--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:31:44 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2549/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.90 -905.92
2 -902.86 -906.73
--------------------------------------
TOTAL -902.88 -906.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900085 0.086810 0.364986 1.485150 0.876266 1470.59 1485.80 1.000
r(A<->C){all} 0.165179 0.019621 0.000206 0.449193 0.127813 242.09 246.20 1.000
r(A<->G){all} 0.161530 0.018828 0.000073 0.446694 0.126348 154.97 224.71 1.000
r(A<->T){all} 0.170599 0.021596 0.000029 0.462935 0.130659 188.84 229.58 1.002
r(C<->G){all} 0.170709 0.020564 0.000078 0.465641 0.137172 119.13 170.27 1.000
r(C<->T){all} 0.178678 0.022792 0.000135 0.474154 0.137515 173.76 205.51 1.000
r(G<->T){all} 0.153305 0.018400 0.000286 0.430436 0.113441 102.56 169.12 1.000
pi(A){all} 0.201013 0.000227 0.173085 0.231266 0.200608 1002.31 1251.66 1.000
pi(C){all} 0.328521 0.000321 0.294139 0.362698 0.328388 1278.18 1389.59 1.000
pi(G){all} 0.295660 0.000304 0.259928 0.327965 0.295468 1295.75 1368.93 1.000
pi(T){all} 0.174806 0.000201 0.148244 0.203000 0.174650 1276.61 1388.81 1.000
alpha{1,2} 0.427412 0.223720 0.000148 1.363470 0.268030 1139.92 1140.19 1.001
alpha{3} 0.470963 0.255221 0.000153 1.451667 0.308488 1018.19 1259.59 1.000
pinvar{all} 0.997697 0.000008 0.992245 0.999998 0.998542 1232.14 1278.08 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -880.231713
Model 2: PositiveSelection -880.231711
Model 0: one-ratio -880.231712
Model 7: beta -880.231761
Model 8: beta&w>1 -880.231699
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 3.999999989900971E-6
Model 8 vs 7 1.2399999991430377E-4
>C1
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
>C2
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
>C3
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
>C4
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
>C5
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
>C6
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=222
C1 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
C2 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
C3 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
C4 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
C5 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
C6 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
**************************************************
C1 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
C2 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
C3 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
C4 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
C5 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
C6 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
**************************************************
C1 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
C2 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
C3 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
C4 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
C5 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
C6 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
**************************************************
C1 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
C2 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
C3 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
C4 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
C5 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
C6 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
**************************************************
C1 WDTNRPNPALLTQGMWVQFRAT
C2 WDTNRPNPALLTQGMWVQFRAT
C3 WDTNRPNPALLTQGMWVQFRAT
C4 WDTNRPNPALLTQGMWVQFRAT
C5 WDTNRPNPALLTQGMWVQFRAT
C6 WDTNRPNPALLTQGMWVQFRAT
**********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6660]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6660]--->[6660]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.486 Mb, Max= 30.769 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
C2 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
C3 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
C4 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
C5 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
C6 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
**************************************************
C1 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
C2 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
C3 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
C4 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
C5 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
C6 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
**************************************************
C1 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
C2 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
C3 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
C4 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
C5 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
C6 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
**************************************************
C1 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
C2 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
C3 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
C4 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
C5 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
C6 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
**************************************************
C1 WDTNRPNPALLTQGMWVQFRAT
C2 WDTNRPNPALLTQGMWVQFRAT
C3 WDTNRPNPALLTQGMWVQFRAT
C4 WDTNRPNPALLTQGMWVQFRAT
C5 WDTNRPNPALLTQGMWVQFRAT
C6 WDTNRPNPALLTQGMWVQFRAT
**********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
C2 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
C3 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
C4 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
C5 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
C6 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
**************************************************
C1 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
C2 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
C3 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
C4 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
C5 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
C6 GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
**************************************************
C1 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
C2 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
C3 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
C4 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
C5 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
C6 GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
**************************************************
C1 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
C2 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
C3 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
C4 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
C5 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
C6 CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
**************************************************
C1 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
C2 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
C3 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
C4 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
C5 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
C6 ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
**************************************************
C1 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
C2 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
C3 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
C4 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
C5 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
C6 TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
**************************************************
C1 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
C2 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
C3 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
C4 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
C5 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
C6 GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
**************************************************
C1 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
C2 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
C3 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
C4 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
