:44 287500 -- (-906.349) [-904.712] (-903.273) (-901.667) * [-905.143] (-903.436) (-902.869) (-902.817) -- 0:00:44 288000 -- (-904.783) (-902.589) (-902.696) [-902.684] * (-906.996) [-903.106] (-902.353) (-905.312) -- 0:00:44 288500 -- (-908.735) (-901.941) [-903.356] (-903.723) * (-902.442) (-904.176) [-903.864] (-902.113) -- 0:00:44 289000 -- (-903.505) (-902.042) (-906.084) [-903.069] * (-902.383) [-901.859] (-901.480) (-905.215) -- 0:00:44 289500 -- [-902.730] (-901.967) (-904.088) (-902.306) * (-904.530) (-902.281) (-902.517) [-907.153] -- 0:00:44 290000 -- (-901.410) (-904.630) [-904.309] (-904.572) * (-902.805) [-902.096] (-903.045) (-908.519) -- 0:00:44 Average standard deviation of split frequencies: 0.010812 290500 -- (-904.641) (-905.068) [-902.459] (-904.029) * (-903.242) [-902.192] (-904.894) (-908.039) -- 0:00:43 291000 -- (-902.086) [-902.804] (-902.459) (-904.153) * (-902.447) (-901.767) [-906.019] (-909.191) -- 0:00:43 291500 -- (-902.969) (-907.504) [-902.121] (-905.477) * [-901.656] (-902.235) (-906.099) (-905.388) -- 0:00:43 292000 -- (-902.913) (-911.014) (-902.460) [-902.640] * (-901.785) [-903.966] (-903.930) (-905.187) -- 0:00:43 292500 -- (-905.448) (-902.565) (-901.696) [-907.324] * (-904.594) (-902.346) (-903.182) [-904.207] -- 0:00:43 293000 -- (-910.871) [-905.091] (-901.696) (-905.519) * (-903.538) (-903.618) [-901.991] (-902.476) -- 0:00:43 293500 -- (-904.979) [-902.056] (-905.070) (-902.737) * (-904.025) (-902.641) (-905.473) [-902.537] -- 0:00:43 294000 -- (-909.768) (-902.295) (-907.073) [-904.464] * [-902.916] (-903.285) (-905.661) (-903.082) -- 0:00:43 294500 -- (-902.583) (-903.308) (-908.870) [-903.448] * (-905.746) [-904.024] (-906.806) (-906.142) -- 0:00:43 295000 -- [-902.400] (-902.971) (-902.476) (-904.410) * (-903.260) (-902.858) (-902.127) [-903.006] -- 0:00:43 Average standard deviation of split frequencies: 0.011237 295500 -- [-901.937] (-905.170) (-902.973) (-904.994) * (-904.516) [-903.245] (-902.528) (-903.360) -- 0:00:42 296000 -- (-905.029) (-907.276) (-903.032) [-903.220] * (-903.013) [-901.912] (-903.463) (-903.655) -- 0:00:42 296500 -- [-904.215] (-904.487) (-905.037) (-902.902) * (-903.044) (-907.320) [-904.738] (-907.577) -- 0:00:42 297000 -- [-903.751] (-904.989) (-906.940) (-907.207) * [-904.724] (-903.660) (-905.291) (-904.479) -- 0:00:44 297500 -- (-902.133) (-902.719) [-903.864] (-904.836) * (-911.906) [-901.647] (-903.635) (-904.063) -- 0:00:44 298000 -- [-903.706] (-903.220) (-903.829) (-905.366) * [-903.070] (-903.229) (-902.344) (-906.189) -- 0:00:44 298500 -- [-901.656] (-905.345) (-902.717) (-903.763) * (-903.515) (-903.261) [-903.644] (-904.372) -- 0:00:44 299000 -- [-903.186] (-904.527) (-904.181) (-902.241) * [-903.739] (-903.241) (-902.815) (-906.656) -- 0:00:44 299500 -- (-902.294) (-904.594) (-903.921) [-903.455] * (-905.414) [-903.809] (-902.089) (-903.125) -- 0:00:44 300000 -- (-905.774) [-902.667] (-904.042) (-906.114) * (-905.964) (-907.064) (-902.448) [-902.955] -- 0:00:44 Average standard deviation of split frequencies: 0.010191 300500 -- (-905.055) (-904.262) (-904.656) [-901.936] * [-902.787] (-905.513) (-901.482) (-904.510) -- 0:00:44 301000 -- (-903.185) [-904.724] (-903.627) (-903.468) * [-904.705] (-908.505) (-902.313) (-903.384) -- 0:00:44 301500 -- (-902.174) (-905.167) (-902.481) [-902.555] * (-902.761) (-904.549) [-901.882] (-904.523) -- 0:00:44 302000 -- (-903.203) [-908.107] (-904.289) (-906.716) * (-907.270) (-904.454) [-903.083] (-903.311) -- 0:00:43 302500 -- (-903.695) (-908.447) [-903.421] (-905.210) * (-913.831) (-903.738) (-903.140) [-906.207] -- 0:00:43 303000 -- (-902.636) (-905.302) (-902.724) [-904.023] * (-909.726) (-901.791) [-906.300] (-905.889) -- 0:00:43 303500 -- (-905.559) (-904.762) [-903.201] (-908.419) * (-904.441) [-901.905] (-905.845) (-904.260) -- 0:00:43 304000 -- (-902.380) (-903.481) [-901.887] (-902.360) * [-901.935] (-901.710) (-904.600) (-903.404) -- 0:00:43 304500 -- (-903.309) (-901.931) (-901.794) [-901.974] * (-905.005) [-904.877] (-906.049) (-905.058) -- 0:00:43 305000 -- (-902.318) (-904.271) (-902.056) [-902.224] * (-903.616) (-902.915) [-901.511] (-905.058) -- 0:00:43 Average standard deviation of split frequencies: 0.010185 305500 -- (-902.060) (-904.191) (-905.502) [-901.778] * (-902.460) (-903.032) [-903.163] (-905.075) -- 0:00:43 306000 -- (-905.425) (-903.557) (-903.420) [-901.823] * [-902.432] (-902.154) (-904.269) (-906.710) -- 0:00:43 306500 -- (-904.360) (-902.997) (-904.269) [-903.273] * (-904.857) (-904.839) (-904.269) [-905.391] -- 0:00:42 307000 -- (-906.767) (-906.430) [-902.012] (-907.614) * (-910.634) [-903.568] (-904.316) (-903.104) -- 0:00:42 307500 -- (-902.768) (-903.711) [-903.496] (-902.539) * (-905.495) (-903.801) (-903.133) [-911.074] -- 0:00:42 308000 -- (-903.894) (-905.759) [-903.730] (-906.837) * (-903.241) [-903.206] (-902.387) (-907.052) -- 0:00:42 308500 -- (-905.506) (-904.088) [-903.168] (-905.074) * (-901.528) (-904.740) (-903.819) [-903.316] -- 0:00:42 309000 -- (-907.406) (-902.971) [-904.516] (-903.766) * [-904.724] (-904.159) (-907.403) (-901.857) -- 0:00:42 309500 -- (-911.654) (-903.876) [-903.629] (-909.602) * (-902.075) (-903.154) [-903.137] (-904.055) -- 0:00:42 310000 -- (-906.777) (-904.674) (-905.936) [-901.969] * (-901.813) [-902.836] (-905.422) (-904.603) -- 0:00:42 Average standard deviation of split frequencies: 0.010622 310500 -- (-909.203) [-903.757] (-908.158) (-904.084) * (-903.306) (-902.285) [-903.959] (-904.228) -- 0:00:42 311000 -- (-906.938) (-904.275) (-902.489) [-903.531] * (-901.752) (-902.069) (-904.182) [-904.094] -- 0:00:42 311500 -- [-907.969] (-903.778) (-903.988) (-902.735) * (-902.525) [-905.647] (-905.273) (-905.998) -- 0:00:41 312000 -- (-905.736) [-904.242] (-904.416) (-904.163) * [-902.616] (-905.341) (-907.266) (-902.131) -- 0:00:41 312500 -- [-903.461] (-906.533) (-903.334) (-903.167) * (-903.792) [-904.368] (-907.196) (-902.076) -- 0:00:41 313000 -- [-903.276] (-906.470) (-905.758) (-902.713) * (-905.715) (-903.988) [-904.434] (-905.207) -- 0:00:41 313500 -- (-902.972) (-905.558) [-903.932] (-902.186) * (-903.120) (-904.090) (-905.321) [-903.859] -- 0:00:43 314000 -- (-904.734) (-906.334) (-903.566) [-903.278] * (-905.742) (-902.723) (-903.591) [-903.399] -- 0:00:43 314500 -- (-903.672) (-904.573) (-903.747) [-905.191] * (-903.353) [-902.161] (-902.017) (-903.357) -- 0:00:43 315000 -- (-908.385) [-903.257] (-903.900) (-902.882) * (-901.985) (-908.549) [-902.134] (-902.091) -- 0:00:43 Average standard deviation of split frequencies: 0.011271 315500 -- [-905.107] (-903.282) (-903.614) (-904.858) * (-902.539) (-907.326) (-902.302) [-903.228] -- 0:00:43 316000 -- [-902.037] (-901.539) (-902.938) (-903.819) * [-902.346] (-903.135) (-904.527) (-904.585) -- 0:00:43 316500 -- [-901.725] (-902.862) (-902.191) (-901.973) * (-904.860) (-901.946) [-901.750] (-904.182) -- 0:00:43 317000 -- [-903.161] (-904.288) (-902.005) (-902.294) * (-904.262) (-901.496) [-902.756] (-903.644) -- 0:00:43 317500 -- (-903.009) (-904.283) [-902.010] (-903.570) * [-903.355] (-903.337) (-901.922) (-906.229) -- 0:00:42 318000 -- [-902.757] (-901.930) (-905.061) (-903.246) * [-904.238] (-902.864) (-903.363) (-904.132) -- 0:00:42 318500 -- (-903.644) (-904.447) (-905.562) [-903.994] * [-903.998] (-903.260) (-902.720) (-903.798) -- 0:00:42 319000 -- [-902.410] (-902.485) (-907.546) (-903.506) * [-902.689] (-901.795) (-904.580) (-903.871) -- 0:00:42 319500 -- (-906.041) [-902.449] (-903.992) (-901.984) * (-904.293) [-902.519] (-902.631) (-902.393) -- 0:00:42 320000 -- (-905.283) (-902.823) (-904.654) [-901.843] * (-905.092) (-905.143) (-903.712) [-902.230] -- 0:00:42 Average standard deviation of split frequencies: 0.012087 320500 -- (-903.102) [-903.275] (-906.010) (-901.891) * (-905.383) [-903.745] (-905.561) (-902.230) -- 0:00:42 321000 -- (-902.344) [-902.216] (-906.099) (-902.890) * (-902.847) (-902.534) [-902.838] (-903.246) -- 0:00:42 321500 -- (-905.149) (-903.818) [-903.448] (-905.253) * (-902.740) (-904.529) (-907.878) [-904.235] -- 0:00:42 322000 -- (-907.237) (-901.482) [-902.807] (-902.197) * (-903.201) (-902.351) [-905.615] (-905.853) -- 0:00:42 322500 -- (-904.987) [-904.203] (-902.248) (-903.327) * (-902.319) (-903.235) (-903.344) [-905.764] -- 0:00:42 323000 -- [-903.396] (-904.372) (-902.212) (-908.430) * (-908.171) [-903.158] (-906.888) (-902.497) -- 0:00:41 323500 -- [-902.048] (-904.027) (-902.567) (-905.547) * (-906.510) (-901.469) (-903.503) [-903.121] -- 0:00:41 324000 -- [-901.871] (-901.822) (-908.336) (-904.436) * (-906.771) (-903.767) [-903.258] (-902.980) -- 0:00:41 324500 -- [-905.512] (-907.293) (-907.069) (-903.192) * (-901.874) (-905.063) (-902.125) [-905.045] -- 0:00:41 325000 -- [-902.873] (-903.368) (-905.278) (-903.114) * (-901.919) (-902.164) [-902.454] (-905.232) -- 0:00:41 Average standard deviation of split frequencies: 0.013577 325500 -- (-902.557) (-905.450) [-904.381] (-906.221) * (-901.913) [-903.778] (-904.600) (-908.340) -- 0:00:41 326000 -- (-903.635) (-910.031) (-903.602) [-904.820] * [-903.221] (-903.940) (-903.496) (-903.518) -- 0:00:41 326500 -- (-905.560) (-904.367) [-905.573] (-901.844) * [-902.673] (-903.135) (-904.401) (-902.476) -- 0:00:41 327000 -- (-906.794) (-905.791) (-903.816) [-903.713] * (-903.971) (-905.957) (-905.793) [-907.560] -- 0:00:41 327500 -- (-903.635) [-904.622] (-906.145) (-905.142) * (-907.164) (-902.422) (-902.141) [-903.233] -- 0:00:41 328000 -- [-903.581] (-906.037) (-905.004) (-904.515) * [-907.549] (-902.063) (-905.316) (-903.581) -- 0:00:40 328500 -- [-903.332] (-905.937) (-903.320) (-906.005) * [-908.104] (-904.749) (-904.614) (-903.018) -- 0:00:40 329000 -- (-903.063) (-906.566) (-904.385) [-902.535] * [-903.317] (-903.087) (-903.023) (-902.324) -- 0:00:40 329500 -- (-902.776) (-905.347) [-905.555] (-903.796) * (-904.994) (-903.350) (-904.007) [-902.267] -- 0:00:40 330000 -- (-903.430) [-903.069] (-904.234) (-906.039) * (-903.305) [-902.737] (-904.428) (-904.533) -- 0:00:42 Average standard deviation of split frequencies: 0.012118 330500 -- (-903.598) (-902.299) (-905.043) [-907.389] * (-903.559) [-903.513] (-902.294) (-904.038) -- 0:00:42 331000 -- (-905.094) [-906.486] (-905.632) (-904.007) * (-903.393) [-903.741] (-903.697) (-904.290) -- 0:00:42 331500 -- (-909.300) (-904.779) (-908.003) [-903.237] * [-901.953] (-904.846) (-902.019) (-903.372) -- 0:00:42 332000 -- (-902.303) (-902.132) (-908.063) [-904.648] * (-906.473) (-901.379) [-903.199] (-902.124) -- 0:00:42 332500 -- (-902.806) (-901.892) (-905.321) [-906.246] * (-902.472) (-901.391) [-903.984] (-903.289) -- 