C5 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
C6 TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
**************************************************
C1 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
C2 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
C3 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
C4 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
C5 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
C6 GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
**************************************************
C1 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
C2 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
C3 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
C4 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
C5 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
C6 GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
**************************************************
C1 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
C2 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
C3 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
C4 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
C5 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
C6 GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
**************************************************
C1 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
C2 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
C3 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
C4 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
C5 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
C6 GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
**************************************************
C1 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
C2 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
C3 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
C4 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
C5 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
C6 TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
**************************************************
C1 GCAGTTCCGTGCCACG
C2 GCAGTTCCGTGCCACG
C3 GCAGTTCCGTGCCACG
C4 GCAGTTCCGTGCCACG
C5 GCAGTTCCGTGCCACG
C6 GCAGTTCCGTGCCACG
****************
>C1
ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
GCAGTTCCGTGCCACG
>C2
ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
GCAGTTCCGTGCCACG
>C3
ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
GCAGTTCCGTGCCACG
>C4
ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
GCAGTTCCGTGCCACG
>C5
ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
GCAGTTCCGTGCCACG
>C6
ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG
GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG
GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA
CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA
ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC
TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG
GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC
TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT
GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC
GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT
GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC
GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG
TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT
GCAGTTCCGTGCCACG
>C1
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
>C2
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
>C3
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
>C4
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
>C5
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
>C6
METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
WDTNRPNPALLTQGMWVQFRAT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 666 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579858225
Setting output file names to "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 77135722
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5413048695
Seed = 2014946875
Swapseed = 1579858225
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1490.539932 -- -24.965149
Chain 2 -- -1490.539932 -- -24.965149
Chain 3 -- -1490.539705 -- -24.965149
Chain 4 -- -1490.539705 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1490.539932 -- -24.965149
Chain 2 -- -1490.539705 -- -24.965149
Chain 3 -- -1490.539932 -- -24.965149
Chain 4 -- -1490.539847 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1490.540] (-1490.540) (-1490.540) (-1490.540) * [-1490.540] (-1490.540) (-1490.540) (-1490.540)
500 -- (-920.926) (-918.792) (-921.883) [-912.564] * (-920.730) [-910.219] (-923.696) (-935.826) -- 0:00:00
1000 -- (-914.121) (-910.275) (-912.023) [-916.195] * (-922.959) (-909.513) (-918.121) [-918.125] -- 0:00:00
1500 -- (-909.571) (-909.657) (-918.291) [-910.963] * (-914.223) [-907.166] (-918.287) (-928.396) -- 0:00:00
2000 -- [-913.665] (-907.677) (-913.505) (-912.092) * [-909.863] (-919.611) (-914.023) (-914.698) -- 0:00:00
2500 -- (-911.372) [-913.289] (-919.405) (-912.836) * (-906.912) (-915.685) (-916.031) [-909.618] -- 0:00:00
3000 -- (-913.176) [-919.770] (-907.802) (-914.430) * (-913.264) (-913.247) [-917.190] (-915.420) -- 0:00:00
3500 -- (-913.284) [-909.645] (-905.570) (-914.821) * (-920.190) (-914.456) (-912.400) [-916.734] -- 0:00:00
4000 -- (-908.781) (-924.513) [-912.075] (-917.501) * (-914.146) [-907.883] (-915.677) (-909.208) -- 0:00:00
4500 -- [-909.374] (-917.285) (-910.792) (-918.668) * (-909.115) (-909.522) (-917.135) [-913.860] -- 0:00:00
5000 -- (-917.132) (-911.814) [-908.110] (-917.085) * (-914.321) (-907.656) [-913.500] (-912.236) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- (-914.787) (-916.240) [-914.253] (-913.544) * (-914.819) (-911.756) (-909.127) [-915.801] -- 0:00:00
6000 -- (-906.801) (-906.032) (-908.044) [-912.463] * [-915.422] (-914.587) (-911.898) (-912.446) -- 0:00:00
6500 -- (-914.379) (-914.643) (-912.269) [-911.580] * [-912.072] (-912.817) (-911.443) (-917.269) -- 0:02:32
7000 -- (-921.738) (-910.604) [-909.406] (-912.872) * [-912.276] (-911.627) (-914.193) (-916.075) -- 0:02:21
7500 -- [-909.456] (-910.005) (-928.357) (-917.930) * (-917.246) [-908.812] (-916.147) (-912.694) -- 0:02:12
8000 -- (-915.028) (-918.105) (-917.338) [-911.621] * (-912.377) (-912.639) [-917.363] (-908.922) -- 0:02:04
8500 -- (-919.540) (-909.429) [-914.129] (-911.158) * (-909.616) (-914.724) [-913.702] (-914.018) -- 0:01:56
9000 -- (-905.745) (-908.141) [-914.259] (-912.212) * (-916.907) (-912.665) (-906.387) [-906.733] -- 0:01:50
9500 -- [-909.247] (-925.568) (-919.650) (-918.280) * (-911.812) (-908.695) [-906.564] (-918.797) -- 0:01:44
10000 -- [-911.057] (-908.087) (-908.974) (-914.821) * (-908.446) [-914.713] (-906.571) (-916.558) -- 0:01:39
Average standard deviation of split frequencies: 0.083969
10500 -- (-913.370) [-910.974] (-915.607) (-910.744) * [-908.364] (-919.579) (-906.735) (-915.215) -- 0:01:34
11000 -- [-908.622] (-914.219) (-915.166) (-913.636) * (-913.541) [-906.807] (-904.259) (-913.146) -- 0:01:29
11500 -- (-911.965) [-909.724] (-916.082) (-913.697) * (-916.540) [-902.041] (-905.951) (-915.148) -- 0:01:25
12000 -- [-906.808] (-912.007) (-913.588) (-911.681) * (-913.787) [-904.765] (-903.714) (-909.367) -- 0:01:22
12500 -- (-910.457) (-909.290) (-917.555) [-911.599] * (-912.272) (-903.553) [-902.624] (-909.422) -- 0:01:19
13000 -- (-912.165) (-925.304) [-909.883] (-907.840) * (-911.272) [-904.893] (-902.375) (-916.964) -- 0:01:15
13500 -- [-917.950] (-918.104) (-913.902) (-926.465) * [-909.523] (-902.670) (-905.393) (-913.698) -- 0:01:13
14000 -- (-915.108) [-911.496] (-919.492) (-910.409) * (-918.998) [-903.979] (-902.432) (-914.685) -- 0:01:10
14500 -- (-915.064) [-905.519] (-916.108) (-913.224) * [-908.530] (-903.926) (-906.504) (-915.102) -- 0:01:07
15000 -- [-907.177] (-919.947) (-919.657) (-917.279) * (-912.284) [-903.181] (-905.019) (-908.101) -- 0:01:05
Average standard deviation of split frequencies: 0.054274
15500 -- (-908.665) (-921.533) [-915.284] (-921.097) * [-908.828] (-903.044) (-904.313) (-912.886) -- 0:01:03
16000 -- [-915.906] (-908.006) (-915.032) (-916.491) * (-915.666) (-903.013) [-902.769] (-917.561) -- 0:01:01
16500 -- (-915.435) (-914.746) (-909.000) [-902.607] * [-915.983] (-902.856) (-906.947) (-913.538) -- 0:00:59
17000 -- (-912.818) [-916.213] (-908.261) (-902.823) * (-919.008) (-902.887) [-903.409] (-913.690) -- 0:00:57
17500 -- (-910.423) (-917.709) (-914.967) [-906.611] * [-909.785] (-904.150) (-902.205) (-917.923) -- 0:00:56
18000 -- [-907.411] (-915.163) (-913.953) (-904.531) * (-911.167) [-903.213] (-903.053) (-917.196) -- 0:00:54