0:00:42 333000 -- (-902.305) (-904.231) [-903.353] (-905.190) * [-903.042] (-904.070) (-905.164) (-902.258) -- 0:00:42 333500 -- (-910.984) (-904.282) [-902.872] (-904.409) * (-901.518) [-902.766] (-902.697) (-902.050) -- 0:00:41 334000 -- (-902.605) [-903.556] (-904.209) (-906.531) * (-905.259) (-901.420) [-904.369] (-903.176) -- 0:00:41 334500 -- (-907.129) (-903.933) (-903.742) [-905.701] * [-901.590] (-901.386) (-902.919) (-902.911) -- 0:00:41 335000 -- (-904.353) (-902.922) (-903.686) [-904.665] * [-902.206] (-904.388) (-905.016) (-907.581) -- 0:00:41 Average standard deviation of split frequencies: 0.011536 335500 -- (-908.529) (-902.337) [-903.893] (-901.230) * (-902.820) (-902.713) [-902.552] (-906.928) -- 0:00:41 336000 -- (-904.631) [-904.580] (-903.262) (-901.219) * (-902.932) (-906.228) [-901.861] (-904.545) -- 0:00:41 336500 -- [-903.870] (-906.268) (-906.094) (-903.620) * (-903.033) [-904.601] (-905.654) (-901.489) -- 0:00:41 337000 -- (-905.035) [-903.798] (-902.819) (-904.971) * (-902.421) (-906.535) (-903.160) [-903.079] -- 0:00:41 337500 -- (-905.822) [-902.942] (-904.961) (-905.991) * (-901.520) (-903.551) [-905.371] (-903.549) -- 0:00:41 338000 -- (-903.735) [-904.801] (-905.046) (-904.661) * (-902.444) [-901.763] (-903.721) (-903.792) -- 0:00:41 338500 -- [-903.563] (-903.745) (-901.736) (-905.562) * (-904.027) (-902.122) [-903.965] (-903.455) -- 0:00:41 339000 -- (-903.718) (-902.863) (-906.737) [-904.301] * (-903.756) (-904.810) [-904.036] (-903.731) -- 0:00:40 339500 -- (-901.857) [-902.276] (-904.137) (-912.153) * (-904.455) (-903.333) [-905.936] (-902.360) -- 0:00:40 340000 -- [-905.595] (-904.256) (-903.062) (-905.409) * [-902.594] (-903.963) (-902.364) (-903.466) -- 0:00:40 Average standard deviation of split frequencies: 0.012454 340500 -- (-901.362) (-905.524) (-907.023) [-903.721] * (-902.300) [-902.766] (-909.021) (-902.676) -- 0:00:40 341000 -- [-903.576] (-904.390) (-902.132) (-903.992) * (-905.474) (-905.198) [-903.542] (-904.042) -- 0:00:40 341500 -- (-901.855) [-902.760] (-902.399) (-903.702) * (-905.619) (-903.637) [-902.777] (-906.704) -- 0:00:40 342000 -- (-903.493) (-903.420) [-904.774] (-903.811) * [-903.084] (-902.387) (-903.638) (-906.273) -- 0:00:40 342500 -- (-902.314) (-904.620) (-903.168) [-902.841] * (-903.226) [-903.069] (-906.107) (-904.177) -- 0:00:40 343000 -- [-902.584] (-904.722) (-902.765) (-902.334) * [-903.839] (-904.422) (-905.227) (-903.210) -- 0:00:40 343500 -- (-904.934) (-902.977) [-902.891] (-902.663) * (-901.655) (-904.796) [-902.133] (-903.734) -- 0:00:40 344000 -- (-904.744) (-902.291) (-902.330) [-902.760] * (-901.818) [-909.678] (-902.396) (-906.417) -- 0:00:40 344500 -- (-903.726) (-906.359) [-902.296] (-902.725) * (-903.325) [-904.265] (-906.802) (-902.932) -- 0:00:39 345000 -- (-903.699) (-908.901) (-903.840) [-906.177] * (-904.869) (-901.454) (-905.539) [-906.611] -- 0:00:41 Average standard deviation of split frequencies: 0.011505 345500 -- (-904.803) (-904.240) [-902.414] (-902.489) * (-903.753) (-907.888) [-906.261] (-903.466) -- 0:00:41 346000 -- (-904.860) (-908.227) [-904.409] (-903.424) * (-903.417) (-910.028) (-905.530) [-903.367] -- 0:00:41 346500 -- (-906.803) (-903.699) (-905.224) [-904.418] * (-902.574) (-906.424) (-903.370) [-903.033] -- 0:00:41 347000 -- [-905.851] (-909.736) (-905.202) (-902.831) * (-904.332) (-903.729) (-905.550) [-903.527] -- 0:00:41 347500 -- (-903.969) (-901.844) [-903.245] (-902.497) * (-902.670) (-902.905) [-902.040] (-903.025) -- 0:00:41 348000 -- (-906.175) (-901.835) (-904.679) [-901.894] * (-907.789) [-904.531] (-901.982) (-907.446) -- 0:00:41 348500 -- (-908.811) (-902.036) [-902.471] (-903.580) * [-902.411] (-903.661) (-903.154) (-904.587) -- 0:00:41 349000 -- (-904.968) [-901.676] (-910.070) (-905.035) * (-902.234) (-905.565) [-902.694] (-903.078) -- 0:00:41 349500 -- [-903.268] (-904.216) (-906.229) (-909.873) * [-904.780] (-905.712) (-901.565) (-903.929) -- 0:00:40 350000 -- (-902.585) (-905.698) (-911.382) [-905.103] * (-905.750) (-902.648) [-902.481] (-904.157) -- 0:00:40 Average standard deviation of split frequencies: 0.012920 350500 -- [-904.490] (-905.474) (-908.781) (-905.020) * (-906.267) (-903.920) (-903.041) [-904.358] -- 0:00:40 351000 -- (-902.516) (-905.627) [-902.509] (-902.281) * (-906.327) (-903.830) (-904.534) [-904.735] -- 0:00:40 351500 -- (-902.280) (-903.998) (-903.110) [-904.934] * (-902.217) (-906.706) (-905.929) [-907.757] -- 0:00:40 352000 -- (-904.122) [-906.388] (-902.954) (-905.851) * (-903.178) (-903.640) [-905.136] (-902.828) -- 0:00:40 352500 -- [-903.580] (-905.811) (-903.028) (-906.486) * (-902.737) [-902.494] (-904.126) (-905.012) -- 0:00:40 353000 -- (-902.173) [-902.394] (-901.967) (-908.442) * (-902.474) (-902.823) [-904.161] (-902.156) -- 0:00:40 353500 -- (-903.408) [-902.930] (-906.465) (-903.896) * (-902.929) (-904.008) (-901.765) [-906.047] -- 0:00:40 354000 -- (-906.215) (-903.343) (-906.862) [-903.752] * (-903.849) (-904.204) (-903.570) [-902.569] -- 0:00:40 354500 -- [-903.387] (-904.387) (-904.482) (-901.707) * (-906.741) [-901.802] (-902.350) (-903.280) -- 0:00:40 355000 -- [-906.460] (-904.558) (-903.066) (-904.033) * (-903.711) [-902.091] (-901.672) (-902.084) -- 0:00:39 Average standard deviation of split frequencies: 0.013904 355500 -- (-903.427) (-903.121) [-902.086] (-904.229) * (-902.611) (-901.383) [-902.539] (-902.383) -- 0:00:39 356000 -- (-904.056) (-906.003) [-904.981] (-909.160) * (-904.341) (-903.506) (-902.763) [-903.593] -- 0:00:39 356500 -- [-903.354] (-905.007) (-901.744) (-906.035) * (-906.011) [-902.254] (-902.059) (-904.139) -- 0:00:39 357000 -- (-903.250) (-902.820) [-903.246] (-905.727) * (-909.904) [-903.722] (-904.557) (-903.520) -- 0:00:39 357500 -- (-903.657) (-905.728) [-901.797] (-904.574) * (-903.882) (-903.463) (-905.041) [-906.027] -- 0:00:39 358000 -- (-902.632) [-904.131] (-901.930) (-902.513) * (-906.939) [-901.907] (-906.125) (-906.519) -- 0:00:39 358500 -- (-902.835) (-906.208) [-901.216] (-903.458) * (-906.095) [-904.277] (-904.101) (-902.955) -- 0:00:41 359000 -- (-904.415) (-904.302) (-902.150) [-902.255] * (-903.779) (-903.189) (-904.443) [-903.728] -- 0:00:41 359500 -- (-904.917) (-906.143) (-904.512) [-901.799] * [-904.735] (-904.229) (-906.370) (-904.063) -- 0:00:40 360000 -- [-902.751] (-907.686) (-907.226) (-902.815) * [-903.150] (-903.880) (-908.692) (-903.666) -- 0:00:40 Average standard deviation of split frequencies: 0.013916 360500 -- (-905.743) [-904.151] (-903.655) (-903.676) * (-908.430) (-905.747) [-902.306] (-903.779) -- 0:00:40 361000 -- (-903.824) (-904.016) (-906.908) [-902.290] * (-903.334) (-903.649) [-903.738] (-906.379) -- 0:00:40 361500 -- (-903.552) (-904.155) (-907.808) [-904.697] * (-904.370) [-903.029] (-903.084) (-902.443) -- 0:00:40 362000 -- [-903.119] (-905.419) (-905.120) (-903.584) * [-903.967] (-904.289) (-903.986) (-902.852) -- 0:00:40 362500 -- [-902.562] (-904.234) (-902.518) (-906.077) * (-903.204) [-902.565] (-908.347) (-904.398) -- 0:00:40 363000 -- (-903.089) [-902.363] (-902.792) (-905.414) * [-903.932] (-903.437) (-903.302) (-901.709) -- 0:00:40 363500 -- (-902.348) (-904.827) [-902.822] (-909.247) * (-903.942) (-905.185) (-902.467) [-901.461] -- 0:00:40 364000 -- (-902.240) (-904.544) [-904.389] (-904.908) * (-904.431) (-903.929) [-902.188] (-902.153) -- 0:00:40 364500 -- (-905.335) [-903.571] (-912.767) (-903.324) * (-902.532) (-903.907) (-902.183) [-902.282] -- 0:00:40 365000 -- (-902.125) (-902.891) [-905.582] (-902.742) * (-904.295) (-905.216) (-903.550) [-901.763] -- 0:00:40 Average standard deviation of split frequencies: 0.013941 365500 -- (-903.943) (-903.230) (-904.102) [-902.201] * [-904.550] (-903.486) (-907.439) (-902.020) -- 0:00:39 366000 -- (-902.348) (-902.887) [-904.700] (-902.226) * [-903.386] (-901.243) (-905.513) (-902.741) -- 0:00:39 366500 -- [-902.978] (-902.218) (-903.164) (-901.962) * (-904.185) [-902.724] (-903.703) (-903.049) -- 0:00:39 367000 -- (-905.428) (-902.168) (-904.503) [-902.340] * (-905.882) (-903.075) (-903.400) [-901.678] -- 0:00:39 367500 -- (-903.680) [-902.069] (-906.448) (-902.195) * [-907.927] (-902.680) (-905.097) (-902.850) -- 0:00:39 368000 -- [-903.849] (-902.429) (-903.945) (-903.511) * (-905.117) [-905.621] (-905.002) (-902.850) -- 0:00:39 368500 -- (-905.229) (-903.658) [-904.687] (-905.054) * (-903.439) (-902.922) [-901.675] (-905.113) -- 0:00:39 369000 -- (-907.461) (-903.660) [-905.419] (-907.461) * [-902.166] (-903.521) (-902.073) (-902.195) -- 0:00:39 369500 -- (-905.996) [-902.731] (-906.062) (-902.832) * (-902.292) [-902.208] (-906.205) (-906.344) -- 0:00:39 370000 -- (-903.939) [-901.650] (-911.276) (-902.856) * (-904.380) [-905.927] (-903.387) (-904.778) -- 0:00:39 Average standard deviation of split frequencies: 0.013840 370500 -- (-903.568) (-902.387) [-905.861] (-902.548) * [-903.700] (-903.311) (-906.206) (-908.515) -- 0:00:39 371000 -- (-907.012) [-903.676] (-908.248) (-905.315) * (-905.329) (-903.756) (-903.673) [-903.679] -- 0:00:38 371500 -- [-903.244] (-904.320) (-905.084) (-903.410) * (-906.621) (-903.764) [-907.299] (-903.660) -- 0:00:38 372000 -- (-903.852) [-905.342] (-906.118) (-905.136) * [-902.366] (-903.908) (-905.275) (-902.692) -- 0:00:38 372500 -- (-903.750) (-904.121) [-901.585] (-904.073) * (-904.217) (-903.306) (-901.449) [-902.359] -- 0:00:38 373000 -- [-903.915] (-907.402) (-902.153) (-903.849) * (-905.022) [-903.099] (-903.308) (-902.760) -- 0:00:38 373500 -- (-904.457) [-902.264] (-903.774) (-904.252) * (-904.572) [-901.996] (-903.819) (-903.315) -- 0:00:40 374000 -- (-903.934) [-903.799] (-903.645) (-905.625) * (-906.415) (-903.693) [-902.021] (-903.621) -- 0:00:40 374500 -- [-902.971] (-904.726) (-903.386) (-904.613) * (-906.251) [-904.298] (-902.998) (-904.163) -- 0:00:40 375000 -- (-902.582) (-903.385) [-903.229] (-903.805) * (-903.949) (-902.089) [-907.424] (-902.461) -- 0:00:40 Average standard deviation of split frequencies: 0.013349 375500 -- [-902.288] (-905.362) (-902.669) (-903.151) * [-902.629] (-904.440) (-902.721) (-904.876) -- 0:00:39 376000 -- (-902.457) (-903.412) [-902.627] (-907.259) * (-904.531) [-904.198] (-903.227) (-905.450) -- 0:00:39 376500 -- (-901.627) (-905.528) (-903.895) [-905.256] * (-902.816) (-904.963) [-903.335] (-909.387) -- 0:00:39 377000 -- (-902.669) [-905.248] (-905.539) (-906.654) * [-903.948] (-904.056) (-904.402) (-904.385) -- 0:00:39 377500 -- (-902.096) (-906.229) (-902.931) [-903.782] * (-909.198) [-904.115] (-909.325) (-902.149) -- 0:00:39 378000 -- (-903.682) (-905.406) (-903.700) [-902.370] * (-905.091) (-906.508) (-905.677) [-902.906] -- 