18500 -- (-920.099) (-918.133) (-908.225) [-903.247] * [-907.716] (-906.710) (-902.672) (-916.220) -- 0:00:53
19000 -- (-918.342) (-915.692) (-918.126) [-903.689] * (-911.655) [-902.977] (-903.604) (-913.493) -- 0:00:51
19500 -- [-906.519] (-911.855) (-926.169) (-906.439) * (-911.012) [-903.090] (-906.071) (-906.905) -- 0:00:50
20000 -- (-912.348) (-915.676) (-920.590) [-905.524] * (-921.656) [-903.993] (-902.445) (-901.433) -- 0:00:49
Average standard deviation of split frequencies: 0.055224
20500 -- (-920.060) (-914.948) [-908.280] (-906.639) * (-918.154) (-904.613) (-906.968) [-902.002] -- 0:00:47
21000 -- (-913.639) [-913.169] (-909.974) (-902.713) * (-921.736) (-903.595) (-902.767) [-902.427] -- 0:00:46
21500 -- (-914.034) [-914.607] (-915.507) (-906.586) * (-910.473) [-901.707] (-907.861) (-902.470) -- 0:00:45
22000 -- [-916.132] (-912.110) (-908.789) (-903.987) * (-923.388) [-902.908] (-905.928) (-903.416) -- 0:00:44
22500 -- [-913.152] (-913.261) (-914.208) (-904.570) * (-917.378) [-904.152] (-901.576) (-904.102) -- 0:01:26
23000 -- (-911.648) (-917.606) [-909.605] (-901.593) * (-917.345) (-904.462) [-901.293] (-909.719) -- 0:01:24
23500 -- (-913.721) [-911.759] (-922.712) (-903.309) * [-905.087] (-903.846) (-904.397) (-907.936) -- 0:01:23
24000 -- (-916.231) [-915.621] (-919.516) (-904.461) * (-902.618) [-902.059] (-903.529) (-907.270) -- 0:01:21
24500 -- [-908.889] (-915.274) (-911.747) (-902.005) * [-901.902] (-906.401) (-907.657) (-906.096) -- 0:01:19
25000 -- [-918.281] (-916.000) (-911.784) (-904.428) * (-902.034) [-902.556] (-903.153) (-902.390) -- 0:01:18
Average standard deviation of split frequencies: 0.037086
25500 -- (-913.377) (-911.001) [-904.687] (-904.976) * (-904.454) [-902.541] (-902.985) (-901.935) -- 0:01:16
26000 -- (-908.887) (-914.999) [-904.149] (-903.551) * [-902.771] (-902.810) (-902.803) (-902.249) -- 0:01:14
26500 -- (-918.154) (-916.554) (-905.439) [-904.031] * (-904.334) (-903.282) [-904.672] (-901.492) -- 0:01:13
27000 -- (-910.424) (-912.959) [-904.568] (-903.377) * (-903.455) (-905.391) (-905.224) [-902.181] -- 0:01:12
27500 -- (-914.868) (-914.720) [-903.576] (-906.082) * (-902.869) [-902.936] (-906.128) (-902.062) -- 0:01:10
28000 -- (-908.627) (-916.500) (-903.135) [-903.418] * (-902.918) (-904.882) (-908.343) [-905.440] -- 0:01:09
28500 -- (-914.048) [-911.658] (-903.551) (-903.767) * (-903.038) [-903.133] (-905.644) (-902.933) -- 0:01:08
29000 -- (-911.825) [-916.804] (-902.286) (-905.933) * (-904.381) [-902.997] (-902.107) (-904.965) -- 0:01:06
29500 -- (-912.812) (-930.178) (-905.560) [-905.629] * [-904.798] (-904.554) (-903.836) (-904.882) -- 0:01:05
30000 -- (-910.269) [-910.102] (-905.615) (-908.446) * (-906.625) (-902.934) [-903.178] (-902.359) -- 0:01:04
Average standard deviation of split frequencies: 0.039198
30500 -- (-911.238) [-903.067] (-904.771) (-907.329) * [-902.789] (-904.522) (-902.113) (-902.549) -- 0:01:03
31000 -- (-913.303) (-904.055) (-907.777) [-904.069] * (-903.202) [-906.162] (-903.083) (-908.524) -- 0:01:02
31500 -- [-908.932] (-901.326) (-903.207) (-902.168) * (-904.416) (-905.220) [-902.315] (-905.696) -- 0:01:01
32000 -- [-915.711] (-903.443) (-903.100) (-904.028) * (-904.069) (-902.902) (-905.054) [-905.124] -- 0:01:00
32500 -- (-915.257) (-903.866) [-902.676] (-902.520) * [-902.965] (-902.129) (-902.180) (-901.436) -- 0:00:59
33000 -- [-913.427] (-902.907) (-902.547) (-905.231) * (-903.049) (-903.348) (-904.977) [-902.058] -- 0:00:58
33500 -- (-912.490) (-903.771) [-902.454] (-908.165) * (-903.029) (-904.457) (-903.460) [-902.008] -- 0:00:57
34000 -- (-909.148) (-902.999) [-906.124] (-910.692) * (-906.209) [-902.047] (-904.636) (-902.863) -- 0:00:56
34500 -- (-918.717) [-902.353] (-904.639) (-908.584) * (-907.747) [-902.049] (-903.226) (-902.227) -- 0:00:55
35000 -- [-906.117] (-905.469) (-903.979) (-905.378) * (-904.563) (-904.898) [-901.911] (-901.937) -- 0:00:55
Average standard deviation of split frequencies: 0.034919
35500 -- (-915.261) (-902.040) (-904.465) [-906.689] * [-914.030] (-903.747) (-904.887) (-901.991) -- 0:00:54
36000 -- (-918.049) [-902.850] (-904.278) (-905.566) * (-906.327) [-903.022] (-902.573) (-902.303) -- 0:00:53
36500 -- (-913.995) [-903.936] (-903.163) (-902.361) * (-904.663) (-903.717) (-902.520) [-903.076] -- 0:00:52
37000 -- (-910.980) (-905.590) (-902.088) [-905.354] * (-904.650) (-904.012) [-903.156] (-901.930) -- 0:00:52
37500 -- (-913.754) (-902.929) [-901.575] (-904.465) * (-902.381) (-903.997) (-904.316) [-903.474] -- 0:00:51
38000 -- (-912.956) (-903.707) [-901.698] (-905.713) * [-902.162] (-901.313) (-903.796) (-905.114) -- 0:00:50
38500 -- (-917.960) (-902.534) [-902.925] (-903.557) * (-907.271) (-901.247) (-901.549) [-901.798] -- 0:00:49
39000 -- (-911.098) [-902.416] (-903.073) (-903.166) * (-903.579) (-902.439) [-903.377] (-905.890) -- 0:00:49
39500 -- (-915.375) (-902.286) [-901.630] (-904.001) * [-903.361] (-901.490) (-903.915) (-903.955) -- 0:01:12
40000 -- [-910.321] (-902.467) (-902.574) (-906.564) * [-902.794] (-902.578) (-904.281) (-906.292) -- 0:01:12
Average standard deviation of split frequencies: 0.032730
40500 -- (-908.638) [-902.773] (-902.456) (-907.697) * (-906.284) (-902.018) [-901.669] (-901.632) -- 0:01:11
41000 -- (-915.207) (-903.428) (-901.824) [-903.584] * (-904.540) (-907.296) [-904.361] (-902.212) -- 0:01:10
41500 -- (-908.766) [-905.027] (-902.663) (-902.289) * (-904.465) (-904.968) [-902.472] (-905.248) -- 0:01:09
42000 -- (-910.789) (-905.098) [-902.863] (-901.728) * (-906.109) [-902.666] (-903.289) (-904.533) -- 0:01:08
42500 -- (-913.534) (-903.771) [-902.199] (-902.116) * [-903.130] (-905.725) (-904.742) (-904.683) -- 0:01:07
43000 -- (-914.203) (-905.346) (-905.189) [-903.823] * [-901.640] (-904.389) (-904.075) (-903.931) -- 0:01:06
43500 -- (-914.213) [-905.401] (-904.223) (-903.166) * (-903.481) (-909.777) [-904.442] (-903.078) -- 0:01:05
44000 -- (-909.628) (-905.348) [-907.246] (-904.840) * (-903.488) (-905.166) [-904.274] (-901.733) -- 0:01:05
44500 -- (-916.682) (-906.737) [-904.821] (-904.540) * [-902.553] (-904.321) (-904.839) (-904.487) -- 0:01:04
45000 -- (-917.004) (-905.499) (-904.223) [-902.074] * (-906.942) (-901.562) (-903.945) [-904.605] -- 0:01:03
Average standard deviation of split frequencies: 0.025620
45500 -- (-916.702) (-903.459) [-903.582] (-902.033) * (-902.334) (-901.568) [-904.804] (-903.342) -- 0:01:02
46000 -- (-911.351) [-907.137] (-906.223) (-903.717) * (-903.348) [-902.708] (-907.072) (-901.848) -- 0:01:02
46500 -- [-912.617] (-903.085) (-903.626) (-902.725) * (-902.763) (-903.143) [-906.406] (-901.847) -- 0:01:01
47000 -- (-905.328) [-904.806] (-904.583) (-903.878) * (-902.665) [-902.669] (-905.106) (-902.042) -- 0:01:00
47500 -- (-907.842) (-903.318) [-903.091] (-903.928) * (-905.435) (-901.577) [-904.019] (-901.991) -- 0:01:00
48000 -- (-910.519) (-904.964) [-902.486] (-905.305) * (-902.470) [-904.615] (-903.141) (-901.918) -- 0:00:59
48500 -- (-917.520) (-903.768) [-902.484] (-903.996) * (-903.717) [-901.828] (-905.843) (-903.521) -- 0:00:58
49000 -- (-915.012) (-903.928) (-902.069) [-902.275] * [-905.418] (-902.795) (-908.186) (-904.825) -- 0:00:58
49500 -- (-918.912) [-902.605] (-901.778) (-902.521) * (-902.702) (-904.593) [-904.130] (-902.926) -- 0:00:57
50000 -- (-911.204) [-903.671] (-903.094) (-902.221) * [-903.079] (-904.811) (-902.696) (-905.535) -- 0:00:57
Average standard deviation of split frequencies: 0.027447
50500 -- (-909.160) [-903.376] (-902.550) (-902.610) * (-905.329) [-904.311] (-902.251) (-902.522) -- 0:00:56
51000 -- (-908.761) [-903.021] (-902.393) (-903.989) * [-902.783] (-904.249) (-902.604) (-903.669) -- 0:00:55
51500 -- [-913.533] (-903.047) (-905.930) (-902.915) * (-905.867) (-904.237) (-905.233) [-902.353] -- 0:00:55
52000 -- (-913.732) [-901.759] (-903.419) (-904.938) * (-902.064) [-902.371] (-905.818) (-908.290) -- 0:00:54
52500 -- [-911.810] (-904.614) (-901.948) (-903.986) * (-901.859) (-906.321) [-907.144] (-902.628) -- 0:00:54
53000 -- (-920.756) (-902.389) (-903.586) [-902.913] * (-903.798) (-903.774) (-906.831) [-902.069] -- 0:00:53
53500 -- [-914.387] (-902.501) (-906.114) (-902.941) * (-902.647) [-903.418] (-904.700) (-903.892) -- 0:00:53
54000 -- (-913.174) (-902.432) (-904.340) [-903.011] * (-904.709) [-902.341] (-905.018) (-904.188) -- 0:00:52
54500 -- (-919.318) (-904.318) (-904.262) [-904.340] * (-903.304) (-903.739) (-905.238) [-904.202] -- 0:00:52
55000 -- (-918.510) (-903.666) (-903.944) [-902.897] * (-906.449) [-901.644] (-904.011) (-904.369) -- 0:00:51
Average standard deviation of split frequencies: 0.026937
55500 -- (-907.229) (-904.448) [-903.435] (-902.923) * (-909.352) (-906.858) [-903.186] (-902.260) -- 0:01:08
56000 -- (-908.684) (-902.980) [-904.374] (-904.020) * (-904.863) [-903.550] (-904.679) (-902.823) -- 0:01:07
56500 -- [-909.753] (-902.830) (-907.579) (-908.616) * (-904.848) [-901.546] (-902.677) (-903.865) -- 0:01:06
57000 -- (-904.910) [-903.754] (-908.930) (-904.144) * (-908.408) [-902.063] (-902.765) (-904.439) -- 0:01:06
57500 -- (-904.303) (-902.174) (-904.685) [-902.248] * (-904.614) [-902.388] (-901.656) (-902.263) -- 0:01:05
58000 -- (-906.427) [-902.543] (-904.209) (-902.250) * (-903.255) (-903.012) [-902.820] (-902.632) -- 0:01:04
58500 -- (-905.284) [-904.499] (-902.873) (-903.499) * (-904.270) [-902.027] (-901.822) (-903.705) -- 0:01:04
59000 -- (-902.318) (-904.658) [-902.279] (-903.143) * (-904.819) (-905.941) [-903.658] (-903.147) -- 0:01:03
59500 -- (-904.324) (-903.107) [-903.077] (-903.046) * [-904.973] (-905.160) (-902.286) (-902.409) -- 0:01:03
60000 -- [-902.979] (-903.046) (-902.367) (-908.421) * (-904.990) (-902.292) [-902.301] (-902.541) -- 0:01:02
Average standard deviation of split frequencies: 0.022923
60500 -- [-903.508] (-903.048) (-906.498) (-905.733) * (-902.107) (-902.168) (-907.270) [-902.975] -- 0:01:02
61000 -- (-902.560) (-903.249) (-903.622) [-904.449] * (-903.333) (-901.934) [-906.878] (-902.865) -- 0:01:01
61500 -- (-904.589) [-904.010] (-905.980) (-903.929) * (-903.247) (-905.151) [-902.122] (-905.030) -- 0:01:01
62000 -- (-902.994) (-901.813) (-904.058) [-903.906] * (-904.328) (-903.258) [-902.382] (-903.136) -- 0:01:00
62500 -- [-903.523] (-904.042) (-903.752) (-903.194) * [-902.717] (-902.314) (-903.010) (-903.075) -- 0:01:00
63000 -- (-904.496) (-902.732) [-903.106] (-903.614) * (-903.212) [-903.065] (-903.174) (-901.860) -- 0:00:59
63500 -- (-903.503) (-903.440) [-903.957] (-912.946) * [-902.708] (-902.786) (-901.946) (-902.603) -- 0:00:58
64000 -- [-902.814] (-901.687) (-904.360) (-919.075) * [-905.273] (-903.641) (-903.617) (-902.182) -- 0:00:58
64500 -- (-905.535) [-901.771] (-905.420) (-904.321) * (-903.660) (-902.876) (-901.894) [-901.597] -- 0:00:58
65000 -- (-903.500) [-902.774] (-909.263) (-907.414) * (-902.916) (-902.341) [-903.987] (-901.635) -- 0:00:57
Average standard deviation of split frequencies: 0.025323
65500 -- (-902.818) [-903.318] (-903.255) (-904.221) * (-903.708) (-906.114) [-903.063] (-902.524) -- 0:00:57
66000 -- (-903.145) (-903.812) [-902.951] (-903.918) * (-903.387) (-906.108) [-901.884] (-901.777) -- 0:00:56
66500 -- (-904.007) (-905.251) (-906.507) [-904.070] * [-903.267] (-904.382) (-901.714) (-902.481) -- 0:00:56
67000 -- (-904.539) [-903.701] (-904.069) (-902.371) * (-904.206) [-909.840] (-901.714) (-902.381) -- 0:00:55
67500 -- (-906.625) [-902.164] (-903.306) (-902.578) * (-907.196) [-904.120] (-903.946) (-903.597) -- 0:00:55
68000 -- (-903.434) (-906.110) (-904.289) [-902.384] * [-905.549] (-902.660) (-904.944) (-902.836) -- 0:00:54
68500 -- [-903.036] (-907.380) (-902.934) (-902.873) * (-907.907) (-902.454) [-905.419] (-902.982) -- 0:00:54
69000 -- (-904.317) (-903.037) (-903.387) [-902.936] * [-905.192] (-903.911) (-905.532) (-902.867) -- 0:00:53
69500 -- (-904.686) [-903.419] (-903.041) (-902.779) * [-904.945] (-905.077) (-909.982) (-907.191) -- 0:00:53
70000 -- (-908.165) (-902.390) (-904.217) [-902.343] * [-903.442] (-903.098) (-907.093) (-905.245) -- 0:00:53
Average standard deviation of split frequencies: 0.024348
70500 -- [-901.649] (-902.273) (-908.242) (-901.563) * (-904.340) (-902.705) [-909.030] (-903.578) -- 0:00:52
71000 -- (-905.050) (-902.092) (-909.747) [-902.176] * (-905.881) [-905.214] (-906.276) (-902.625) -- 0:00:52
71500 -- (-903.550) (-903.381) (-907.270) [-901.632] * (-901.954) [-910.766] (-905.001) (-905.403) -- 0:00:51
72000 -- (-907.488) (-902.778) (-911.624) [-901.640] * (-901.953) (-906.924) (-901.859) [-903.730] -- 0:01:04
72500 -- (-908.366) [-903.134] (-908.928) (-902.367) * (-902.260) (-902.500) (-902.810) [-901.775] -- 0:01:03
73000 -- (-909.053) [-903.224] (-905.935) (-905.358) * (-902.498) [-901.547] (-903.205) (-901.692) -- 0:01:03
73500 -- (-905.625) (-902.766) [-904.911] (-903.519) * (-903.217) (-902.045) [-902.909] (-903.236) -- 0:01:03
74000 -- (-902.075) (-902.299) (-904.804) [-901.994] * (-904.202) [-901.959] (-902.550) (-902.930) -- 0:01:02
74500 -- (-904.407) [-903.318] (-904.674) (-903.611) * (-902.229) (-908.080) [-904.027] (-902.853) -- 0:01:02
75000 -- [-904.421] (-903.080) (-907.253) (-901.580) * (-902.229) [-909.656] (-903.127) (-903.139) -- 0:01:01
Average standard deviation of split frequencies: 0.027749
75500 -- (-907.685) (-905.040) [-907.174] (-903.355) * (-910.711) (-904.730) [-901.636] (-904.457) -- 0:01:01
76000 -- (-904.002) (-903.775) (-903.306) [-903.056] * (-904.296) [-906.564] (-902.723) (-905.580) -- 0:01:00
76500 -- (-902.317) (-903.336) (-902.250) [-902.409] * (-903.727) (-903.996) [-904.090] (-905.960) -- 0:01:00
77000 -- (-906.924) (-903.841) [-902.490] (-901.309) * [-903.039] (-903.710) (-904.733) (-906.036) -- 0:00:59
77500 -- (-902.461) (-903.208) [-902.393] (-903.400) * [-903.751] (-905.425) (-903.264) (-903.660) -- 0:00:59
78000 -- [-903.715] (-909.254) (-901.805) (-905.734) * [-902.683] (-904.076) (-903.612) (-906.138) -- 0:00:59
78500 -- [-902.767] (-902.657) (-901.389) (-905.563) * (-903.478) (-904.957) (-904.483) [-905.668] -- 0:00:58
79000 -- (-903.421) [-903.172] (-901.551) (-903.304) * (-902.424) [-905.892] (-902.718) (-907.660) -- 0:00:58
79500 -- (-904.624) (-904.878) (-901.976) [-902.395] * (-903.608) (-902.298) [-903.136] (-905.724) -- 0:00:57
80000 -- (-904.243) (-903.648) [-902.598] (-902.395) * (-904.129) (-901.955) (-905.720) [-904.664] -- 0:00:57
Average standard deviation of split frequencies: 0.030843
80500 -- (-904.654) (-903.638) [-901.399] (-904.680) * [-902.281] (-904.975) (-902.225) (-904.015) -- 0:00:57
81000 -- (-902.829) (-901.827) [-902.402] (-903.656) * (-902.703) [-903.014] (-905.860) (-904.185) -- 0:00:56
81500 -- (-903.431) (-905.219) [-902.320] (-901.878) * (-903.039) (-905.835) (-905.623) [-906.270] -- 0:00:56
82000 -- (-904.063) (-904.343) [-903.322] (-906.273) * [-902.313] (-906.426) (-907.796) (-903.407) -- 0:00:55
82500 -- (-906.286) [-903.256] (-901.882) (-903.293) * (-904.109) (-903.581) (-904.464) [-903.512] -- 0:00:55
83000 -- (-902.994) [-904.131] (-903.563) (-904.409) * [-902.497] (-903.491) (-904.383) (-903.845) -- 0:00:55
83500 -- [-904.895] (-903.674) (-905.371) (-904.109) * (-901.908) (-904.930) [-902.630] (-908.365) -- 0:00:54
84000 -- (-902.891) (-904.946) [-905.230] (-904.750) * (-902.501) [-907.617] (-908.900) (-906.392) -- 0:00:54
84500 -- (-903.005) [-904.900] (-904.216) (-903.611) * (-905.995) (-905.050) [-902.103] (-904.067) -- 0:00:54
85000 -- (-903.794) [-904.474] (-907.574) (-901.828) * (-905.976) [-905.415] (-902.333) (-907.253) -- 0:00:53
Average standard deviation of split frequencies: 0.026830
85500 -- (-902.975) [-902.567] (-903.095) (-902.758) * [-902.370] (-905.725) (-903.417) (-904.765) -- 0:00:53
86000 -- (-902.804) [-903.424] (-903.365) (-903.819) * (-903.306) (-904.562) [-902.711] (-906.353) -- 0:00:53
86500 -- (-901.641) (-901.700) (-904.624) [-902.748] * (-904.305) [-902.413] (-902.454) (-905.750) -- 0:00:52
87000 -- [-901.836] (-903.358) (-904.488) (-902.909) * [-902.582] (-902.105) (-904.770) (-904.351) -- 0:00:52
87500 -- (-902.147) [-902.395] (-902.938) (-902.180) * (-902.566) [-902.386] (-904.666) (-903.214) -- 0:00:52
88000 -- (-901.659) [-902.585] (-904.247) (-902.728) * [-902.033] (-901.497) (-908.150) (-904.312) -- 0:00:51
88500 -- (-901.944) [-904.590] (-904.104) (-901.734) * (-904.477) (-902.331) [-903.562] (-905.462) -- 0:01:01
89000 -- (-902.364) (-904.315) [-906.734] (-906.469) * (-901.660) [-902.306] (-904.830) (-905.572) -- 0:01:01
89500 -- (-902.883) (-902.121) [-904.356] (-906.402) * (-901.518) [-902.759] (-903.745) (-904.239) -- 0:01:01
90000 -- (-904.580) (-902.042) [-903.934] (-903.894) * (-903.185) (-904.174) (-902.838) [-902.193] -- 0:01:00
Average standard deviation of split frequencies: 0.028076
90500 -- (-902.551) (-903.064) (-903.368) [-905.263] * (-902.718) [-904.248] (-906.819) (-904.518) -- 0:01:00
91000 -- (-903.650) (-902.133) (-902.390) [-905.265] * (-902.834) (-906.602) (-901.737) [-901.526] -- 0:00:59
91500 -- (-902.469) (-902.257) [-903.097] (-901.621) * (-904.181) (-905.053) [-903.939] (-902.653) -- 0:00:59
92000 -- (-902.052) (-904.776) (-905.801) [-902.178] * (-905.398) [-903.585] (-903.290) (-903.552) -- 0:00:59
92500 -- (-902.328) (-903.217) (-903.946) [-903.603] * (-903.238) (-902.166) (-904.532) [-903.425] -- 0:00:58
93000 -- [-903.876] (-903.062) (-905.046) (-902.503) * (-902.690) [-903.314] (-906.183) (-902.147) -- 0:00:58