0:00:39 378500 -- [-904.294] (-901.837) (-903.559) (-901.752) * (-907.947) (-901.510) (-902.378) [-902.674] -- 0:00:39 379000 -- (-903.577) (-901.692) [-909.709] (-904.148) * (-905.772) [-902.095] (-904.426) (-901.977) -- 0:00:39 379500 -- [-904.173] (-901.875) (-905.897) (-904.607) * (-904.940) (-904.233) (-907.385) [-902.806] -- 0:00:39 380000 -- (-903.121) (-903.270) [-905.053] (-902.090) * (-904.046) [-906.181] (-907.271) (-902.555) -- 0:00:39 Average standard deviation of split frequencies: 0.014205 380500 -- (-904.110) [-903.463] (-902.851) (-909.970) * [-901.810] (-912.799) (-903.225) (-905.064) -- 0:00:39 381000 -- (-905.044) (-902.208) [-902.130] (-905.981) * (-902.534) (-905.890) (-906.211) [-904.748] -- 0:00:38 381500 -- (-903.239) (-902.830) (-904.420) [-903.810] * [-902.071] (-902.145) (-903.067) (-904.176) -- 0:00:38 382000 -- (-904.030) [-903.078] (-905.344) (-904.860) * (-908.230) [-901.940] (-906.408) (-903.708) -- 0:00:38 382500 -- (-904.837) (-903.817) [-903.320] (-901.262) * (-906.207) (-902.148) (-904.838) [-902.807] -- 0:00:38 383000 -- [-902.425] (-902.959) (-903.652) (-901.556) * (-905.078) (-903.063) [-903.204] (-905.400) -- 0:00:38 383500 -- [-903.033] (-902.302) (-903.771) (-903.709) * (-903.662) (-908.645) [-905.611] (-903.484) -- 0:00:38 384000 -- (-903.723) [-904.394] (-903.685) (-904.010) * (-902.449) (-902.720) (-904.248) [-904.837] -- 0:00:38 384500 -- (-904.336) (-906.909) [-903.758] (-906.084) * (-902.925) (-903.793) [-902.892] (-902.092) -- 0:00:38 385000 -- (-905.249) (-906.103) (-902.721) [-906.690] * (-903.672) (-904.283) [-902.750] (-903.624) -- 0:00:38 Average standard deviation of split frequencies: 0.014368 385500 -- [-901.670] (-903.970) (-905.126) (-903.979) * (-902.771) (-902.785) [-902.035] (-903.804) -- 0:00:38 386000 -- (-903.026) [-904.007] (-902.854) (-901.545) * (-904.113) [-903.377] (-903.744) (-902.642) -- 0:00:38 386500 -- (-903.319) (-905.677) [-903.016] (-902.423) * [-902.577] (-905.097) (-906.482) (-902.639) -- 0:00:38 387000 -- (-905.829) (-904.187) (-905.075) [-902.489] * (-902.652) [-903.655] (-905.423) (-902.745) -- 0:00:38 387500 -- (-904.159) (-904.191) [-905.625] (-902.316) * (-902.643) (-902.831) [-902.407] (-905.012) -- 0:00:37 388000 -- [-905.068] (-902.779) (-903.999) (-903.466) * [-901.479] (-903.386) (-902.407) (-902.890) -- 0:00:37 388500 -- (-904.217) [-904.430] (-902.857) (-903.939) * (-901.420) (-905.529) [-902.923] (-903.141) -- 0:00:37 389000 -- [-904.323] (-904.283) (-909.349) (-903.838) * [-901.881] (-903.167) (-903.677) (-907.616) -- 0:00:37 389500 -- [-902.964] (-903.355) (-901.549) (-907.209) * (-906.996) (-906.040) (-902.889) [-903.034] -- 0:00:39 390000 -- (-902.723) (-903.417) (-905.037) [-907.698] * (-906.082) (-906.384) (-902.357) [-904.966] -- 0:00:39 Average standard deviation of split frequencies: 0.013841 390500 -- [-902.225] (-904.312) (-905.408) (-905.337) * (-909.225) (-904.668) [-904.042] (-903.700) -- 0:00:39 391000 -- [-904.501] (-905.157) (-903.008) (-905.214) * (-903.584) [-904.080] (-904.262) (-905.872) -- 0:00:38 391500 -- (-905.947) (-902.272) [-903.272] (-906.181) * (-902.780) [-903.113] (-902.305) (-904.593) -- 0:00:38 392000 -- (-902.240) [-901.885] (-902.798) (-904.281) * [-902.577] (-903.618) (-903.360) (-904.663) -- 0:00:38 392500 -- (-903.083) [-902.805] (-901.869) (-907.555) * (-903.279) (-903.789) [-905.022] (-904.017) -- 0:00:38 393000 -- [-902.777] (-902.147) (-901.895) (-907.220) * [-902.629] (-902.484) (-905.028) (-905.457) -- 0:00:38 393500 -- (-902.002) (-902.430) (-902.632) [-904.291] * (-903.361) (-902.008) [-903.941] (-904.445) -- 0:00:38 394000 -- (-904.031) [-902.195] (-901.638) (-904.898) * (-904.634) [-903.223] (-901.827) (-904.926) -- 0:00:38 394500 -- (-905.038) (-909.134) (-909.657) [-903.071] * (-907.562) (-903.483) (-907.369) [-902.948] -- 0:00:38 395000 -- (-902.565) (-907.075) (-906.777) [-903.186] * (-908.587) [-903.010] (-903.372) (-904.189) -- 0:00:38 Average standard deviation of split frequencies: 0.012744 395500 -- [-903.880] (-910.060) (-906.985) (-906.228) * [-905.371] (-902.322) (-910.253) (-905.459) -- 0:00:38 396000 -- (-903.200) (-907.652) (-901.898) [-905.728] * (-906.048) (-902.830) [-912.487] (-904.519) -- 0:00:38 396500 -- (-905.681) (-904.832) [-905.261] (-904.460) * (-901.938) [-903.503] (-904.634) (-902.629) -- 0:00:38 397000 -- (-904.989) (-902.564) (-905.678) [-908.090] * (-902.481) [-904.742] (-903.960) (-902.628) -- 0:00:37 397500 -- (-905.730) (-902.005) (-902.282) [-906.378] * (-904.501) [-902.976] (-903.008) (-905.215) -- 0:00:37 398000 -- (-901.945) (-903.554) (-903.837) [-902.004] * (-902.708) [-903.086] (-902.659) (-902.149) -- 0:00:37 398500 -- (-903.840) (-905.457) [-904.678] (-903.760) * (-902.002) (-902.512) (-905.800) [-903.014] -- 0:00:37 399000 -- [-901.787] (-910.194) (-911.220) (-903.790) * (-902.484) (-902.823) [-906.090] (-904.678) -- 0:00:37 399500 -- [-903.023] (-905.334) (-904.841) (-901.474) * [-903.039] (-902.992) (-904.851) (-906.450) -- 0:00:37 400000 -- [-901.683] (-903.341) (-905.714) (-902.345) * (-901.615) (-902.994) (-903.285) [-905.441] -- 0:00:37 Average standard deviation of split frequencies: 0.012734 400500 -- (-901.456) (-902.515) [-903.338] (-904.929) * (-901.511) [-902.124] (-903.868) (-901.845) -- 0:00:37 401000 -- (-905.204) [-903.143] (-903.380) (-905.216) * (-904.429) [-906.171] (-903.253) (-903.084) -- 0:00:37 401500 -- (-905.103) (-901.525) (-907.072) [-901.766] * (-904.082) (-909.463) (-904.483) [-902.308] -- 0:00:37 402000 -- (-908.845) (-902.340) (-905.331) [-904.728] * (-902.626) (-907.555) [-903.115] (-907.008) -- 0:00:37 402500 -- [-906.693] (-904.393) (-902.956) (-910.699) * (-903.222) (-905.210) [-901.358] (-903.499) -- 0:00:37 403000 -- (-909.830) (-909.043) [-902.306] (-904.278) * (-902.995) (-906.197) (-903.894) [-902.769] -- 0:00:37 403500 -- (-903.355) (-903.477) (-902.960) [-906.083] * (-905.091) (-904.745) [-902.826] (-904.613) -- 0:00:36 404000 -- (-903.653) (-902.744) [-902.240] (-901.748) * (-905.477) (-905.491) (-903.694) [-903.361] -- 0:00:36 404500 -- (-902.684) (-902.996) (-905.328) [-905.904] * [-907.031] (-907.940) (-904.051) (-903.774) -- 0:00:36 405000 -- (-902.839) [-901.853] (-904.483) (-906.432) * (-902.444) [-901.640] (-903.548) (-903.629) -- 0:00:36 Average standard deviation of split frequencies: 0.013592 405500 -- [-904.630] (-906.631) (-901.789) (-905.247) * [-903.256] (-906.733) (-905.900) (-903.196) -- 0:00:38 406000 -- (-902.884) (-902.194) (-902.546) [-904.527] * (-902.481) (-908.113) [-903.905] (-902.914) -- 0:00:38 406500 -- (-902.034) [-908.121] (-902.087) (-904.262) * [-902.800] (-902.661) (-909.094) (-901.701) -- 0:00:37 407000 -- (-905.207) (-904.351) [-902.174] (-902.497) * [-901.663] (-902.935) (-907.753) (-906.029) -- 0:00:37 407500 -- (-904.550) (-903.037) (-902.083) [-902.766] * (-902.577) [-905.295] (-904.801) (-903.285) -- 0:00:37 408000 -- [-903.291] (-904.596) (-902.085) (-906.111) * (-904.077) (-904.002) [-903.111] (-903.105) -- 0:00:37 408500 -- (-901.795) (-906.052) [-902.057] (-908.687) * (-902.624) [-901.588] (-902.698) (-903.596) -- 0:00:37 409000 -- [-901.960] (-906.478) (-901.447) (-902.252) * (-906.169) (-902.468) [-901.901] (-903.821) -- 0:00:37 409500 -- [-902.389] (-903.509) (-901.501) (-902.406) * (-902.724) (-901.905) [-904.434] (-907.153) -- 0:00:37 410000 -- [-903.173] (-902.419) (-902.875) (-902.863) * (-903.666) [-901.770] (-902.563) (-906.395) -- 0:00:37 Average standard deviation of split frequencies: 0.013707 410500 -- (-902.669) (-902.058) [-903.993] (-903.533) * (-901.857) [-902.809] (-902.707) (-904.080) -- 0:00:37 411000 -- (-903.015) (-904.234) [-904.804] (-902.834) * (-902.119) (-908.436) (-903.007) [-904.255] -- 0:00:37 411500 -- (-903.754) (-904.517) (-904.193) [-906.286] * (-904.896) (-903.948) [-902.189] (-910.588) -- 0:00:37 412000 -- (-903.843) (-905.450) (-906.433) [-903.464] * (-905.355) [-902.314] (-904.485) (-901.544) -- 0:00:37 412500 -- (-901.823) (-907.257) (-905.041) [-902.907] * [-901.478] (-905.960) (-902.404) (-901.794) -- 0:00:37 413000 -- (-901.964) (-904.359) (-902.953) [-904.480] * [-901.638] (-902.574) (-903.373) (-902.085) -- 0:00:36 413500 -- (-901.966) (-902.186) [-907.094] (-903.658) * (-901.992) (-902.466) [-902.484] (-903.530) -- 0:00:36 414000 -- [-902.349] (-903.913) (-912.540) (-902.929) * (-902.935) (-903.107) [-902.554] (-904.393) -- 0:00:36 414500 -- (-903.760) [-904.656] (-904.074) (-901.560) * [-902.987] (-903.393) (-904.221) (-902.593) -- 0:00:36 415000 -- [-903.514] (-902.969) (-905.268) (-901.616) * [-903.643] (-903.903) (-902.264) (-902.226) -- 0:00:36 Average standard deviation of split frequencies: 0.013532 415500 -- (-902.017) (-905.766) (-910.728) [-902.064] * [-901.844] (-904.844) (-902.459) (-903.335) -- 0:00:36 416000 -- (-902.255) (-904.478) (-902.635) [-903.044] * (-902.607) (-901.520) [-902.714] (-903.698) -- 0:00:36 416500 -- [-902.851] (-903.046) (-907.330) (-907.953) * [-903.312] (-903.096) (-902.643) (-903.554) -- 0:00:36 417000 -- [-902.650] (-905.629) (-904.436) (-903.969) * (-904.729) (-905.565) [-903.717] (-906.924) -- 0:00:36 417500 -- (-903.312) (-908.039) (-904.018) [-903.463] * (-903.706) (-904.206) (-902.918) [-903.488] -- 0:00:36 418000 -- [-904.074] (-902.540) (-904.619) (-904.332) * (-902.511) [-904.400] (-902.641) (-907.132) -- 0:00:36 418500 -- (-902.323) [-901.997] (-902.114) (-903.877) * [-902.925] (-904.191) (-906.331) (-905.811) -- 0:00:36 419000 -- (-906.120) (-906.931) [-901.499] (-903.975) * (-905.560) (-903.501) (-902.849) [-903.157] -- 0:00:36 419500 -- (-905.282) [-903.980] (-902.281) (-903.934) * (-903.420) (-903.282) (-902.685) [-904.928] -- 0:00:35 420000 -- (-902.679) [-903.350] (-901.400) (-904.758) * (-904.806) [-904.245] (-902.106) (-904.800) -- 0:00:35 Average standard deviation of split frequencies: 0.013250 420500 -- (-902.240) (-902.761) (-904.221) [-902.882] * (-905.691) (-903.103) (-902.483) [-903.859] -- 0:00:35 421000 -- (-901.759) [-903.529] (-904.146) (-902.406) * (-903.981) [-902.950] (-904.564) (-907.194) -- 0:00:35 421500 -- (-903.443) [-902.810] (-902.018) (-902.861) * (-904.612) [-903.606] (-904.501) (-911.943) -- 0:00:35 422000 -- (-903.204) (-902.718) [-905.293] (-905.386) * [-901.801] (-905.165) (-903.368) (-902.087) -- 0:00:36 422500 -- [-903.813] (-902.494) (-902.158) (-903.000) * (-903.771) [-902.238] (-903.125) (-902.342) -- 0:00:36 423000 -- (-901.754) (-904.676) [-902.481] (-902.332) * (-904.594) (-904.726) [-901.661] (-903.711) -- 0:00:36 423500 -- (-901.311) (-908.180) (-903.110) [-904.847] * (-902.913) (-902.056) [-902.858] (-902.383) -- 