93500 -- (-903.881) (-904.450) [-906.038] (-913.912) * (-902.089) (-904.545) (-914.424) [-903.166] -- 0:00:58
94000 -- (-904.493) (-904.249) [-902.977] (-901.843) * (-902.505) (-901.824) (-904.086) [-903.193] -- 0:00:57
94500 -- (-907.239) [-903.805] (-903.684) (-904.526) * (-901.667) (-902.804) [-905.566] (-908.214) -- 0:00:57
95000 -- [-903.051] (-903.683) (-903.382) (-903.746) * [-903.015] (-902.544) (-902.828) (-910.410) -- 0:00:57
Average standard deviation of split frequencies: 0.026361
95500 -- [-902.999] (-904.657) (-903.015) (-905.551) * (-903.994) [-903.637] (-907.801) (-905.733) -- 0:00:56
96000 -- (-903.709) [-903.097] (-907.675) (-903.161) * (-902.295) [-904.671] (-902.448) (-905.341) -- 0:00:56
96500 -- (-902.063) (-906.122) [-906.709] (-903.370) * [-905.408] (-903.444) (-902.035) (-907.015) -- 0:00:56
97000 -- (-902.508) (-903.328) (-904.370) [-901.557] * (-909.671) (-903.556) [-903.561] (-904.065) -- 0:00:55
97500 -- [-901.882] (-906.824) (-903.115) (-901.777) * (-901.623) (-903.648) (-908.995) [-904.963] -- 0:00:55
98000 -- (-904.352) (-906.428) (-902.838) [-904.991] * [-902.159] (-902.594) (-903.975) (-904.254) -- 0:00:55
98500 -- (-905.336) [-905.462] (-903.194) (-906.450) * (-902.581) (-905.593) (-902.149) [-902.091] -- 0:00:54
99000 -- (-906.316) (-906.803) [-901.950] (-904.921) * (-902.480) [-904.004] (-902.110) (-904.224) -- 0:00:54
99500 -- (-904.593) (-904.932) [-901.605] (-901.550) * (-901.987) (-907.366) (-904.537) [-903.864] -- 0:00:54
100000 -- (-904.524) (-905.618) (-903.069) [-908.140] * (-903.319) [-906.808] (-901.456) (-902.399) -- 0:00:54
Average standard deviation of split frequencies: 0.023934
100500 -- (-902.796) [-904.793] (-903.511) (-903.403) * (-905.854) (-907.224) (-905.101) [-902.581] -- 0:00:53
101000 -- (-904.312) (-905.363) [-902.039] (-905.056) * [-903.265] (-907.695) (-903.991) (-903.132) -- 0:00:53
101500 -- (-902.480) [-903.453] (-903.078) (-904.065) * [-905.745] (-903.771) (-904.720) (-905.127) -- 0:00:53
102000 -- [-901.822] (-903.365) (-903.340) (-901.770) * (-901.922) (-905.066) [-906.443] (-904.961) -- 0:00:52
102500 -- [-904.843] (-905.065) (-903.184) (-904.718) * (-903.455) (-909.812) (-910.672) [-906.080] -- 0:00:52
103000 -- [-903.613] (-904.513) (-904.326) (-902.026) * [-902.394] (-903.527) (-905.777) (-906.296) -- 0:00:52
103500 -- (-906.145) (-903.949) (-904.974) [-904.329] * (-903.657) (-904.145) (-903.867) [-906.484] -- 0:00:51
104000 -- (-907.484) [-901.590] (-905.618) (-902.810) * (-902.804) (-909.506) (-902.538) [-903.626] -- 0:00:51
104500 -- (-904.979) (-902.385) [-907.774] (-902.444) * (-902.177) (-905.367) (-904.887) [-904.884] -- 0:00:51
105000 -- (-901.969) (-901.482) [-904.007] (-904.504) * (-902.034) (-905.639) (-902.061) [-902.075] -- 0:00:51
Average standard deviation of split frequencies: 0.023172
105500 -- [-903.998] (-904.791) (-902.905) (-903.433) * (-902.137) (-903.814) [-904.463] (-903.275) -- 0:00:59
106000 -- [-902.645] (-905.662) (-903.339) (-902.955) * (-901.926) (-905.831) [-903.685] (-905.073) -- 0:00:59
106500 -- (-905.783) [-903.244] (-903.156) (-906.892) * (-901.873) [-904.834] (-904.263) (-902.748) -- 0:00:58
107000 -- (-901.960) [-901.789] (-902.976) (-902.594) * (-902.747) [-902.087] (-902.338) (-905.736) -- 0:00:58
107500 -- (-901.930) [-901.961] (-906.656) (-903.263) * (-902.614) (-901.326) [-903.586] (-902.563) -- 0:00:58
108000 -- (-906.029) (-906.196) (-904.779) [-902.680] * (-903.888) [-904.324] (-905.051) (-911.899) -- 0:00:57
108500 -- (-905.069) [-903.986] (-902.986) (-904.165) * (-902.757) [-902.770] (-903.450) (-910.488) -- 0:00:57
109000 -- (-901.989) (-901.965) [-902.087] (-904.043) * (-905.047) (-903.097) (-905.616) [-905.040] -- 0:00:57
109500 -- (-903.217) (-903.840) (-903.142) [-902.575] * (-902.376) (-903.696) (-905.409) [-903.712] -- 0:00:56
110000 -- (-907.799) [-903.049] (-901.954) (-903.287) * (-903.192) [-906.429] (-906.165) (-903.326) -- 0:00:56
Average standard deviation of split frequencies: 0.024437
110500 -- (-905.493) [-904.604] (-901.964) (-906.219) * [-902.924] (-902.342) (-903.778) (-902.294) -- 0:00:56
111000 -- (-909.084) [-905.094] (-902.285) (-905.152) * (-903.830) (-902.046) [-903.212] (-901.844) -- 0:00:56
111500 -- [-903.336] (-906.909) (-906.971) (-903.126) * (-902.111) (-902.410) (-904.431) [-901.818] -- 0:00:55
112000 -- (-905.450) (-903.911) (-906.325) [-902.698] * (-907.189) [-904.840] (-903.336) (-902.232) -- 0:00:55
112500 -- (-903.257) (-902.654) [-902.565] (-902.685) * [-901.872] (-903.067) (-903.184) (-902.511) -- 0:00:55
113000 -- [-905.038] (-903.781) (-904.523) (-905.456) * (-903.347) (-902.410) (-905.121) [-903.979] -- 0:00:54
113500 -- (-903.181) (-906.666) [-902.923] (-908.674) * (-903.818) (-902.410) [-903.628] (-903.437) -- 0:00:54
114000 -- (-907.522) [-902.135] (-905.061) (-903.510) * (-903.120) (-902.600) (-903.876) [-905.537] -- 0:00:54
114500 -- (-904.747) (-902.219) (-907.992) [-904.505] * (-901.837) (-902.854) [-902.488] (-903.444) -- 0:00:54
115000 -- [-903.352] (-904.460) (-905.290) (-907.398) * (-905.593) (-902.533) (-903.295) [-903.172] -- 0:00:53
Average standard deviation of split frequencies: 0.020996
115500 -- (-903.119) (-904.168) (-906.828) [-904.291] * (-906.686) [-903.522] (-905.000) (-903.174) -- 0:00:53
116000 -- [-902.428] (-905.118) (-903.557) (-902.956) * (-906.732) (-902.184) (-905.355) [-904.135] -- 0:00:53
116500 -- (-904.100) [-903.505] (-904.890) (-901.660) * (-906.303) (-904.740) (-903.011) [-904.562] -- 0:00:53
117000 -- (-903.176) (-909.090) [-906.825] (-901.450) * (-903.471) [-905.045] (-902.574) (-904.842) -- 0:00:52
117500 -- (-902.517) (-903.315) [-903.344] (-901.476) * (-905.533) (-907.391) (-904.449) [-903.583] -- 0:00:52
118000 -- [-904.261] (-902.280) (-901.967) (-904.166) * [-907.987] (-906.838) (-906.051) (-904.957) -- 0:00:52
118500 -- (-905.885) [-904.608] (-902.530) (-906.254) * (-905.349) (-905.659) (-906.243) [-905.658] -- 0:00:52
119000 -- (-906.586) (-903.859) [-901.964] (-903.153) * (-903.508) (-905.042) [-904.265] (-907.635) -- 0:00:51
119500 -- (-905.194) [-902.873] (-904.224) (-902.556) * (-905.309) [-903.450] (-904.766) (-908.536) -- 0:00:51
120000 -- (-905.579) (-904.688) [-906.200] (-901.847) * [-903.185] (-902.021) (-903.987) (-904.713) -- 0:00:51
Average standard deviation of split frequencies: 0.018014
120500 -- [-903.064] (-905.931) (-901.657) (-901.822) * (-905.384) (-904.575) (-908.838) [-904.631] -- 0:00:51
121000 -- [-903.648] (-905.496) (-901.508) (-901.767) * [-902.129] (-912.354) (-904.763) (-905.202) -- 0:00:50
121500 -- (-903.095) (-904.143) (-905.194) [-902.490] * [-905.993] (-906.126) (-904.917) (-905.276) -- 0:00:57
122000 -- (-905.174) [-904.591] (-904.863) (-904.859) * (-903.274) (-906.709) (-904.204) [-902.926] -- 0:00:57
122500 -- (-904.808) (-902.551) (-903.778) [-904.127] * (-904.163) (-904.383) [-902.713] (-901.420) -- 0:00:57
123000 -- (-905.346) (-902.434) [-903.445] (-902.748) * (-903.807) (-903.976) (-904.183) [-901.517] -- 0:00:57
123500 -- (-906.974) [-903.321] (-904.180) (-903.712) * (-906.647) (-904.015) [-907.397] (-901.714) -- 0:00:56
124000 -- (-905.478) (-903.100) [-904.549] (-902.171) * [-906.482] (-905.800) (-902.302) (-901.482) -- 0:00:56
124500 -- (-903.058) (-902.483) (-903.900) [-903.358] * (-908.024) [-907.527] (-909.199) (-908.161) -- 0:00:56
125000 -- (-906.232) (-902.665) [-904.180] (-902.669) * (-907.539) (-907.151) (-904.275) [-905.719] -- 0:00:56
Average standard deviation of split frequencies: 0.020676
125500 -- (-905.439) (-902.752) (-904.996) [-903.259] * (-903.699) (-903.325) (-903.052) [-903.003] -- 0:00:55
126000 -- (-902.618) (-903.564) (-903.347) [-903.216] * (-903.992) [-903.942] (-902.207) (-903.307) -- 0:00:55
126500 -- [-901.566] (-904.769) (-902.045) (-908.395) * (-906.789) (-903.855) (-902.532) [-903.109] -- 0:00:55
127000 -- [-902.179] (-903.806) (-903.585) (-903.773) * (-904.104) [-905.646] (-903.067) (-902.958) -- 0:00:54
127500 -- [-904.513] (-901.874) (-902.854) (-905.049) * (-904.213) (-903.679) (-904.749) [-903.649] -- 0:00:54
128000 -- [-904.943] (-904.254) (-902.498) (-903.115) * (-904.410) (-906.180) (-902.130) [-903.737] -- 0:00:54
128500 -- [-902.692] (-903.122) (-906.517) (-902.666) * (-904.389) (-902.254) (-905.707) [-905.327] -- 0:00:54
129000 -- (-902.398) [-902.966] (-903.627) (-903.249) * (-906.504) (-902.478) (-906.734) [-906.412] -- 0:00:54
129500 -- [-902.328] (-902.047) (-903.217) (-905.069) * [-902.404] (-902.402) (-903.891) (-905.636) -- 0:00:53
130000 -- (-903.243) [-905.082] (-901.932) (-903.120) * (-902.209) (-904.990) (-902.500) [-904.852] -- 0:00:53
Average standard deviation of split frequencies: 0.021456
130500 -- [-902.697] (-905.114) (-901.880) (-906.136) * (-903.449) (-902.787) [-902.654] (-912.617) -- 0:00:53
131000 -- (-905.849) (-902.581) [-904.711] (-906.495) * (-904.044) (-902.252) [-902.418] (-907.548) -- 0:00:53
131500 -- (-903.491) [-902.793] (-902.115) (-904.685) * (-903.377) [-903.015] (-901.810) (-902.055) -- 0:00:52
132000 -- [-902.887] (-902.332) (-902.112) (-904.906) * (-905.182) [-903.196] (-903.232) (-901.657) -- 0:00:52
132500 -- (-905.388) (-904.625) (-901.486) [-901.644] * (-904.294) (-903.196) [-902.715] (-902.306) -- 0:00:52
133000 -- (-902.579) (-905.603) [-902.671] (-901.474) * (-905.239) (-902.656) (-903.699) [-901.690] -- 0:00:52
133500 -- [-901.453] (-905.797) (-903.859) (-902.870) * [-902.654] (-902.124) (-902.792) (-902.727) -- 0:00:51
134000 -- [-906.344] (-907.481) (-902.138) (-901.717) * (-906.962) (-903.592) (-905.087) [-904.246] -- 0:00:51
134500 -- (-906.553) (-901.660) [-903.351] (-902.386) * (-904.124) [-905.011] (-905.889) (-902.301) -- 0:00:51
135000 -- (-904.460) [-907.033] (-904.062) (-901.873) * (-903.986) (-904.288) (-906.101) [-902.638] -- 0:00:51
Average standard deviation of split frequencies: 0.022723
135500 -- (-901.526) (-906.877) (-902.940) [-901.693] * [-902.489] (-901.232) (-905.398) (-907.369) -- 0:00:51
136000 -- [-902.394] (-906.518) (-903.081) (-906.042) * (-906.121) (-902.062) [-903.543] (-902.642) -- 0:00:50
136500 -- (-903.658) (-903.724) [-901.872] (-903.395) * (-906.231) (-904.394) [-904.801] (-904.702) -- 0:00:50
137000 -- [-902.476] (-902.689) (-902.710) (-904.241) * [-902.157] (-903.012) (-902.297) (-902.824) -- 0:00:50
137500 -- (-905.320) [-905.787] (-905.872) (-903.656) * (-905.273) [-902.007] (-904.582) (-902.390) -- 0:00:50
138000 -- (-903.405) (-905.236) (-907.009) [-902.622] * [-902.566] (-903.313) (-902.462) (-903.797) -- 0:00:56
138500 -- (-903.440) (-901.436) (-905.410) [-903.552] * (-903.746) (-905.456) (-904.887) [-903.539] -- 0:00:55
139000 -- (-904.256) (-907.128) (-903.365) [-901.722] * (-902.256) [-902.288] (-905.247) (-903.943) -- 0:00:55
139500 -- (-905.319) (-902.695) [-904.263] (-902.247) * (-901.681) (-906.337) (-906.743) [-905.038] -- 0:00:55
140000 -- [-901.390] (-903.185) (-901.941) (-901.775) * (-905.089) (-903.245) [-903.252] (-902.997) -- 0:00:55
Average standard deviation of split frequencies: 0.020666
140500 -- [-901.804] (-901.635) (-902.130) (-903.612) * [-902.883] (-906.696) (-902.426) (-902.494) -- 0:00:55
141000 -- [-903.255] (-901.945) (-904.766) (-904.870) * (-901.768) (-903.011) [-903.616] (-901.570) -- 0:00:54
141500 -- (-902.240) [-902.183] (-904.765) (-903.679) * (-901.669) [-902.786] (-904.403) (-901.410) -- 0:00:54
142000 -- (-904.882) (-905.018) [-902.042] (-907.168) * (-901.907) (-907.116) [-904.055] (-903.014) -- 0:00:54
142500 -- (-902.757) (-903.227) [-902.048] (-901.939) * (-901.959) (-905.818) [-902.130] (-903.669) -- 0:00:54
143000 -- [-903.271] (-903.659) (-902.302) (-901.983) * (-903.621) (-902.250) (-902.031) [-901.977] -- 0:00:53
143500 -- (-904.829) [-903.005] (-902.967) (-902.403) * (-904.709) (-906.062) [-903.015] (-903.123) -- 0:00:53
144000 -- (-902.105) (-902.978) [-903.051] (-904.618) * [-903.094] (-903.500) (-902.846) (-905.812) -- 0:00:53
144500 -- (-905.042) (-902.352) (-903.072) [-903.687] * (-902.931) (-906.133) [-904.470] (-905.485) -- 0:00:53
145000 -- (-903.732) (-901.781) (-905.198) [-901.583] * (-902.859) (-903.006) (-903.453) [-903.227] -- 0:00:53
Average standard deviation of split frequencies: 0.020732
145500 -- (-905.766) (-905.054) (-902.993) [-901.583] * (-905.024) [-904.835] (-901.890) (-903.145) -- 0:00:52
146000 -- (-905.853) (-902.680) [-902.172] (-901.675) * (-908.190) [-903.705] (-903.456) (-902.722) -- 0:00:52
146500 -- (-905.521) [-904.601] (-907.506) (-905.136) * (-904.147) (-903.879) [-902.284] (-903.249) -- 0:00:52
147000 -- (-906.043) [-902.732] (-905.405) (-904.117) * (-905.011) (-903.027) (-904.041) [-902.674] -- 0:00:52
147500 -- (-907.261) [-901.894] (-905.063) (-904.809) * (-902.362) [-903.056] (-901.542) (-903.228) -- 0:00:52
148000 -- [-906.034] (-907.152) (-904.540) (-905.656) * [-902.948] (-902.534) (-903.427) (-906.220) -- 0:00:51
148500 -- (-904.662) (-903.155) [-902.742] (-906.227) * (-903.196) (-904.445) (-907.550) [-902.412] -- 0:00:51
149000 -- (-905.326) [-903.233] (-906.448) (-903.018) * (-903.993) (-904.008) [-905.480] (-903.524) -- 0:00:51
149500 -- (-905.036) (-903.716) (-901.858) [-902.254] * (-902.934) (-903.638) [-903.602] (-902.973) -- 0:00:51
150000 -- [-902.545] (-902.962) (-903.023) (-904.885) * (-902.157) [-901.749] (-903.138) (-902.020) -- 0:00:51
Average standard deviation of split frequencies: 0.018443
150500 -- (-902.610) [-903.690] (-903.679) (-903.114) * (-904.062) (-904.138) (-904.379) [-902.287] -- 0:00:50
151000 -- (-902.124) (-906.910) [-904.039] (-903.641) * (-901.454) (-902.941) [-901.413] (-902.386) -- 0:00:50
151500 -- [-903.212] (-902.906) (-902.523) (-905.648) * (-901.703) (-902.753) (-904.375) [-904.737] -- 0:00:50
152000 -- (-902.347) (-902.649) [-902.894] (-903.719) * [-908.004] (-906.427) (-903.808) (-902.035) -- 0:00:50
152500 -- (-903.203) (-902.329) [-903.316] (-909.622) * (-902.216) (-904.303) (-904.971) [-902.676] -- 0:00:50
153000 -- (-906.279) (-904.347) [-903.519] (-908.554) * (-906.696) (-904.501) (-909.896) [-902.732] -- 0:00:49
153500 -- (-904.068) (-903.656) (-903.777) [-905.255] * (-906.546) [-906.122] (-902.394) (-902.835) -- 0:00:49
154000 -- (-906.894) (-906.580) (-902.666) [-902.111] * [-902.845] (-903.898) (-903.664) (-902.508) -- 0:00:49
154500 -- [-906.155] (-902.989) (-903.009) (-903.509) * [-901.544] (-904.099) (-903.509) (-903.992) -- 0:00:54
155000 -- (-909.849) [-906.857] (-902.560) (-903.597) * [-902.956] (-904.578) (-902.219) (-901.584) -- 0:00:54
Average standard deviation of split frequencies: 0.019562
155500 -- (-905.479) (-909.369) (-904.672) [-903.345] * [-901.568] (-906.042) (-901.830) (-903.724) -- 0:00:54
156000 -- [-904.818] (-906.988) (-904.988) (-905.346) * (-904.208) (-904.780) [-903.880] (-904.644) -- 0:00:54
156500 -- (-907.430) [-902.022] (-903.377) (-903.228) * (-904.649) [-902.857] (-904.161) (-905.002) -- 0:00:53
157000 -- (-906.460) (-902.287) [-904.766] (-903.554) * (-903.597) (-902.197) (-902.442) [-904.436] -- 0:00:53
157500 -- (-908.321) (-905.681) (-903.080) [-902.827] * [-902.036] (-902.996) (-903.226) (-903.864) -- 0:00:53
158000 -- (-905.118) (-913.643) (-903.296) [-903.641] * (-902.135) [-901.785] (-905.493) (-906.430) -- 0:00:53
158500 -- (-906.295) (-901.617) [-902.046] (-904.190) * (-903.764) [-904.595] (-904.440) (-905.028) -- 0:00:53
159000 -- (-904.469) [-904.691] (-904.258) (-903.761) * [-902.745] (-904.535) (-903.891) (-904.412) -- 0:00:52
159500 -- (-903.347) (-902.880) (-904.506) [-902.874] * (-902.842) (-909.453) [-907.226] (-902.244) -- 0:00:52
160000 -- (-902.554) (-904.187) [-904.399] (-901.728) * (-902.653) (-904.966) [-902.879] (-902.927) -- 0:00:52
Average standard deviation of split frequencies: 0.020375
160500 -- (-903.211) [-902.300] (-907.047) (-902.698) * (-901.911) (-907.312) (-902.640) [-902.532] -- 0:00:52
161000 -- (-904.088) [-901.958] (-905.171) (-902.792) * (-902.297) (-902.664) (-904.992) [-908.477] -- 0:00:52
161500 -- (-906.268) (-901.856) (-904.470) [-902.056] * (-901.913) (-902.388) [-903.992] (-901.951) -- 0:00:51
162000 -- (-905.637) [-901.914] (-905.522) (-903.187) * (-904.556) (-904.217) [-902.264] (-902.168) -- 0:00:51
162500 -- (-904.918) (-903.801) [-905.433] (-904.141) * (-903.803) (-905.241) (-902.872) [-903.090] -- 0:00:51
163000 -- [-902.362] (-904.235) (-903.925) (-903.427) * (-905.015) [-905.224] (-904.750) (-904.184) -- 0:00:51
163500 -- (-906.898) (-905.087) (-904.047) [-901.953] * [-902.912] (-903.302) (-903.821) (-907.591) -- 0:00:51
164000 -- [-904.696] (-906.121) (-904.795) (-904.136) * (-905.129) (-908.739) (-902.211) [-905.297] -- 0:00:50
164500 -- [-904.809] (-903.161) (-902.577) (-903.712) * (-901.536) [-903.466] (-903.177) (-904.965) -- 0:00:50
165000 -- [-904.315] (-903.256) (-903.584) (-905.202) * (-901.552) (-903.029) [-903.068] (-903.694) -- 0:00:50
Average standard deviation of split frequencies: 0.019405
165500 -- (-905.933) [-905.056] (-903.492) (-906.566) * [-901.648] (-902.991) (-902.095) (-908.193) -- 0:00:50
166000 -- (-904.894) (-902.696) [-903.147] (-904.189) * (-902.507) (-904.302) [-901.685] (-905.823) -- 0:00:50
166500 -- (-905.060) (-905.133) (-908.485) [-902.842] * (-903.170) [-904.009] (-903.993) (-903.419) -- 0:00:50
167000 -- (-907.212) [-905.428] (-902.564) (-903.699) * [-904.063] (-903.335) (-903.889) (-903.291) -- 0:00:49
167500 -- (-906.108) (-902.350) [-903.325] (-905.353) * (-905.126) [-903.175] (-903.445) (-903.085) -- 0:00:49