0:00:36 424000 -- [-902.307] (-905.107) (-901.859) (-905.305) * (-902.646) (-901.771) [-904.328] (-902.135) -- 0:00:36 424500 -- (-905.753) (-902.916) [-901.855] (-904.304) * (-906.946) (-905.651) [-905.301] (-903.275) -- 0:00:36 425000 -- (-908.680) (-907.082) [-901.799] (-909.225) * [-903.560] (-906.191) (-909.795) (-902.294) -- 0:00:36 Average standard deviation of split frequencies: 0.013402 425500 -- (-904.780) (-906.194) [-906.046] (-910.333) * [-903.620] (-902.730) (-906.123) (-902.785) -- 0:00:36 426000 -- [-903.817] (-906.595) (-902.327) (-902.780) * (-908.767) (-902.050) (-903.224) [-902.951] -- 0:00:36 426500 -- [-902.127] (-904.131) (-909.652) (-903.571) * (-908.390) (-904.759) [-903.275] (-908.126) -- 0:00:36 427000 -- (-902.191) [-903.915] (-909.252) (-904.093) * (-902.821) [-903.186] (-902.098) (-904.563) -- 0:00:36 427500 -- (-904.738) (-902.112) [-903.987] (-903.195) * (-903.781) (-902.998) (-902.608) [-903.642] -- 0:00:36 428000 -- (-903.942) (-904.612) [-904.167] (-902.778) * (-904.424) (-902.991) [-901.194] (-903.664) -- 0:00:36 428500 -- (-902.672) (-905.072) (-903.278) [-902.173] * (-908.876) (-905.130) [-903.236] (-903.520) -- 0:00:36 429000 -- (-903.646) [-907.018] (-906.119) (-902.174) * (-906.490) (-907.948) [-902.260] (-902.672) -- 0:00:35 429500 -- (-903.809) (-905.346) [-902.510] (-903.139) * (-903.621) [-903.562] (-905.067) (-905.839) -- 0:00:35 430000 -- [-903.906] (-905.274) (-903.709) (-904.261) * (-905.291) (-906.911) [-901.463] (-904.689) -- 0:00:35 Average standard deviation of split frequencies: 0.013013 430500 -- (-903.244) (-903.682) [-902.478] (-903.335) * [-905.034] (-901.610) (-906.756) (-903.892) -- 0:00:35 431000 -- (-905.873) (-904.591) (-904.051) [-905.315] * (-908.465) (-902.469) (-902.666) [-904.179] -- 0:00:35 431500 -- (-909.121) [-902.903] (-909.075) (-903.600) * (-910.660) (-902.955) [-904.084] (-903.047) -- 0:00:35 432000 -- [-906.832] (-904.170) (-904.129) (-905.175) * [-907.226] (-904.644) (-902.179) (-903.752) -- 0:00:35 432500 -- (-903.184) (-904.937) (-909.505) [-902.530] * [-908.322] (-902.367) (-903.220) (-903.079) -- 0:00:35 433000 -- (-902.284) [-901.412] (-901.926) (-902.136) * [-905.094] (-901.790) (-902.276) (-902.967) -- 0:00:35 433500 -- (-904.742) [-902.267] (-904.241) (-901.426) * (-903.434) (-901.523) [-904.315] (-902.942) -- 0:00:35 434000 -- (-902.265) (-907.457) [-902.368] (-903.950) * [-903.004] (-908.770) (-902.814) (-903.479) -- 0:00:35 434500 -- (-902.202) (-902.946) [-903.780] (-907.418) * (-903.736) (-903.521) (-905.003) [-901.569] -- 0:00:35 435000 -- (-902.406) [-904.574] (-904.185) (-905.201) * (-903.484) (-901.619) [-902.456] (-904.978) -- 0:00:35 Average standard deviation of split frequencies: 0.012338 435500 -- (-902.574) (-908.373) [-903.786] (-903.229) * (-902.246) (-903.133) [-904.292] (-905.212) -- 0:00:34 436000 -- [-903.226] (-902.045) (-907.645) (-903.710) * (-903.519) (-908.894) (-906.208) [-904.704] -- 0:00:34 436500 -- [-905.642] (-904.322) (-903.861) (-911.687) * [-902.749] (-905.502) (-910.117) (-904.390) -- 0:00:34 437000 -- [-901.649] (-906.171) (-904.313) (-904.580) * (-903.700) (-901.930) [-902.416] (-905.652) -- 0:00:34 437500 -- (-908.523) (-903.157) [-904.833] (-903.302) * [-904.347] (-905.043) (-901.572) (-909.025) -- 0:00:34 438000 -- (-906.916) [-902.056] (-902.559) (-903.211) * (-904.810) (-904.420) (-902.806) [-903.247] -- 0:00:34 438500 -- (-904.490) [-904.003] (-902.782) (-901.819) * (-903.001) (-903.769) [-902.637] (-903.913) -- 0:00:35 439000 -- [-904.036] (-904.355) (-906.644) (-902.735) * (-903.570) (-903.775) [-901.464] (-902.466) -- 0:00:35 439500 -- (-901.722) (-904.512) (-906.528) [-905.810] * [-903.068] (-903.408) (-902.685) (-902.008) -- 0:00:35 440000 -- [-904.455] (-903.638) (-908.219) (-904.178) * (-901.718) [-902.396] (-902.155) (-902.845) -- 0:00:35 Average standard deviation of split frequencies: 0.013253 440500 -- (-903.172) (-904.551) (-903.180) [-904.235] * (-902.203) (-902.882) [-901.979] (-901.986) -- 0:00:35 441000 -- (-904.547) (-907.762) [-905.236] (-906.272) * (-903.962) [-904.378] (-904.755) (-903.447) -- 0:00:35 441500 -- (-908.769) [-904.540] (-903.941) (-903.857) * (-904.888) (-903.241) [-902.510] (-904.580) -- 0:00:35 442000 -- [-905.826] (-903.833) (-904.550) (-903.142) * (-902.364) (-904.429) (-902.182) [-904.494] -- 0:00:35 442500 -- (-904.837) (-902.433) (-908.048) [-903.126] * [-902.951] (-904.410) (-905.226) (-905.943) -- 0:00:35 443000 -- (-904.837) [-902.222] (-903.396) (-904.487) * (-902.814) (-902.750) [-904.649] (-902.557) -- 0:00:35 443500 -- (-902.563) (-902.758) [-902.372] (-901.486) * (-903.892) [-902.523] (-906.304) (-905.710) -- 0:00:35 444000 -- (-901.666) (-902.898) (-906.638) [-901.983] * (-906.585) (-902.857) [-904.036] (-906.160) -- 0:00:35 444500 -- (-903.740) (-904.348) (-902.701) [-902.421] * (-903.159) [-904.425] (-904.189) (-903.150) -- 0:00:34 445000 -- [-903.423] (-906.719) (-904.076) (-904.805) * [-903.833] (-902.804) (-905.641) (-902.539) -- 0:00:34 Average standard deviation of split frequencies: 0.013799 445500 -- (-903.922) (-903.034) (-903.737) [-902.426] * [-902.723] (-905.819) (-902.662) (-902.790) -- 0:00:34 446000 -- (-902.510) [-902.136] (-902.821) (-902.044) * (-901.684) (-901.991) [-903.002] (-904.407) -- 0:00:34 446500 -- (-903.123) (-903.206) (-912.431) [-902.826] * (-903.720) (-904.237) [-901.957] (-903.120) -- 0:00:34 447000 -- (-904.079) [-902.226] (-906.213) (-906.249) * (-903.761) (-903.605) [-903.666] (-904.711) -- 0:00:34 447500 -- [-904.983] (-905.277) (-904.460) (-903.326) * (-902.733) (-902.913) [-902.328] (-906.511) -- 0:00:34 448000 -- (-903.395) (-908.997) (-905.661) [-902.734] * [-903.860] (-905.322) (-902.677) (-903.429) -- 0:00:34 448500 -- (-902.992) (-902.183) (-903.776) [-902.971] * [-902.939] (-903.144) (-901.763) (-903.552) -- 0:00:34 449000 -- (-905.923) (-903.445) [-904.418] (-902.228) * (-902.413) (-902.695) [-904.016] (-906.097) -- 0:00:34 449500 -- (-906.439) (-902.813) (-904.081) [-904.171] * (-902.629) [-904.610] (-902.858) (-902.291) -- 0:00:34 450000 -- [-901.794] (-903.251) (-905.835) (-905.780) * (-902.604) (-904.829) [-905.578] (-902.615) -- 0:00:34 Average standard deviation of split frequencies: 0.013308 450500 -- (-903.284) (-904.096) [-902.768] (-908.434) * [-902.906] (-903.681) (-905.447) (-902.537) -- 0:00:34 451000 -- [-903.671] (-903.080) (-904.537) (-901.862) * (-904.016) (-902.215) [-902.936] (-902.609) -- 0:00:34 451500 -- (-906.908) [-904.030] (-904.246) (-903.739) * (-904.527) (-903.935) (-903.848) [-903.339] -- 0:00:34 452000 -- (-902.919) [-904.922] (-903.700) (-903.791) * [-905.174] (-904.534) (-901.731) (-903.652) -- 0:00:33 452500 -- (-901.695) [-905.795] (-902.935) (-910.001) * (-906.547) (-905.978) (-901.510) [-902.760] -- 0:00:33 453000 -- (-902.448) (-907.076) (-906.484) [-903.822] * (-903.824) (-902.678) [-903.643] (-903.546) -- 0:00:33 453500 -- (-903.452) (-910.151) (-903.117) [-905.969] * [-906.656] (-903.408) (-904.434) (-901.654) -- 0:00:33 454000 -- (-902.438) (-903.781) [-902.487] (-903.412) * (-902.792) (-904.447) (-902.658) [-904.041] -- 0:00:33 454500 -- (-902.388) (-902.173) (-903.487) [-905.636] * [-902.137] (-904.625) (-902.739) (-907.819) -- 0:00:33 455000 -- (-903.233) (-907.511) [-904.710] (-907.762) * [-904.602] (-903.367) (-903.371) (-902.665) -- 0:00:34 Average standard deviation of split frequencies: 0.012635 455500 -- (-903.183) [-901.652] (-905.043) (-903.782) * [-902.779] (-903.557) (-905.895) (-903.844) -- 0:00:34 456000 -- (-902.545) [-902.928] (-905.855) (-902.729) * (-906.075) [-901.737] (-903.936) (-901.925) -- 0:00:34 456500 -- (-906.206) (-903.020) (-909.525) [-905.762] * (-902.760) (-903.836) (-906.348) [-901.640] -- 0:00:34 457000 -- [-901.795] (-909.663) (-904.746) (-903.527) * [-903.452] (-903.052) (-902.693) (-902.238) -- 0:00:34 457500 -- (-904.038) [-905.568] (-902.006) (-901.748) * (-902.938) [-902.336] (-901.915) (-902.238) -- 0:00:34 458000 -- [-903.807] (-902.820) (-902.006) (-903.319) * (-907.343) (-904.861) (-905.385) [-901.974] -- 0:00:34 458500 -- (-908.425) [-904.729] (-902.644) (-901.735) * (-904.719) [-903.481] (-905.850) (-902.189) -- 0:00:34 459000 -- (-902.906) (-903.923) (-902.856) [-901.765] * [-904.084] (-903.598) (-904.542) (-906.500) -- 0:00:34 459500 -- (-902.040) (-905.316) (-903.752) [-902.596] * (-906.373) [-901.522] (-903.816) (-903.214) -- 0:00:34 460000 -- (-905.396) (-907.459) [-903.881] (-904.055) * (-902.954) (-902.047) (-906.068) [-902.319] -- 0:00:34 Average standard deviation of split frequencies: 0.012340 460500 -- (-903.874) (-905.139) [-902.507] (-901.874) * (-904.352) [-904.318] (-901.450) (-905.115) -- 0:00:33 461000 -- [-904.300] (-904.042) (-902.184) (-904.530) * (-902.503) [-903.792] (-905.627) (-903.761) -- 0:00:33 461500 -- [-901.814] (-903.782) (-904.701) (-904.441) * (-903.668) (-902.851) [-904.190] (-903.208) -- 0:00:33 462000 -- [-903.759] (-904.842) (-913.316) (-904.444) * [-902.585] (-903.802) (-903.801) (-905.160) -- 0:00:33 462500 -- (-903.708) (-901.666) (-906.624) [-903.559] * (-902.436) (-902.463) [-903.549] (-902.127) -- 0:00:33 463000 -- (-903.242) (-902.281) [-904.199] (-903.405) * (-904.303) (-906.738) (-908.233) [-905.185] -- 0:00:33 463500 -- (-904.517) [-903.766] (-903.487) (-911.619) * (-905.213) (-902.328) (-906.954) [-904.069] -- 0:00:33 464000 -- (-904.170) [-905.034] (-902.811) (-909.119) * (-903.013) (-904.180) (-906.670) [-904.675] -- 0:00:33 464500 -- [-906.748] (-905.112) (-901.769) (-902.446) * (-904.699) (-905.571) [-903.350] (-903.046) -- 0:00:33 465000 -- (-905.565) [-903.151] (-902.652) (-901.725) * (-902.874) (-904.510) [-907.695] (-904.698) -- 0:00:33 Average standard deviation of split frequencies: 0.011842 465500 -- (-906.160) (-906.460) (-902.189) [-901.913] * (-903.576) (-903.329) [-904.215] (-907.009) -- 0:00:33 466000 -- (-903.375) [-904.104] (-902.675) (-904.342) * (-904.207) [-903.714] (-911.743) (-905.943) -- 0:00:33 466500 -- (-904.192) (-902.465) (-902.273) [-905.688] * (-904.627) [-905.944] (-906.407) (-908.762) -- 0:00:33 467000 -- (-905.665) (-906.424) (-901.522) [-902.650] * (-902.853) (-902.632) (-904.227) [-905.613] -- 0:00:33 467500 -- (-909.289) [-903.133] (-905.153) (-903.356) * (-903.404) (-904.126) (-906.395) [-904.254] -- 0:00:33 468000 -- (-904.044) [-903.734] (-905.159) (-904.870) * (-902.262) [-902.792] (-908.897) (-904.371) -- 0:00:32 468500 -- (-903.833) [-903.641] (-906.265) (-902.335) * [-901.955] (-902.206) (-906.782) (-903.939) -- 0:00:32 469000 -- (-903.476) [-905.331] (-906.036) (-904.844) * (-902.288) (-907.241) [-903.822] (-904.496) -- 0:00:32 469500 -- (-904.960) (-908.482) [-908.598] (-903.922) * (-904.600) (-908.362) [-902.289] (-909.297) -- 0:00:32 470000 -- (-903.505) (-906.780) (-910.608) [-903.902] * (-905.238) [-903.889] (-902.155) (-904.938) -- 0:00:32 Average standard deviation of split frequencies: 0.012431 470500 -- (-903.022) [-901.450] (-904.169) (-903.510) * [-906.861] (-907.101) (-903.731) (-908.258) -- 0:00:32 471000 -- (-902.079) (-902.591) [-903.101] (-902.313) * (-902.092) (-905.802) (-904.475) [-902.815] -- 0:00:33 471500 -- [-902.253] (-905.886) (-902.349) (-903.678) * [-901.956] (-906.194) (-903.196) (-906.072) -- 0:00:33 472000 -- [-901.399] (-902.829) (-903.128) (-903.511) * (-907.344) [-904.417] (-902.270) (-902.628) -- 0:00:33 472500 -- (-902.955) (-906.147) (-903.473) [-903.207] * (-901.820) (-905.776) (-901.732) [-901.963] -- 0:00:33 473000 -- [-904.805] (-905.680) (-905.910) (-901.738) * (-902.279) (-904.385) [-904.517] (-904.561) -- 0:00:33 473500 -- (-902.285) (-903.437) [-902.259] (-902.446) * (-903.650) (-904.133) (-902.720) [-903.718] -- 0:00:33 474000 -- (-902.755) (-906.878) (-901.712) [-902.823] * [-903.683] (-903.243) (-903.702) (-903.803) -- 0:00:33 474500 -- (-903.930) [-905.449] (-902.120) (-908.915) * (-902.864) (-903.665) [-904.057] (-908.566) -- 0:00:33 475000 -- (-902.349) [-908.226] (-901.767) (-904.432) * (-902.667) (-908.418) (-903.792) [-907.808] -- 0:00:33 Average standard deviation of split frequencies: 0.012104 475500 -- (-906.557) (-904.808) (-905.852) [-902.141] * (-902.041) (-903.211) (-904.161) [-905.275] -- 0:00:33 476000 -- [-905.603] (-904.527) (-902.937) (-904.574) * [-904.600] (-903.907) (-904.521) (-904.014) -- 0:00:33 476500 -- (-904.800) (-906.696) (-902.333) [-907.616] * (-902.879) [-901.858] (-904.139) (-902.352) -- 0:00:32 477000 -- [-906.389] (-908.168) (-902.857) (-905.597) * (-907.196) (-902.679) [-902.601] (-902.981) -- 0:00:32 477500 -- (-905.479) (-902.170) [-903.064] (-902.188) * (-910.502) [-903.452] (-902.412) (-901.574) -- 0:00:32 478000 -- (-903.681) [-905.147] (-902.276) (-902.889) * (-901.455) (-903.238) (-905.662) [-901.607] -- 0:00:32 478500 -- (-904.264) [-901.720] (-904.198) (-901.715) * (-907.704) (-903.892) (-905.999) [-903.292] -- 0:00:32 479000 -- (-903.545) (-902.738) [-902.296] (-903.056) * (-902.641) (-904.371) [-903.400] (-902.107) -- 0:00:32 479500 -- [-903.076] (-904.061) (-904.239) (-902.158) * (-906.586) (-902.170) [-905.708] (-905.448) -- 0:00:32 480000 -- [-903.814] (-904.382) (-905.272) (-907.075) * [-903.370] (-901.737) (-905.462) (-906.459) -- 0:00:32 Average standard deviation of split frequencies: 0.012858 480500 -- (-904.979) [-902.782] (-903.879) (-902.836) * (-903.420) (-904.449) [-902.172] (-904.388) -- 0:00:32 481000 -- [-902.289] (-903.336) (-902.142) (-902.432) * (-901.563) [-903.472] (-902.150) (-903.579) -- 0:00:32 481500 -- (-904.910) [-902.610] (-902.098) (-906.050) * (-902.335) (-905.051) (-905.203) [-904.291] -- 0:00:32 482000 -- [-904.274] (-901.496) (-901.908) (-904.007) * (-902.099) (-903.725) [-902.599] (-903.612) -- 0:00:32 482500 -- [-905.963] (-904.767) (-905.022) (-904.734) * (-903.271) [-902.782] (-903.618) (-902.298) -- 0:00:32 483000 -- (-905.982) (-903.815) [-902.628] (-902.571) * (-905.997) [-903.508] (-908.458) (-903.555) -- 0:00:32 483500 -- (-905.071) (-904.686) (-901.732) [-903.761] * [-903.861] (-902.149) (-909.223) (-903.832) -- 0:00:32 484000 -- (-903.345) (-904.032) [-903.286] (-902.326) * [-902.183] (-908.310) (-903.284) (-902.428) -- 0:00:31 484500 -- (-903.440) (-903.203) (-903.766) [-902.750] * (-903.211) (-902.771) [-902.576] (-902.706) -- 0:00:31 485000 -- (-902.788) (-905.721) (-904.353) [-903.082] * (-902.643) (-903.236) [-901.764] (-902.429) -- 0:00:31 Average standard deviation of split frequencies: 0.013148 485500 -- (-907.787) (-903.238) [-902.314] (-901.585) * [-903.755] (-904.627) (-907.622) (-902.393) -- 0:00:31 486000 -- [-904.632] (-904.187) (-903.879) (-902.021) * (-906.589) (-906.111) (-906.432) [-902.059] -- 0:00:31 486500 -- [-902.426] (-902.346) (-902.506) (-902.259) * (-901.577) (-904.846) (-906.045) [-902.540] -- 0:00:31 487000 -- (-904.020) (-902.822) [-903.381] (-903.663) * (-902.460) (-907.017) (-906.591) [-905.116] -- 0:00:31 487500 -- (-901.917) (-903.187) (-903.215) [-903.509] * (-903.432) [-902.341] (-908.590) (-905.254) -- 0:00:32 488000 -- (-903.920) (-905.231) (-901.967) [-902.761] * [-903.305] (-904.137) (-902.692) (-903.717) -- 0:00:32 488500 -- (-902.649) [-903.805] (-902.054) (-903.970) * (-903.005) (-903.032) (-901.955) [-904.009] -- 0:00:32 489000 -- [-903.162] (-902.497) (-903.755) (-904.929) * [-904.027] (-903.383) (-905.215) (-904.147) -- 0:00:32 489500 -- (-903.580) [-902.785] (-903.534) (-903.810) * [-903.464] (-906.669) (-903.225) (-904.690) -- 0:00:32 490000 -- [-903.902] (-903.168) (-903.146) (-904.189) * (-905.043) (-903.072) [-905.393] (-903.380) -- 0:00:32 Average standard deviation of split frequencies: 0.013344 490500 -- (-903.146) [-901.685] (-902.321) (-904.102) * (-902.360) (-902.291) [-903.889] (-901.698) -- 0:00:32 491000 -- (-903.678) [-901.476] (-903.480) (-903.237) * (-902.476) (-905.726) [-902.780] (-904.280) -- 0:00:32 491500 -- (-903.756) (-902.520) (-905.658) [-902.555] * (-902.764) (-904.506) [-903.898] (-904.335) -- 0:00:32 492000 -- (-903.798) (-909.125) [-902.906] (-902.675) * (-902.070) (-904.187) (-905.016) [-903.863] -- 0:00:32 492500 -- (-903.167) (-901.277) [-903.370] (-903.668) * (-908.024) [-902.701] (-904.526) (-904.504) -- 0:00:31 493000 -- (-901.708) (-902.312) [-907.391] (-905.325) * (-905.439) (-904.147) [-902.964] (-903.428) -- 0:00:31 493500 -- (-903.107) (-908.838) [-903.655] (-908.194) * (-903.821) [-902.432] (-903.541) (-904.117) -- 0:00:31 494000 -- [-901.929] (-903.907) (-903.773) (-907.639) * (-907.844) (-904.179) [-904.941] (-906.021) -- 0:00:31 494500 -- (-903.188) (-905.739) (-905.957) [-902.465] * (-905.022) (-904.936) [-902.195] (-906.412) -- 0:00:31 495000 -- [-903.201] (-903.293) (-903.118) (-902.178) * (-907.464) (-903.659) (-902.237) [-906.585] -- 0:00:31 Average standard deviation of split frequencies: 0.013939 495500 -- (-905.931) [-903.276] (-904.224) (-904.599) * (-904.602) [-904.973] (-902.668) (-904.667) -- 0:00:31 496000 -- (-903.002) (-904.099) (-902.176) [-902.735] * (-909.469) [-902.137] (-902.389) (-906.531) -- 0:00:31 496500 -- [-904.029] (-903.759) (-902.218) (-903.615) * (-904.269) (-907.079) [-902.268] (-903.257) -- 0:00:31 497000 -- (-903.935) [-903.575] (-901.892) (-904.071) * (-906.150) (-906.673) (-904.799) [-902.372] -- 0:00:31 497500 -- (-904.449) (-904.350) (-903.077) [-904.057] * (-903.841) [-904.981] (-904.230) (-902.917) -- 0:00:31 498000 -- [-902.304] (-910.048) (-903.822) (-907.664) * (-903.653) (-905.636) (-902.637) [-904.286] -- 0:00:31 498500 -- (-904.948) (-905.191) (-903.774) [-906.571] * (-902.672) (-903.582) [-902.163] (-902.208) -- 0:00:31 499000 -- (-904.638) (-905.782) [-904.613] (-902.171) * (-903.990) [-901.591] (-902.826) (-902.668) -- 0:00:31 499500 -- (-904.293) [-906.657] (-913.254) (-903.864) * (-904.834) (-905.777) (-905.349) [-902.950] -- 0:00:31 500000 -- (-905.930) [-904.652] (-916.194) (-903.723) * (-907.692) (-903.328) (-902.312) [-903.113] -- 0:00:31 Average standard deviation of split frequencies: 0.013862 500500 -- [-902.827] (-904.078) (-907.305) (-901.894) * [-905.457] (-902.915) (-901.366) (-904.536) -- 0:00:30 501000 -- (-905.096) [-902.771] (-907.325) (-905.097) * (-902.194) (-903.917) [-902.198] (-906.427) -- 0:00:30 501500 -- (-904.453) [-903.390] (-904.276) (-902.431) * (-902.398) (-903.849) (-904.627) [-901.958] -- 0:00:30 502000 -- (-905.282) (-903.250) [-902.057] (-904.713) * (-902.819) (-903.508) [-901.902] (-903.629) -- 0:00:30 502500 -- (-905.739) [-903.250] (-906.091) (-903.056) * (-903.380) [-902.020] (-903.565) (-902.753) -- 0:00:30 503000 -- (-902.862) (-903.324) [-902.879] (-903.328) * (-903.522) [-902.843] (-904.258) (-902.242) -- 0:00:30 503500 -- (-904.286) (-905.885) [-910.578] (-902.986) * (-902.233) (-907.750) [-902.571] (-902.208) -- 0:00:31 504000 -- (-906.417) [-902.619] (-904.438) (-902.584) * (-902.197) (-906.045) (-904.325) [-905.927] -- 0:00:31 504500 -- (-903.180) (-903.025) [-904.211] (-903.693) * (-902.737) [-903.703] (-902.857) (-903.113) -- 0:00:31 505000 -- (-903.853) (-902.897) (-904.217) [-903.073] * (-904.460) (-903.551) (-901.776) [-904.106] -- 0:00:31 Average standard deviation of split frequencies: 0.014751 505500 -- (-910.204) (-903.724) (-905.206) [-905.675] * (-902.334) (-901.690) (-901.848) [-907.274] -- 0:00:31 506000 -- (-902.206) [-902.705] (-906.674) (-902.247) * (-905.501) [-902.920] (-902.020) (-907.103) -- 0:00:31 506500 -- (-908.428) (-902.179) (-904.434) [-904.469] * (-902.455) (-903.248) [-901.843] (-902.176) -- 0:00:31 507000 -- (-902.730) (-902.156) (-913.129) [-902.501] * (-903.628) (-902.864) (-903.514) [-901.733] -- 0:00:31 507500 -- [-903.434] (-906.512) (-905.566) (-902.921) * (-903.784) (-902.572) (-902.968) [-902.067] -- 0:00:31 508000 -- (-903.630) [-903.619] (-902.115) (-904.264) * [-902.392] (-904.025) (-902.968) (-910.158) -- 0:00:30 508500 -- [-907.694] (-908.768) (-905.981) (-907.530) * (-904.976) (-902.935) [-903.206] (-902.732) -- 0:00:30 509000 -- (-902.892) (-903.253) (-904.573) [-904.117] * (-904.605) (-904.363) (-904.739) [-903.690] -- 0:00:30 509500 -- (-904.380) (-902.516) [-902.680] (-904.283) * (-905.225) [-904.769] (-901.954) (-902.333) -- 0:00:30 510000 -- [-903.019] (-907.291) (-902.569) (-901.944) * (-905.644) (-903.142) (-904.039) [-903.845] -- 0:00:30 Average standard deviation of split frequencies: 0.014154 510500 -- (-904.352) (-904.436) (-906.036) [-902.506] * (-906.573) (-904.022) [-903.643] (-903.010) -- 0:00:30 511000 -- (-905.688) (-902.101) [-902.548] (-906.933) * (-908.077) (-902.698) (-902.694) [-902.142] -- 0:00:30 511500 -- [-903.735] (-901.421) (-905.600) (-902.881) * (-905.577) [-903.023] (-902.215) (-902.083) -- 0:00:30 512000 -- (-902.402) [-905.379] (-908.401) (-904.307) * (-902.430) [-903.313] (-902.511) (-902.173) -- 0:00:30 512500 -- (-904.302) (-902.441) [-904.586] (-902.191) * [-902.418] (-904.315) (-902.681) (-901.392) -- 0:00:30 513000 -- (-902.456) (-902.715) [-903.003] (-901.521) * (-903.958) (-905.235) (-901.831) [-902.065] -- 0:00:30 513500 -- (-903.205) (-904.486) (-902.577) [-901.851] * [-905.804] (-909.363) (-907.302) (-902.265) -- 0:00:30 514000 -- [-904.115] (-903.497) (-902.408) (-902.255) * (-903.621) (-902.968) [-907.198] (-903.966) -- 0:00:30 514500 -- (-904.103) (-907.348) (-905.856) [-902.521] * (-903.257) (-902.490) (-904.981) [-902.226] -- 