168000 -- (-902.722) (-902.005) [-903.742] (-905.841) * (-903.049) [-904.608] (-908.246) (-902.692) -- 0:00:49
168500 -- [-904.254] (-901.571) (-904.797) (-906.997) * (-904.305) (-902.788) (-901.832) [-903.895] -- 0:00:49
169000 -- (-905.939) [-902.936] (-904.043) (-905.414) * [-904.192] (-904.986) (-903.938) (-903.389) -- 0:00:49
169500 -- (-909.240) [-902.104] (-903.622) (-902.734) * (-906.013) (-902.252) [-902.042] (-914.736) -- 0:00:48
170000 -- [-904.162] (-903.086) (-908.683) (-902.347) * (-903.417) (-902.719) (-903.101) [-905.245] -- 0:00:48
Average standard deviation of split frequencies: 0.017954
170500 -- [-905.730] (-904.562) (-901.821) (-902.645) * (-904.908) [-902.617] (-902.557) (-901.428) -- 0:00:53
171000 -- (-906.566) (-909.581) (-901.943) [-903.603] * (-907.644) [-902.719] (-905.031) (-903.417) -- 0:00:53
171500 -- (-905.914) (-903.752) (-904.759) [-903.173] * [-905.670] (-902.293) (-903.834) (-903.918) -- 0:00:53
172000 -- (-904.221) (-906.071) [-902.097] (-901.472) * (-902.425) (-902.639) [-902.259] (-904.038) -- 0:00:52
172500 -- (-902.916) (-906.209) [-902.880] (-902.618) * (-902.384) (-905.517) [-905.613] (-904.617) -- 0:00:52
173000 -- (-902.911) (-904.352) (-902.695) [-903.156] * (-903.680) (-903.459) [-904.099] (-903.159) -- 0:00:52
173500 -- [-902.206] (-907.410) (-901.925) (-904.887) * (-901.778) (-902.792) [-904.958] (-904.479) -- 0:00:52
174000 -- (-901.898) (-903.139) (-904.764) [-901.811] * (-902.178) (-903.965) [-904.217] (-911.274) -- 0:00:52
174500 -- (-901.757) [-904.802] (-906.446) (-902.650) * [-901.493] (-902.193) (-904.029) (-907.582) -- 0:00:52
175000 -- (-902.585) [-906.514] (-903.231) (-902.471) * (-902.842) [-903.119] (-903.196) (-902.042) -- 0:00:51
Average standard deviation of split frequencies: 0.016353
175500 -- (-908.178) (-903.947) [-907.776] (-903.870) * (-902.113) (-902.134) [-903.198] (-903.303) -- 0:00:51
176000 -- (-901.791) (-904.199) (-906.073) [-904.915] * [-909.208] (-901.311) (-902.513) (-903.460) -- 0:00:51
176500 -- (-903.915) (-905.264) (-909.946) [-903.604] * [-909.688] (-904.525) (-902.206) (-902.728) -- 0:00:51
177000 -- (-904.062) (-904.037) (-904.707) [-903.137] * (-903.713) [-905.615] (-902.985) (-903.221) -- 0:00:51
177500 -- (-901.898) [-903.960] (-903.179) (-903.104) * (-903.049) (-902.243) (-903.492) [-902.215] -- 0:00:50
178000 -- (-902.107) (-902.745) (-905.693) [-903.969] * (-902.302) [-905.184] (-902.763) (-903.535) -- 0:00:50
178500 -- [-903.349] (-903.035) (-905.381) (-905.305) * (-903.465) (-902.520) [-902.049] (-903.697) -- 0:00:50
179000 -- (-903.957) (-907.549) (-903.900) [-902.621] * (-907.107) (-902.284) (-902.509) [-904.985] -- 0:00:50
179500 -- (-904.527) (-908.190) [-904.633] (-903.476) * [-902.761] (-904.730) (-902.807) (-904.739) -- 0:00:50
180000 -- (-903.180) (-903.852) [-906.352] (-905.721) * (-906.388) [-902.283] (-902.416) (-902.291) -- 0:00:50
Average standard deviation of split frequencies: 0.015366
180500 -- (-903.520) [-903.078] (-903.983) (-903.678) * [-903.927] (-903.929) (-902.315) (-905.679) -- 0:00:49
181000 -- (-904.712) (-903.137) [-903.422] (-905.184) * (-904.079) (-904.439) [-903.933] (-904.550) -- 0:00:49
181500 -- [-903.525] (-901.456) (-903.200) (-903.432) * (-905.631) (-902.210) (-904.138) [-902.708] -- 0:00:49
182000 -- [-902.301] (-902.230) (-904.137) (-902.796) * (-905.899) (-904.213) (-903.603) [-902.757] -- 0:00:49
182500 -- (-902.197) (-903.340) [-904.187] (-903.855) * [-903.152] (-903.593) (-902.377) (-905.987) -- 0:00:49
183000 -- (-903.033) (-904.103) (-903.878) [-902.915] * (-905.673) [-904.111] (-902.441) (-907.336) -- 0:00:49
183500 -- (-903.818) (-902.713) (-903.357) [-904.668] * (-901.787) (-902.233) (-905.095) [-905.838] -- 0:00:48
184000 -- (-904.816) (-902.149) (-903.723) [-904.982] * [-904.200] (-902.986) (-902.979) (-906.878) -- 0:00:48
184500 -- (-902.770) (-905.292) (-902.989) [-903.713] * [-903.176] (-903.178) (-903.514) (-901.303) -- 0:00:48
185000 -- (-901.952) [-904.257] (-903.385) (-904.527) * (-903.502) [-902.339] (-903.161) (-901.621) -- 0:00:48
Average standard deviation of split frequencies: 0.016140
185500 -- (-902.863) [-905.768] (-905.197) (-902.623) * (-903.480) [-902.605] (-904.208) (-904.989) -- 0:00:48
186000 -- [-902.629] (-906.303) (-903.130) (-902.598) * [-902.257] (-905.895) (-903.569) (-905.713) -- 0:00:52
186500 -- (-902.717) [-907.723] (-905.999) (-905.878) * [-902.895] (-905.994) (-903.351) (-905.765) -- 0:00:52
187000 -- [-903.404] (-902.503) (-903.230) (-904.554) * (-903.372) (-904.173) [-903.737] (-907.097) -- 0:00:52
187500 -- (-904.189) [-901.748] (-903.001) (-904.848) * [-906.011] (-907.159) (-902.816) (-907.239) -- 0:00:52
188000 -- (-902.709) [-902.570] (-907.173) (-907.021) * (-902.839) [-903.665] (-904.066) (-903.522) -- 0:00:51
188500 -- (-905.382) (-902.114) [-905.069] (-904.167) * (-907.817) [-906.329] (-903.113) (-903.385) -- 0:00:51
189000 -- (-905.313) (-902.478) (-904.514) [-902.696] * [-903.637] (-903.903) (-904.861) (-902.699) -- 0:00:51
189500 -- [-904.626] (-902.427) (-902.974) (-905.544) * (-904.559) [-903.191] (-903.420) (-901.910) -- 0:00:51
190000 -- (-903.302) (-901.873) [-902.976] (-905.333) * [-904.850] (-902.103) (-903.769) (-904.548) -- 0:00:51
Average standard deviation of split frequencies: 0.015355
190500 -- (-901.327) (-903.831) (-903.798) [-903.448] * (-901.967) (-902.137) [-906.278] (-905.132) -- 0:00:50
191000 -- (-905.184) (-902.628) (-903.981) [-902.251] * (-903.154) (-901.876) (-902.830) [-902.517] -- 0:00:50
191500 -- (-903.658) (-902.846) [-901.974] (-901.396) * [-902.108] (-904.412) (-903.306) (-904.204) -- 0:00:50
192000 -- (-902.507) (-903.056) (-901.551) [-903.038] * (-905.395) (-904.996) [-905.586] (-905.220) -- 0:00:50
192500 -- (-904.332) (-904.074) [-903.229] (-904.254) * (-904.272) (-903.422) [-904.765] (-903.249) -- 0:00:50
193000 -- (-901.382) (-903.262) [-903.227] (-905.765) * (-906.966) (-904.096) (-903.677) [-903.722] -- 0:00:50
193500 -- (-902.617) [-903.853] (-901.789) (-901.545) * (-901.981) (-905.169) [-903.328] (-903.313) -- 0:00:50
194000 -- (-902.667) [-904.614] (-902.137) (-902.713) * [-901.785] (-904.580) (-906.313) (-904.150) -- 0:00:49
194500 -- (-903.787) (-903.403) (-901.893) [-902.925] * (-902.421) (-906.955) [-903.113] (-902.935) -- 0:00:49
195000 -- (-902.893) (-903.989) (-902.866) [-902.469] * (-904.749) (-904.452) (-902.569) [-905.081] -- 0:00:49
Average standard deviation of split frequencies: 0.014431
195500 -- (-903.962) (-902.617) (-902.286) [-906.001] * [-903.675] (-904.082) (-903.108) (-901.570) -- 0:00:49
196000 -- (-903.218) (-904.685) (-909.540) [-904.726] * (-907.007) [-904.928] (-902.553) (-903.692) -- 0:00:49
196500 -- (-902.308) (-903.098) [-906.511] (-903.473) * (-906.773) (-904.280) [-901.826] (-902.372) -- 0:00:49
197000 -- [-901.908] (-904.226) (-906.540) (-903.210) * [-903.738] (-904.611) (-903.788) (-902.036) -- 0:00:48
197500 -- (-902.870) (-903.183) [-904.864] (-903.585) * (-905.343) (-902.632) (-903.243) [-902.543] -- 0:00:48
198000 -- (-902.874) (-903.449) (-902.191) [-905.217] * (-902.528) (-902.652) (-903.545) [-902.799] -- 0:00:48
198500 -- (-904.769) [-903.291] (-903.630) (-904.912) * [-903.182] (-902.636) (-902.196) (-902.778) -- 0:00:48
199000 -- (-902.737) (-903.194) (-904.323) [-904.973] * [-903.596] (-906.639) (-902.653) (-902.673) -- 0:00:48
199500 -- (-903.818) (-906.492) (-905.021) [-901.529] * [-905.703] (-904.075) (-901.616) (-903.684) -- 0:00:48
200000 -- [-901.583] (-905.436) (-902.096) (-902.449) * (-904.244) (-905.596) [-904.796] (-905.421) -- 0:00:48
Average standard deviation of split frequencies: 0.015753
200500 -- (-902.340) (-904.700) (-902.468) [-904.004] * (-903.119) (-902.655) (-903.408) [-902.475] -- 0:00:47
201000 -- [-902.321] (-906.368) (-904.106) (-905.071) * (-904.865) (-901.811) [-908.747] (-904.142) -- 0:00:47
201500 -- (-902.780) (-906.176) (-901.930) [-903.600] * (-905.762) (-902.406) (-902.525) [-902.896] -- 0:00:51
202000 -- (-904.789) (-902.873) [-903.115] (-903.458) * (-902.033) (-902.490) [-902.023] (-904.756) -- 0:00:51
202500 -- (-907.326) [-904.577] (-906.378) (-905.196) * [-901.797] (-902.206) (-903.602) (-903.477) -- 0:00:51
203000 -- (-907.792) (-903.750) (-902.594) [-903.650] * (-904.744) (-905.836) (-905.587) [-903.641] -- 0:00:51
203500 -- [-903.422] (-903.743) (-905.166) (-904.877) * [-903.705] (-903.114) (-906.062) (-906.048) -- 0:00:50
204000 -- (-905.385) (-903.485) [-905.598] (-903.574) * (-907.233) (-903.105) [-904.534] (-906.057) -- 0:00:50
204500 -- (-904.466) (-902.337) (-903.050) [-905.305] * (-903.476) (-903.102) (-904.012) [-902.829] -- 0:00:50
205000 -- (-902.474) [-901.422] (-902.516) (-902.364) * [-903.615] (-903.973) (-903.334) (-905.402) -- 0:00:50