0:00:30 515000 -- (-903.079) (-904.456) (-902.490) [-903.381] * (-905.702) (-902.773) [-903.691] (-904.767) -- 0:00:30 Average standard deviation of split frequencies: 0.013551 515500 -- (-902.859) [-903.948] (-904.360) (-903.406) * (-903.750) (-903.581) (-904.753) [-901.986] -- 0:00:30 516000 -- (-904.695) [-902.215] (-904.099) (-904.719) * [-902.914] (-906.325) (-903.948) (-902.185) -- 0:00:30 516500 -- (-904.368) (-905.348) [-903.979] (-904.177) * (-902.216) (-903.862) [-905.348] (-904.703) -- 0:00:29 517000 -- (-904.121) (-905.207) (-904.846) [-904.872] * (-902.348) (-903.147) [-906.094] (-903.129) -- 0:00:29 517500 -- (-904.465) [-902.733] (-907.574) (-902.191) * (-905.151) [-902.655] (-904.861) (-905.887) -- 0:00:29 518000 -- (-905.088) [-904.448] (-903.886) (-904.218) * [-904.258] (-903.430) (-903.430) (-904.315) -- 0:00:29 518500 -- (-904.234) (-902.127) (-903.069) [-903.900] * (-904.314) [-903.755] (-905.791) (-906.529) -- 0:00:29 519000 -- (-904.031) [-903.392] (-903.900) (-902.107) * (-905.207) (-902.185) (-903.829) [-904.725] -- 0:00:29 519500 -- (-907.241) (-903.931) [-904.231] (-903.362) * (-906.736) (-908.527) [-908.180] (-904.022) -- 0:00:30 520000 -- [-905.418] (-901.941) (-905.374) (-902.377) * (-904.831) [-903.256] (-907.232) (-902.999) -- 0:00:30 Average standard deviation of split frequencies: 0.013732 520500 -- (-902.280) [-904.753] (-903.573) (-904.751) * (-907.059) [-902.982] (-907.917) (-906.331) -- 0:00:30 521000 -- [-903.232] (-905.133) (-902.125) (-902.509) * (-901.541) [-902.654] (-904.214) (-903.653) -- 0:00:30 521500 -- (-901.539) [-902.803] (-903.364) (-903.298) * (-903.026) (-908.211) (-903.421) [-903.398] -- 0:00:30 522000 -- (-903.447) (-903.899) [-904.644] (-902.877) * [-902.697] (-903.229) (-904.090) (-902.476) -- 0:00:30 522500 -- (-904.396) [-903.245] (-902.154) (-902.543) * (-902.404) (-906.521) (-902.992) [-902.189] -- 0:00:30 523000 -- (-905.921) [-904.426] (-902.964) (-905.562) * [-903.364] (-904.098) (-904.923) (-902.851) -- 0:00:30 523500 -- [-903.239] (-901.954) (-905.175) (-904.958) * [-901.459] (-904.183) (-905.799) (-904.221) -- 0:00:30 524000 -- (-903.524) (-901.905) (-904.551) [-904.089] * (-903.863) (-903.036) [-903.331] (-902.741) -- 0:00:29 524500 -- (-904.489) (-903.750) (-906.512) [-903.328] * (-904.282) [-906.805] (-903.770) (-904.599) -- 0:00:29 525000 -- [-903.984] (-906.342) (-903.975) (-903.936) * (-904.769) (-905.786) (-906.002) [-904.791] -- 0:00:29 Average standard deviation of split frequencies: 0.013792 525500 -- (-903.636) (-908.605) (-903.202) [-906.003] * (-902.716) [-902.704] (-905.396) (-904.233) -- 0:00:29 526000 -- (-901.787) (-907.520) (-903.513) [-904.172] * (-901.976) [-902.410] (-902.966) (-903.054) -- 0:00:29 526500 -- (-906.186) [-904.451] (-903.256) (-902.538) * (-903.134) (-903.093) (-903.058) [-903.650] -- 0:00:29 527000 -- [-904.664] (-902.796) (-905.689) (-904.873) * (-906.067) (-910.381) (-903.001) [-903.003] -- 0:00:29 527500 -- (-902.472) [-902.313] (-903.997) (-904.980) * [-902.454] (-902.995) (-904.969) (-907.483) -- 0:00:29 528000 -- (-903.073) [-901.954] (-901.942) (-902.865) * (-902.188) (-903.046) (-904.745) [-904.911] -- 0:00:29 528500 -- [-902.923] (-901.728) (-902.446) (-902.493) * (-903.813) (-904.140) [-903.010] (-908.851) -- 0:00:29 529000 -- [-905.420] (-902.002) (-902.257) (-903.717) * [-902.976] (-903.553) (-902.813) (-904.374) -- 0:00:29 529500 -- (-901.637) [-907.380] (-902.669) (-902.227) * [-902.850] (-904.516) (-904.614) (-904.081) -- 0:00:29 530000 -- [-901.730] (-904.273) (-902.804) (-902.606) * (-904.164) [-907.938] (-903.473) (-904.097) -- 0:00:29 Average standard deviation of split frequencies: 0.013605 530500 -- (-904.516) (-904.826) [-904.519] (-902.860) * (-905.053) [-905.754] (-903.092) (-902.901) -- 0:00:29 531000 -- (-904.860) (-904.357) (-902.058) [-903.179] * (-902.982) (-904.990) (-905.426) [-903.058] -- 0:00:29 531500 -- (-902.283) [-902.225] (-902.215) (-905.726) * (-903.528) [-902.477] (-905.887) (-903.520) -- 0:00:29 532000 -- (-902.883) (-906.001) [-901.931] (-905.715) * (-901.745) (-903.798) (-908.181) [-903.617] -- 0:00:29 532500 -- (-905.457) (-904.946) [-909.528] (-903.531) * (-904.026) [-904.441] (-902.338) (-904.419) -- 0:00:28 533000 -- (-902.651) (-903.137) (-901.980) [-905.054] * (-902.025) (-902.328) [-907.341] (-904.121) -- 0:00:28 533500 -- (-901.499) (-903.329) (-902.913) [-901.622] * [-902.144] (-902.837) (-903.880) (-904.879) -- 0:00:28 534000 -- (-901.581) (-902.283) [-902.125] (-903.369) * (-901.888) (-902.459) [-906.249] (-905.132) -- 0:00:28 534500 -- [-902.595] (-904.147) (-902.036) (-903.473) * (-902.507) (-905.624) (-909.765) [-903.958] -- 0:00:28 535000 -- (-905.135) (-904.122) [-902.490] (-905.492) * (-901.912) (-904.656) [-902.916] (-905.035) -- 0:00:29 Average standard deviation of split frequencies: 0.013655 535500 -- (-904.990) (-903.645) (-902.479) [-903.899] * (-906.057) (-903.390) [-903.148] (-905.856) -- 0:00:29 536000 -- (-905.611) (-908.543) (-902.479) [-902.839] * (-908.392) [-903.219] (-904.301) (-903.398) -- 0:00:29 536500 -- (-901.931) (-905.388) (-904.426) [-905.977] * (-905.563) (-902.643) [-905.430] (-902.548) -- 0:00:29 537000 -- (-903.058) [-902.915] (-904.117) (-904.991) * (-904.387) (-901.832) (-904.690) [-904.446] -- 0:00:29 537500 -- (-902.944) [-905.477] (-902.155) (-902.598) * (-908.852) [-902.331] (-902.655) (-904.358) -- 0:00:29 538000 -- [-901.805] (-907.954) (-903.921) (-903.570) * (-903.788) [-901.535] (-902.936) (-906.122) -- 0:00:29 538500 -- (-903.508) (-902.733) [-903.650] (-906.106) * (-901.326) (-901.891) [-902.165] (-905.385) -- 0:00:29 539000 -- (-902.634) (-904.078) (-903.631) [-903.495] * (-904.327) (-908.449) (-906.472) [-907.754] -- 0:00:29 539500 -- (-905.120) [-903.256] (-901.867) (-904.413) * [-904.161] (-912.998) (-902.897) (-903.741) -- 0:00:29 540000 -- (-902.876) (-905.320) (-902.184) [-906.707] * (-905.536) [-911.991] (-903.695) (-902.271) -- 0:00:28 Average standard deviation of split frequencies: 0.014096 540500 -- (-902.869) [-903.437] (-903.041) (-902.633) * (-905.708) (-901.943) [-904.044] (-902.130) -- 0:00:28 541000 -- (-902.619) (-905.157) (-906.477) [-902.518] * [-901.570] (-902.458) (-904.372) (-905.229) -- 0:00:28 541500 -- (-909.980) (-903.853) [-902.674] (-904.943) * [-901.770] (-902.946) (-904.256) (-904.327) -- 0:00:28 542000 -- [-904.717] (-905.512) (-905.892) (-903.504) * (-902.543) (-903.893) (-907.384) [-905.321] -- 0:00:28 542500 -- (-904.424) (-902.410) (-904.403) [-903.623] * (-902.968) (-906.991) (-903.259) [-902.434] -- 0:00:28 543000 -- (-901.630) [-903.329] (-904.510) (-902.598) * (-905.657) (-909.429) (-901.903) [-903.263] -- 0:00:28 543500 -- (-902.097) [-902.308] (-904.949) (-902.186) * (-902.815) [-904.089] (-906.335) (-902.270) -- 0:00:28 544000 -- (-903.985) (-906.466) (-906.422) [-901.882] * (-902.934) (-904.563) (-903.608) [-903.350] -- 0:00:28 544500 -- (-902.835) (-905.959) (-909.880) [-901.964] * (-908.290) (-903.585) (-902.886) [-901.519] -- 0:00:28 545000 -- (-902.899) (-902.658) [-903.731] (-901.975) * (-904.628) (-905.610) (-901.399) [-901.746] -- 0:00:28 Average standard deviation of split frequencies: 0.013238 545500 -- [-902.269] (-901.707) (-905.052) (-906.326) * (-907.215) (-905.751) [-905.976] (-904.145) -- 0:00:28 546000 -- (-903.586) (-903.062) (-905.094) [-903.720] * [-905.038] (-908.574) (-904.753) (-903.170) -- 0:00:28 546500 -- (-902.098) (-903.427) [-905.442] (-903.707) * (-908.424) [-906.266] (-906.555) (-904.886) -- 0:00:28 547000 -- (-903.317) [-903.518] (-906.474) (-903.666) * (-904.472) [-901.491] (-902.195) (-903.462) -- 0:00:28 547500 -- (-903.765) [-902.486] (-902.331) (-902.254) * (-916.095) [-901.586] (-908.300) (-904.232) -- 0:00:28 548000 -- [-906.431] (-904.123) (-902.258) (-903.378) * (-902.770) [-902.185] (-901.965) (-902.614) -- 0:00:28 548500 -- (-907.783) (-903.818) [-903.196] (-905.378) * [-902.532] (-901.524) (-903.371) (-903.362) -- 0:00:27 549000 -- (-903.688) (-904.190) [-903.505] (-903.936) * (-902.580) [-902.878] (-901.286) (-902.575) -- 0:00:27 549500 -- (-903.819) [-904.527] (-903.307) (-906.241) * (-904.206) [-903.462] (-903.758) (-902.269) -- 0:00:28 550000 -- [-902.710] (-902.431) (-902.834) (-913.513) * [-903.955] (-902.391) (-902.759) (-908.820) -- 0:00:28 Average standard deviation of split frequencies: 0.013364 550500 -- (-904.520) (-903.322) [-906.917] (-904.872) * (-908.463) (-905.055) (-903.770) [-904.018] -- 0:00:28 551000 -- [-902.734] (-905.626) (-904.772) (-902.594) * (-905.798) [-905.723] (-901.986) (-906.441) -- 0:00:28 551500 -- (-901.499) (-903.851) [-903.662] (-902.311) * (-904.058) [-905.580] (-902.376) (-905.787) -- 0:00:28 552000 -- (-902.233) (-907.028) [-902.078] (-902.027) * (-903.279) [-902.873] (-903.682) (-906.307) -- 0:00:28 552500 -- (-908.010) (-909.313) (-902.705) [-903.306] * (-903.155) (-904.858) (-903.333) [-907.435] -- 0:00:28 553000 -- (-905.753) (-902.968) (-903.245) [-903.193] * [-905.177] (-905.383) (-908.049) (-905.951) -- 0:00:28 553500 -- (-903.329) [-903.199] (-901.926) (-903.554) * [-906.875] (-902.599) (-904.624) (-904.325) -- 0:00:28 554000 -- (-902.376) (-904.353) [-902.786] (-903.120) * (-903.373) (-901.829) [-904.145] (-902.494) -- 0:00:28 554500 -- (-901.858) (-905.172) (-901.971) [-902.666] * (-904.904) [-903.493] (-905.115) (-903.340) -- 0:00:28 555000 -- [-903.154] (-906.210) (-903.602) (-903.857) * (-907.722) (-908.432) [-904.601] (-905.855) -- 0:00:28 Average standard deviation of split frequencies: 0.013236 555500 -- (-902.651) (-903.523) [-901.359] (-902.263) * (-902.670) (-911.204) (-906.728) [-903.694] -- 0:00:28 556000 -- (-905.170) (-903.894) [-901.355] (-904.814) * (-902.384) [-905.411] (-904.114) (-903.791) -- 0:00:27 556500 -- (-903.785) [-908.380] (-903.703) (-907.323) * (-904.566) (-902.936) (-903.331) [-902.183] -- 0:00:27 557000 -- [-902.723] (-917.874) (-903.703) (-902.980) * (-904.668) (-904.956) (-902.660) [-901.449] -- 0:00:27 557500 -- [-903.182] (-905.684) (-903.041) (-903.789) * (-905.601) (-901.814) (-906.083) [-904.019] -- 0:00:27 558000 -- (-903.705) [-904.368] (-907.168) (-901.902) * (-902.844) [-902.570] (-904.399) (-906.750) -- 0:00:27 558500 -- [-904.606] (-905.317) (-910.158) (-902.439) * (-905.366) [-901.972] (-906.895) (-906.302) -- 0:00:27 559000 -- (-901.445) [-903.581] (-906.688) (-906.466) * (-905.872) [-902.746] (-906.234) (-905.595) -- 0:00:27 559500 -- (-903.501) (-905.578) (-904.685) [-906.112] * [-904.234] (-904.077) (-905.838) (-902.897) -- 0:00:27 560000 -- [-903.548] (-908.845) (-903.937) (-903.389) * [-904.337] (-906.715) (-901.691) (-902.033) -- 0:00:27 Average standard deviation of split frequencies: 0.013546 560500 -- (-903.977) (-908.172) (-906.526) [-901.857] * (-903.555) (-901.542) [-903.016] (-902.260) -- 0:00:27 561000 -- (-903.772) (-902.325) [-905.675] (-906.477) * (-903.096) (-902.635) (-904.785) [-902.370] -- 0:00:27 561500 -- (-903.454) [-903.597] (-906.284) (-901.661) * (-902.703) [-902.623] (-907.321) (-906.516) -- 0:00:27 562000 -- (-906.253) (-904.462) (-903.445) [-901.705] * (-902.371) (-904.235) (-904.208) [-902.227] -- 0:00:27 562500 -- (-904.864) [-902.305] (-902.610) (-901.926) * (-902.791) [-905.465] (-904.663) (-905.513) -- 0:00:27 563000 -- (-903.523) (-905.453) [-902.377] (-902.774) * (-901.986) (-904.054) (-904.911) [-902.629] -- 0:00:27 563500 -- (-913.594) (-904.905) [-904.592] (-902.150) * (-902.048) (-903.478) [-905.014] (-905.704) -- 0:00:27 564000 -- (-902.639) [-903.846] (-902.458) (-902.811) * (-904.078) (-904.902) [-901.772] (-904.800) -- 0:00:27 564500 -- (-905.175) (-902.317) [-902.471] (-903.453) * (-901.513) (-905.081) (-902.425) [-902.503] -- 0:00:27 565000 -- [-902.615] (-906.675) (-903.443) (-902.563) * (-904.450) [-903.844] (-901.854) (-901.459) -- 0:00:27 Average standard deviation of split frequencies: 0.012678 565500 -- [-904.832] (-901.773) (-906.764) (-903.101) * [-901.834] (-904.540) (-904.665) (-902.908) -- 0:00:27 566000 -- (-903.487) [-902.124] (-907.870) (-901.555) * (-901.805) (-903.314) (-902.334) [-902.890] -- 0:00:27 566500 -- [-903.618] (-903.431) (-904.048) (-903.065) * [-902.914] (-902.818) (-902.505) (-903.065) -- 0:00:27 567000 -- (-907.313) (-903.012) (-902.993) [-904.186] * (-903.776) (-902.825) (-902.455) [-902.608] -- 0:00:27 567500 -- (-905.313) (-902.901) [-904.950] (-908.475) * (-902.832) [-904.135] (-902.311) (-902.971) -- 0:00:27 568000 -- (-904.656) (-907.233) [-904.952] (-903.022) * (-903.802) (-905.086) (-903.694) [-903.429] -- 0:00:27 568500 -- (-904.352) (-901.809) (-901.707) [-903.052] * [-903.522] (-903.730) (-903.932) (-905.060) -- 0:00:27 569000 -- (-907.039) [-902.419] (-902.180) (-903.286) * (-903.263) (-904.710) [-902.261] (-903.257) -- 0:00:27 569500 -- (-908.064) (-906.192) (-903.937) [-904.528] * (-902.655) (-904.980) (-903.857) [-902.469] -- 0:00:27 570000 -- (-910.958) [-903.227] (-902.087) (-905.781) * [-904.341] (-905.663) (-904.421) (-904.613) -- 0:00:27 Average standard deviation of split frequencies: 0.012439 570500 -- (-904.834) [-902.458] (-903.059) (-902.441) * (-902.408) [-904.135] (-903.567) (-904.878) -- 0:00:27 571000 -- (-904.692) (-906.195) [-902.142] (-902.401) * (-901.633) [-904.245] (-907.848) (-906.589) -- 0:00:27 571500 -- (-902.373) [-908.290] (-904.908) (-906.169) * [-903.362] (-901.796) (-905.691) (-904.385) -- 0:00:26 572000 -- (-903.662) [-902.927] (-902.348) (-911.879) * (-902.739) (-903.076) [-903.998] (-904.370) -- 0:00:26 572500 -- [-902.177] (-903.151) (-905.983) (-903.067) * [-903.261] (-903.476) (-903.834) (-901.914) -- 0:00:26 573000 -- (-902.048) (-903.002) (-902.450) [-902.069] * [-903.261] (-902.939) (-903.896) (-902.715) -- 0:00:26 573500 -- [-903.445] (-902.626) (-901.255) (-902.123) * [-902.918] (-902.202) (-903.193) (-911.998) -- 0:00:26 574000 -- (-905.418) (-902.865) (-902.087) [-903.918] * (-906.443) [-906.070] (-904.730) (-902.900) -- 0:00:26 574500 -- (-903.930) (-902.461) [-901.906] (-903.765) * (-903.142) (-905.124) [-902.880] (-901.805) -- 0:00:26 575000 -- (-904.144) (-902.948) (-903.276) [-903.689] * [-902.883] (-905.448) (-902.784) (-904.810) -- 0:00:26 Average standard deviation of split frequencies: 0.012469 575500 -- (-902.989) (-903.087) (-903.090) [-903.157] * (-901.828) (-901.425) (-904.212) [-903.294] -- 0:00:26 576000 -- (-905.349) (-904.522) [-902.384] (-905.015) * (-904.625) (-902.182) [-902.488] (-905.494) -- 0:00:26 576500 -- [-903.513] (-904.478) (-902.939) (-904.443) * (-902.794) (-902.232) [-905.696] (-902.501) -- 0:00:26 577000 -- [-902.093] (-903.763) (-907.284) (-905.764) * [-903.854] (-902.196) (-903.360) (-902.706) -- 0:00:26 577500 -- (-905.049) [-902.625] (-904.145) (-902.338) * (-902.203) [-903.940] (-905.238) (-903.633) -- 0:00:26 578000 -- (-910.564) (-905.620) (-904.284) [-905.453] * (-906.042) [-902.084] (-912.967) (-905.355) -- 0:00:26 578500 -- (-904.192) [-909.610] (-904.450) (-903.547) * (-904.068) (-903.433) (-903.262) [-907.122] -- 0:00:26 579000 -- (-903.766) [-904.554] (-910.458) (-904.783) * (-907.081) [-901.646] (-905.090) (-907.277) -- 0:00:26 579500 -- (-904.359) [-902.687] (-903.861) (-901.626) * (-902.647) (-903.622) [-904.717] (-903.653) -- 0:00:26 580000 -- (-904.628) (-902.152) [-902.897] (-902.114) * [-902.980] (-903.971) (-903.677) (-901.780) -- 0:00:26 Average standard deviation of split frequencies: 0.011700 580500 -- (-903.606) (-902.771) [-904.333] (-901.868) * (-902.110) (-910.136) [-903.427] (-902.681) -- 0:00:26 581000 -- [-904.158] (-902.505) (-903.656) (-901.881) * (-901.917) (-903.152) (-902.412) [-902.701] -- 0:00:26 581500 -- [-904.013] (-901.757) (-902.834) (-904.130) * (-903.352) [-906.751] (-903.855) (-905.458) -- 0:00:26 582000 -- [-904.385] (-904.151) (-905.375) (-901.658) * [-903.199] (-903.911) (-901.696) (-903.693) -- 0:00:26 582500 -- (-903.765) (-904.000) (-904.870) [-902.172] * [-902.307] (-902.749) (-904.820) (-904.439) -- 0:00:26 583000 -- [-903.163] (-904.984) (-903.533) (-903.333) * (-905.785) [-905.015] (-904.325) (-902.398) -- 0:00:26 583500 -- [-903.847] (-906.918) (-902.716) (-904.596) * (-901.936) [-902.304] (-907.067) (-902.636) -- 0:00:26 584000 -- (-904.934) (-903.965) (-903.457) [-902.816] * (-903.043) [-904.164] (-902.148) (-901.449) -- 0:00:26 584500 -- (-901.746) (-903.630) (-901.854) [-904.246] * (-906.515) [-901.956] (-903.723) (-906.847) -- 0:00:26 585000 -- (-902.049) (-904.023) (-902.969) [-903.021] * [-903.223] (-903.818) (-903.676) (-906.627) -- 0:00:26 Average standard deviation of split frequencies: 0.011173 585500 -- (-903.002) (-903.272) (-903.099) [-902.040] * [-904.458] (-903.137) (-902.023) (-901.874) -- 0:00:26 586000 -- (-903.331) (-904.753) [-902.251] (-904.275) * (-902.835) (-903.819) (-904.733) [-903.011] -- 0:00:26 586500 -- [-902.566] (-902.809) (-905.680) (-903.137) * (-904.624) (-904.155) [-903.830] (-902.878) -- 0:00:26 587000 -- (-903.392) (-902.688) [-904.888] (-902.054) * (-903.422) (-904.005) (-908.470) [-902.971] -- 0:00:26 587500 -- (-904.168) (-904.125) (-907.790) [-903.373] * (-902.293) (-903.023) [-904.228] (-903.620) -- 0:00:25 588000 -- [-905.525] (-905.257) (-902.091) (-901.480) * (-905.572) (-903.799) (-903.057) [-903.743] -- 0:00:25 588500 -- [-905.820] (-903.291) (-903.156) (-909.163) * (-902.379) (-902.366) (-905.237) [-902.024] -- 0:00:25 589000 -- [-903.869] (-903.578) (-903.792) (-906.562) * (-903.166) (-902.530) [-905.657] (-901.396) -- 0:00:25 589500 -- (-906.376) (-906.189) (-902.048) [-902.658] * [-906.529] (-903.602) (-901.846) (-901.718) -- 0:00:25 590000 -- (-904.104) (-906.534) (-903.227) [-905.329] * (-904.117) (-904.214) (-902.659) [-903.989] -- 0:00:25 Average standard deviation of split frequencies: 0.011737 590500 -- (-901.480) [-905.093] (-903.960) (-904.397) * [-907.340] (-902.864) (-902.736) (-905.745) -- 0:00:25 591000 -- (-902.853) (-904.840) [-902.733] (-905.902) * (-912.001) (-902.090) [-901.606] (-905.358) -- 0:00:25 591500 -- (-902.833) (-903.013) [-904.050] (-902.927) * [-901.990] (-904.154) (-909.291) (-907.110) -- 0:00:25 592000 -- (-906.291) (-902.798) [-908.267] (-903.916) * (-904.306) [-903.280] (-909.179) (-902.516) -- 0:00:25 592500 -- (-904.099) (-904.637) (-903.737) [-902.837] * [-903.810] (-903.022) (-908.145) (-904.210) -- 0:00:25 593000 -- (-904.700) [-903.746] (-907.330) (-902.377) * (-904.482) (-903.647) (-904.169) [-904.093] -- 0:00:25 593500 -- (-907.652) (-903.747) (-903.411) [-901.695] * (-901.729) (-904.172) (-905.967) [-903.289] -- 0:00:25 594000 -- (-909.329) [-902.733] (-905.892) (-903.613) * (-902.382) [-902.646] (-902.092) (-904.211) -- 0:00:25 594500 -- (-903.641) [-902.959] (-902.485) (-903.680) * (-903.281) (-907.126) [-906.232] (-906.736) -- 0:00:25 595000 -- (-904.535) (-904.080) [-902.734] (-903.168) * (-904.286) (-904.829) (-902.475) [-902.266] -- 0:00:25 Average standard deviation of split frequencies: 0.011492 595500 -- [-901.706] (-904.656) (-902.425) (-904.554) * (-906.123) (-905.294) (-904.457) [-902.511] -- 0:00:25 596000 -- [-904.559] (-903.015) (-903.357) (-904.795) * (-905.630) (-903.208) (-901.724) [-901.807] -- 0:00:25 596500 -- (-903.409) [-909.339] (-902.327) (-906.467) * (-904.632) (-905.609) (-903.203) [-901.784] -- 0:00:25 597000 -- (-905.572) (-902.320) [-903.937] (-906.532) * (-904.862) (-903.734) [-903.674] (-912.142) -- 0:00:25 597500 -- (-902.492) [-903.366] (-902.145) (-904.366) * (-901.502) (-903.642) (-902.649) [-901.842] -- 0:00:25 598000 -- [-903.381] (-902.416) (-906.959) (-903.291) * (-901.470) (-902.049) (-902.843) [-901.766] -- 0:00:25 598500 -- [-902.454] (-902.019) (-905.595) (-902.903) * (-901.827) (-901.745) [-902.586] (-902.135) -- 0:00:25 599000 -- (-903.109) [-903.149] (-902.239) (-902.937) * [-901.942] (-903.960) (-902.810) (-903.573) -- 0:00:25 599500 -- (-902.858) (-906.516) (-905.001) [-904.086] * (-902.252) (-905.851) (-902.068) [-901.833] -- 0:00:25 600000 -- (-902.870) (-904.278) [-902.415] (-902.986) * (-905.613) [-902.216] (-902.152) (-901.614) -- 0:00:25 Average standard deviation of split frequencies: 0.010849 600500 -- (-902.671) (-902.944) [-904.363] (-905.506) * [-904.253] (-903.474) (-903.555) (-901.634) -- 0:00:25 601000 -- (-901.718) [-903.853] (-905.050) (-904.369) * (-903.431) [-907.536] (-902.528) (-903.236) -- 0:00:25 601500 -- (-904.624) (-905.023) (-903.404) [-905.468] * (-904.171) (-904.072) (-905.142) [-903.287] -- 0:00:25 602000 -- (-903.220) (-902.739) [-905.304] (-902.854) * [-902.318] (-903.281) (-908.211) (-903.170) -- 0:00:25 602500 -- (-903.597) (-904.324) (-906.304) [-906.944] * [-902.955] (-903.822) (-902.123) (-904.402) -- 0:00:25 603000 -- (-903.700) (-902.639) [-904.828] (-907.652) * (-904.095) (-902.766) [-902.041] (-905.276) -- 0:00:25 603500 -- [-905.229] (-902.915) (-902.249) (-908.412) * (-903.968) (-903.121) [-901.634] (-905.829) -- 0:00:24 604000 -- (-903.830) (-906.354) (-905.686) [-902.825] * (-903.268) (-904.011) (-903.000) [-903.847] -- 0:00:24 604500 -- (-903.447) (-903.533) (-901.795) [-904.143] * (-903.602) (-903.068) [-904.656] (-902.317) -- 0:00:24 605000 -- (-903.059) (-903.301) [-901.789] (-903.620) * (-902.516) [-901.668] (-905.772) (-903.807) -- 0:00:24 Average standard deviation of split frequencies: 0.010296 605500 -- (-906.142) (-902.788) [-904.190] (-908.576) * (-902.104) [-903.642] (-903.331) (-904.292) -- 0:00:24 606000 -- [-904.177] (-904.756) (-904.713) (-906.072) * (-907.190) [-902.046] (-904.505) (-904.300) -- 0:00:24 606500 -- (-902.828) [-902.562] (-902.156) (-902.719) * [-902.889] (-904.064) (-909.400) (-904.689) -- 0:00:24 607000 -- (-902.655) (-906.149) [-901.852] (-904.392) * (-904.408) (-903.297) (-906.046) [-903.315] -- 0:00:24 607500 -- (-902.184) [-902.127] (-901.756) (-903.259) * (-904.918) (-914.656) (-903.060) [-904.383] -- 0:00:24 608000 -- (-903.519) (-901.864) [-902.356] (-903.866) * (-903.164) [-903.427] (-906.126) (-902.232) -- 0:00:24 608500 -- (-904.209) (-902.956) (-903.604) [-903.606] * (-903.102) (-903.147) [-903.598] (-903.773) -- 0:00:24 609000 -- (-905.155) (-905.350) (-902.671) [-902.421] * (-903.005) (-901.911) [-903.118] (-903.657) -- 0:00:24 609500 -- [-903.671] (-905.056) (-902.401) (-902.754) * (-906.868) (-901.396) (-903.992) [-901.473] -- 0:00:24 610000 -- [-903.613] (-902.423) (-905.663) (-905.363) * (-905.263) (-903.933) (-907.670) [-901.460] -- 0:00:24 Average standard deviation of split frequencies: 0.010399 610500 -- (-904.462) [-904.339] (-902.334) (-904.534) * (-906.949) [-903.381] (-906.620) (-905.260) -- 0:00:24 611000 -- [-903.055] (-901.875) (-902.139) (-902.143) * (-902.898) [-902.857] (-902.043) (-907.044) -- 0:00:24 611500 -- (-903.051) (-906.395) (-904.395) [-902.704] * (-904.439) (-903.659) (-904.402) [-905.295] -- 0:00:24 612000 -- [-902.959] (-904.899) (-902.640) (-902.801) * (-902.237) (-903.486) [-903.665] (-906.715) -- 0:00:24 612500 -- (-905.638) (-906.391) (-904.622) [-904.005] * [-905.178] (-903.466) (-905.191) (-905.133) -- 0:00:24 613000 -- (-906.648) [-906.957] (-903.749) (-907.976) * [-907.619] (-905.979) (-904.006) (-904.077) -- 0:00:24 613500 -- [-904.977] (-906.459) (-905.520) (-903.298) * (-902.870) (-904.474) [-903.317] (-903.715) -- 0:00:24 614000 -- (-906.826) (-905.211) [-904.991] (-906.038) * (-904.779) (-904.296) [-904.831] (-906.210) -- 0:00:24 614500 -- (-903.463) [-902.331] (-905.459) (-901.303) * [-906.810] (-903.002) (-906.518) (-903.106) -- 0:00:24 615000 -- [-902.725] (-905.342) (-909.373) (-901.316) * (-902.973) [-904.209] (-905.833) (-902.751) -- 0:00:24 Average standard deviation of split frequencies: 0.010034 615500 -- (-904.646) [-902.675] (-902.425) (-903.040) * (-903.746) (-903.713) (-904.554) [-904.536] -- 0:00:24 616000 -- (-904.876) [-901.627] (-903.209) (-902.042) * (-904.605) (-902.912) [-905.589] (-906.035) -- 0:00:24 616500 -- (-901.809) (-902.661) (-904.033) [-901.415] * (-908.009) (-907.291) [-905.115] (-905.751) -- 0:00:24 617000 -- [-902.043] (-905.671) (-903.534) (-903.965) * (-901.975) (-902.678) [-903.757] (-905.526) -- 0:00:24 617500 -- (-905.875) [-902.379] (-902.766) (-901.993) * [-906.540] (-906.368) (-905.719) (-903.401) -- 0:00:24 618000 -- (-903.791) [-907.538] (-905.079) (-902.030) * (-905.836) (-904.999) [-902.394] (-905.585) -- 0:00:24 618500 -- (-906.140) [-904.364] (-907.530) (-901.925) * [-905.436] (-902.863) (-902.487) (-904.689) -- 0:00:24 619000 -- (-902.001) (-902.701) [-902.631] (-905.694) * (-901.702) (-903.393) (-908.613) [-903.504] -- 0:00:24 619500 -- (-903.913) (-902.242) (-903.384) [-904.706] * (-903.693) (-906.101) [-905.047] (-904.452) -- 0:00:23 620000 -- (-903.048) (-901.990) [-902.017] (-902.289) * (-903.066) (-901.642) [-903.226] (-904.407) -- 0:00:23 Average standard deviation of split frequencies: 0.009283 620500 -- (-906.715) (-903.582) (-905.641) [-903.840] * [-902.554] (-903.233) (-903.903) (-907.910) -- 0:00:23 621000 -- (-904.628) [-903.627] (-906.397) (-905.421) * (-903.206) [-901.996] (-903.070) (-906.296) -- 0:00:23 621500 -- (-907.864) (-907.884) [-904.603] (-903.758) * [-903.774] (-903.581) (-904.285) (-905.781) -- 0:00:23 622000 -- (-904.441) (-907.077) [-902.647] (-905.768) * (-905.962) (-902.502) [-903.334] (-906.534) -- 0:00:23 622500 -- (-903.264) (-904.006) [-905.684] (-906.354) * (-903.816) [-901.764] (-904.754) (-907.392) -- 0:00:23 623000 -- (-903.905) (-906.608) [-901.701] (-903.334) * [-902.221] (-902.885) (-903.461) (-903.278) -- 0:00:23 623500 -- (-904.610) [-901.707] (-902.517) (-902.938) * (-902.759) (-903.016) (-903.954) [-904.285] -- 0:00:23 624000 -- (-903.396) (-903.496) [-903.609] (-903.211) * (-902.174) [-902.962] (-905.369) (-901.844) -- 0:00:23 624500 -- [-902.426] (-902.168) (-903.878) (-907.000) * (-903.070) (-909.673) (-903.443) [-903.766] -- 0:00:23 625000 -- [-904.656] (-903.168) (-903.020) (-904.259) * (-904.709) [-903.857] (-906.284) (-904.833) -- 0:00:23 Average standard deviation of split frequencies: 0.009329 625500 -- [-908.062] (-904.416) (-901.754) (-903.187) * (-903.371) (-902.757) (-903.207) [-902.684] -- 0:00:23 626000 -- [-903.020] (-908.219) (-901.754) (-905.505) * (-902.554) (-907.553) [-903.113] (-904.628) -- 0:00:23 626500 -- (-904.016) [-911.334] (-905.546) (-904.157) * (-903.292) [-906.831] (-907.189) (-904.716) -- 0:00:23 627000 -- (-902.406) [-904.917] (-903.753) (-907.397) * (-905.156) [-901.650] (-903.408) (-904.118) -- 0:00:23 627500 -- (-910.116) [-901.400] (-903.253) (-907.715) * (-903.268) (-901.650) [-903.317] (-903.718) -- 0:00:23 628000 -- [-902.221] (-902.985) (-904.444) (-904.893) * [-903.077] (-903.123) (-902.133) (-905.674) -- 0:00:23 628500 -- (-905.597) [-904.254] (-904.285) (-901.959) * (-902.351) (-904.286) (-903.120) [-902.337] -- 0:00:23 629000 -- (-905.738) (-904.113) (-903.669) [-902.218] * (-902.571) [-902.698] (-902.215) (-905.804) -- 0:00:23 629500 -- [-903.937] (-903.178) (-906.154) (-906.202) * (-902.396) (-905.434) [-904.133] (-907.033) -- 0:00:23 630000 -- (-901.546) (-904.265) [-904.249] (-902.590) * (-902.811) [-904.074] (-902.260) (-906.583) -- 0:00:23 Average standard deviation of split frequencies: 0.009541 630500 -- (-903.567) (-903.803) [-904.190] (-907.298) * (-906.728) (-903.025) [-903.325] (-903.668) -- 0:00:23 631000 -- [-903.559] (-905.302) (-903.910) (-904.686) * (-903.684) (-903.246) (-905.566) [-903.428] -- 0:00:23 631500 -- [-908.924] (-904.877) (-902.507) (-907.713) * [-901.636] (-905.920) (-902.191) (-903.121) -- 0:00:23 632000 -- (-904.240) (-905.814) [-903.831] (-902.755) * (-902.851) [-902.401] (-907.580) (-903.530) -- 0:00:23 632500 -- [-903.041] (-905.318) (-906.168) (-902.773) * (-902.802) (-903.288) [-903.851] (-903.647) -- 0:00:23 633000 -- (-902.560) (-902.632) (-903.981) [-902.773] * (-902.446) [-903.124] (-906.561) (-903.477) -- 0:00:23 633500 -- [-902.530] (-902.373) (-903.928) (-902.888) * (-902.292) (-902.989) [-904.960] (-902.380) -- 0:00:23 634000 -- (-904.049) (-902.602) (-902.637) [-902.696] * (-902.838) (-904.052) (-901.451) [-903.223] -- 0:00:23 634500 -- (-906.075) (-904.146) [-904.108] (-904.256) * (-903.312) [-902.596] (-902.168) (-904.111) -- 0:00:23 635000 -- (-906.690) (-906.062) (-909.235) [-902.984] * (-903.950) [-902.769] (-903.082) (-905.426) -- 0:00:22 Average standard deviation of split frequencies: 0.009679 635500 -- (-904.420) [-902.304] (-906.972) (-901.525) * (-905.630) (-904.940) [-903.878] (-904.272) -- 0:00:22 636000 -- (-903.590) (-902.341) (-908.909) [-901.532] * (-902.859) [-903.448] (-904.554) (-904.308) -- 0:00:22 636500 -- (-904.307) (-902.184) (-902.535) [-906.319] * (-901.920) [-902.101] (-902.784) (-904.533) -- 0:00:22 637000 -- (-902.640) (-902.456) [-903.540] (-903.572) * (-901.731) (-902.877) [-902.974] (-907.779) -- 0:00:22 637500 -- (-904.414) [-902.361] (-902.886) (-905.001) * (-902.685) (-902.073) [-903.303] (-902.119) -- 0:00:22 638000 -- (-905.531) (-902.960) [-903.607] (-902.929) * (-903.436) (-905.826) [-908.443] (-903.310) -- 0:00:22 638500 -- (-906.123) (-902.848) [-904.238] (-903.705) * (-902.801) [-902.090] (-901.930) (-902.216) -- 0:00:22 639000 -- (-903.160) (-902.572) [-908.071] (-903.586) * (-905.131) (-903.188) (-901.935) [-902.907] -- 0:00:22 639500 -- (-902.100) (-902.413) (-904.000) [-903.181] * (-905.296) (-902.515) (-902.990) [-902.073] -- 0:00:22 640000 -- [-902.592] (-906.985) (-902.826) (-904.501) * (-903.963) [-902.294] (-903.971) (-901.857) -- 0:00:22 Average standard deviation of split frequencies: 0.010085 640500 -- [-902.284] (-902.583) (-905.431) (-902.201) * (-904.055) (-902.459) (-903.698) [-904.089] -- 0:00:22 641000 -- [-902.931] (-903.282) (-903.197) (-906.852) * (-903.395) (-903.613) [-903.727] (-904.797) -- 0:00:22 641500 -- (-903.244) (-904.067) [-903.041] (-904.275) * [-902.600] (-903.757) (-904.924) (-905.671) -- 0:00:22 642000 -- [-904.874] (-903.299) (-902.591) (-903.566) * (-902.601) (-902.725) [-901.838] (-904.265) -- 0:00:22 642500 -- [-904.066] (-903.155) (-902.604) (-906.949) * (-901.699) [-905.555] (-902.222) (-903.433) -- 0:00:22 643000 -- (-902.654) (-903.097) (-902.474) [-903.622] * (-901.292) (-904.452) [-902.203] (-905.080) -- 0:00:22 643500 -- (-904.429) [-902.800] (-904.851) (-903.361) * (-903.357) (-903.591) (-902.352) [-903.546] -- 0:00:22 644000 -- [-902.927] (-903.636) (-905.295) (-903.461) * (-905.106) [-902.800] (-902.962) (-905.363) -- 0:00:22 644500 -- (-902.291) (-901.339) [-906.103] (-907.591) * (-910.961) (-904.442) [-904.297] (-905.676) -- 0:00:22 645000 -- [-903.348] (-904.263) (-902.666) (-904.215) * (-912.125) (-904.807) [-902.627] (-902.401) -- 0:00:22 Average standard deviation of split frequencies: 0.010054 645500 -- [-903.423] (-902.799) (-906.685) (-903.490) * (-906.016) (-904.876) (-902.593) [-904.838] -- 0:00:22 646000 -- (-902.099) (-901.909) [-902.714] (-905.231) * (-906.461) [-904.310] (-901.908) (-904.982) -- 0:00:22 646500 -- (-902.550) [-903.702] (-902.394) (-903.551) * (-902.160) (-911.434) (-902.847) [-912.588] -- 0:00:22 647000 -- (-904.921) (-902.864) (-903.363) [-903.866] * (-903.113) (-907.381) [-903.340] (-906.735) -- 0:00:22 647500 -- (-903.981) (-902.620) [-901.971] (-902.944) * (-904.032) (-908.917) (-905.273) [-904.267] -- 0:00:22 648000 -- (-905.436) (-901.932) (-903.447) [-902.032] * (-908.132) (-906.371) [-903.819] (-902.752) -- 0:00:22 648500 -- (-903.890) [-902.062] (-903.254) (-904.144) * [-904.773] (-903.929) (-915.345) (-908.736) -- 0:00:22 649000 -- (-902.734) (-902.202) [-902.471] (-903.539) * (-903.323) [-904.855] (-903.624) (-901.595) -- 0:00:22 649500 -- [-908.870] (-901.939) (-904.611) (-903.925) * [-904.434] (-906.305) (-907.124) (-906.147) -- 0:00:22 650000 -- [-903.828] (-904.602) (-902.982) (-902.199) * (-902.442) (-905.276) (-905.254) [-905.998] -- 0:00:22 Average standard deviation of split frequencies: 0.009762 650500 -- [-902.835] (-903.194) (-904.621) (-902.506) * [-902.246] (-904.003) (-902.62