Average standard deviation of split frequencies: 0.014814
205500 -- [-905.637] (-903.403) (-903.706) (-902.451) * [-907.263] (-904.700) (-903.504) (-903.242) -- 0:00:50
206000 -- (-904.142) [-902.943] (-905.149) (-902.715) * [-902.761] (-904.677) (-902.453) (-905.140) -- 0:00:50
206500 -- (-903.799) (-902.572) (-907.029) [-902.264] * (-904.361) (-902.487) [-904.931] (-901.917) -- 0:00:49
207000 -- (-904.863) (-903.060) (-905.014) [-902.524] * (-905.113) (-903.715) (-904.364) [-903.602] -- 0:00:49
207500 -- (-902.116) [-901.547] (-903.634) (-905.926) * (-904.660) [-905.259] (-903.254) (-904.820) -- 0:00:49
208000 -- (-903.448) (-905.340) [-904.422] (-905.200) * [-903.175] (-902.116) (-902.363) (-903.141) -- 0:00:49
208500 -- [-904.192] (-905.860) (-906.019) (-904.341) * (-905.665) [-901.816] (-903.935) (-903.263) -- 0:00:49
209000 -- [-903.136] (-903.217) (-902.404) (-903.553) * (-906.747) (-902.498) (-903.136) [-910.015] -- 0:00:49
209500 -- (-902.256) (-906.186) [-902.376] (-901.516) * (-904.139) (-903.678) [-902.286] (-903.474) -- 0:00:49
210000 -- (-903.384) (-903.189) [-903.399] (-902.749) * (-904.455) (-903.110) [-902.871] (-903.660) -- 0:00:48
Average standard deviation of split frequencies: 0.013191
210500 -- (-903.346) (-903.692) [-903.554] (-903.759) * (-901.948) [-902.562] (-906.083) (-902.761) -- 0:00:48
211000 -- [-902.050] (-904.040) (-903.792) (-903.347) * [-903.292] (-901.743) (-903.384) (-905.416) -- 0:00:48
211500 -- (-902.523) (-904.077) [-901.821] (-905.552) * [-901.930] (-901.946) (-902.896) (-904.951) -- 0:00:48
212000 -- (-904.714) (-902.527) (-905.011) [-903.303] * (-903.457) [-901.801] (-903.878) (-906.887) -- 0:00:48
212500 -- (-904.837) [-902.095] (-903.274) (-903.259) * (-903.161) [-901.558] (-903.240) (-901.511) -- 0:00:48
213000 -- (-907.788) (-901.524) (-902.591) [-901.759] * (-903.397) (-903.907) (-905.016) [-901.349] -- 0:00:48
213500 -- [-906.974] (-903.481) (-905.355) (-904.160) * (-909.316) (-903.026) [-903.855] (-903.746) -- 0:00:47
214000 -- (-902.630) [-901.946] (-910.039) (-903.792) * (-901.668) (-901.474) [-903.643] (-901.709) -- 0:00:47
214500 -- (-902.289) [-904.095] (-903.464) (-907.530) * (-902.454) (-901.189) [-902.553] (-901.656) -- 0:00:47
215000 -- [-902.385] (-902.802) (-903.889) (-903.395) * (-902.980) (-901.320) (-903.723) [-901.717] -- 0:00:47
Average standard deviation of split frequencies: 0.013943
215500 -- [-903.348] (-903.847) (-905.916) (-903.760) * [-903.112] (-905.453) (-902.113) (-902.436) -- 0:00:47
216000 -- (-905.035) [-905.051] (-905.454) (-903.740) * (-906.871) (-914.280) (-901.551) [-901.437] -- 0:00:47
216500 -- (-904.101) (-903.963) [-903.425] (-903.916) * (-903.004) [-902.096] (-901.479) (-901.833) -- 0:00:47
217000 -- (-904.647) [-903.409] (-902.427) (-902.569) * (-903.290) [-902.790] (-904.196) (-902.142) -- 0:00:46
217500 -- (-902.618) [-904.836] (-905.530) (-907.661) * [-905.790] (-902.636) (-901.687) (-904.576) -- 0:00:46
218000 -- (-901.473) (-905.408) (-903.567) [-905.572] * (-903.468) [-902.211] (-901.558) (-903.472) -- 0:00:50
218500 -- (-902.784) [-902.874] (-902.439) (-905.231) * (-902.637) [-902.366] (-904.591) (-904.576) -- 0:00:50
219000 -- (-904.806) (-903.254) (-902.349) [-905.944] * (-903.417) (-904.855) (-903.185) [-905.280] -- 0:00:49
219500 -- (-901.867) (-905.752) (-905.154) [-904.001] * [-902.116] (-905.632) (-902.885) (-904.513) -- 0:00:49
220000 -- [-903.110] (-902.215) (-902.645) (-901.628) * [-901.662] (-902.642) (-902.168) (-904.369) -- 0:00:49
Average standard deviation of split frequencies: 0.013055
220500 -- (-904.882) (-901.551) [-903.641] (-904.135) * [-901.828] (-905.769) (-904.337) (-902.819) -- 0:00:49
221000 -- (-906.331) [-903.136] (-909.260) (-903.969) * [-904.079] (-902.464) (-904.893) (-901.956) -- 0:00:49
221500 -- [-906.570] (-901.873) (-904.918) (-903.262) * (-905.563) (-903.237) [-904.198] (-901.328) -- 0:00:49
222000 -- (-908.752) (-904.242) [-904.616] (-904.601) * (-903.570) (-902.899) (-904.664) [-901.473] -- 0:00:49
222500 -- (-903.589) [-902.244] (-906.659) (-908.273) * (-904.015) [-902.603] (-904.977) (-904.305) -- 0:00:48
223000 -- [-903.291] (-905.325) (-903.875) (-906.844) * (-912.588) (-904.006) [-905.762] (-904.857) -- 0:00:48
223500 -- (-902.359) [-902.458] (-906.409) (-902.386) * [-908.170] (-903.678) (-902.074) (-903.008) -- 0:00:48
224000 -- [-901.824] (-903.690) (-907.626) (-904.974) * (-908.610) [-904.880] (-902.303) (-902.442) -- 0:00:48
224500 -- [-903.816] (-901.533) (-907.090) (-906.759) * (-905.943) (-903.748) (-906.975) [-903.428] -- 0:00:48
225000 -- (-902.982) [-902.190] (-905.732) (-905.011) * (-904.508) (-904.805) (-906.383) [-902.740] -- 0:00:48
Average standard deviation of split frequencies: 0.012747
225500 -- (-903.423) (-902.931) [-902.586] (-907.284) * [-910.474] (-905.687) (-903.079) (-906.069) -- 0:00:48
226000 -- (-907.978) (-903.319) [-904.163] (-902.144) * (-907.408) (-903.831) (-902.018) [-902.281] -- 0:00:47
226500 -- (-905.883) (-905.007) (-903.534) [-902.417] * (-908.569) (-906.191) [-905.328] (-902.479) -- 0:00:47
227000 -- (-904.832) (-905.781) [-905.875] (-902.800) * (-905.048) (-904.071) (-904.522) [-903.790] -- 0:00:47
227500 -- (-903.008) (-913.643) [-903.721] (-907.030) * (-904.254) (-903.426) [-903.342] (-902.761) -- 0:00:47
228000 -- (-905.869) (-903.799) (-907.423) [-906.851] * (-902.217) [-901.801] (-902.808) (-903.761) -- 0:00:47
228500 -- (-905.417) (-901.469) [-904.903] (-905.781) * (-903.309) (-902.453) [-906.659] (-905.858) -- 0:00:47
229000 -- (-905.214) (-901.913) (-902.568) [-902.374] * (-907.016) (-902.352) (-902.437) [-903.729] -- 0:00:47
229500 -- (-905.156) [-904.729] (-902.458) (-904.594) * (-902.985) [-903.024] (-902.795) (-907.569) -- 0:00:47
230000 -- (-905.524) [-903.533] (-905.962) (-904.330) * (-905.857) (-902.976) [-902.627] (-907.252) -- 0:00:46
Average standard deviation of split frequencies: 0.012830
230500 -- (-906.569) (-902.382) [-902.883] (-902.451) * (-902.787) (-901.455) [-903.215] (-902.905) -- 0:00:46
231000 -- (-906.975) (-901.869) (-903.480) [-907.620] * (-907.408) (-901.553) (-903.406) [-902.306] -- 0:00:46
231500 -- (-907.928) [-904.302] (-903.160) (-902.614) * (-906.057) (-906.405) (-904.410) [-902.833] -- 0:00:46
232000 -- (-905.465) (-906.514) [-903.754] (-903.626) * (-903.529) (-901.987) [-905.843] (-905.241) -- 0:00:46
232500 -- (-906.329) (-903.891) [-904.061] (-902.763) * (-902.469) (-903.147) [-903.755] (-903.435) -- 0:00:46
233000 -- [-902.246] (-909.806) (-905.944) (-902.880) * (-905.920) (-903.262) [-902.324] (-904.744) -- 0:00:46
233500 -- (-902.101) [-901.588] (-903.425) (-901.674) * (-902.853) (-905.114) (-902.639) [-902.519] -- 0:00:45
234000 -- (-907.488) (-902.644) (-901.653) [-902.041] * (-906.404) (-904.885) (-902.351) [-902.728] -- 0:00:49
234500 -- (-907.892) [-902.226] (-901.379) (-901.911) * [-902.596] (-903.670) (-903.827) (-903.355) -- 0:00:48
235000 -- [-903.706] (-905.599) (-902.104) (-902.134) * [-903.829] (-902.301) (-902.847) (-903.371) -- 0:00:48
Average standard deviation of split frequencies: 0.011541
235500 -- (-905.558) [-905.863] (-901.672) (-904.269) * (-904.035) [-902.149] (-902.128) (-903.840) -- 0:00:48
236000 -- (-903.047) (-905.167) (-903.914) [-902.280] * (-905.676) [-905.597] (-902.469) (-905.633) -- 0:00:48
236500 -- (-904.592) (-903.229) (-904.023) [-903.408] * (-904.739) (-902.566) (-901.542) [-904.661] -- 0:00:48
237000 -- (-902.983) (-905.210) (-908.300) [-902.471] * (-902.318) (-902.376) [-903.159] (-903.129) -- 0:00:48
237500 -- (-902.912) [-903.064] (-904.397) (-907.351) * [-902.319] (-901.942) (-904.180) (-904.579) -- 0:00:48
238000 -- [-903.714] (-902.052) (-905.229) (-903.684) * (-902.149) (-902.688) (-901.962) [-910.579] -- 0:00:48
238500 -- (-904.912) [-905.096] (-905.839) (-903.596) * [-905.947] (-904.050) (-903.554) (-904.884) -- 0:00:47
239000 -- (-905.047) (-903.800) [-904.093] (-903.348) * (-902.976) [-903.485] (-903.739) (-903.796) -- 0:00:47
239500 -- [-906.516] (-904.046) (-904.664) (-909.874) * (-903.982) [-902.775] (-903.911) (-901.982) -- 0:00:47
240000 -- (-902.763) (-902.218) [-902.530] (-902.688) * (-902.812) (-905.045) (-903.952) [-903.050] -- 0:00:47
Average standard deviation of split frequencies: 0.011317
240500 -- (-902.564) (-903.209) [-902.653] (-903.074) * [-904.618] (-903.360) (-902.833) (-902.996) -- 0:00:47
241000 -- (-903.871) [-904.595] (-902.522) (-909.417) * (-905.030) (-901.862) [-911.781] (-904.158) -- 0:00:47
241500 -- (-905.606) [-904.525] (-905.263) (-903.821) * (-908.405) [-906.202] (-910.547) (-903.155) -- 0:00:47
242000 -- (-902.053) (-905.406) (-904.846) [-905.155] * (-908.222) (-903.250) (-902.682) [-903.339] -- 0:00:46
242500 -- (-903.754) [-902.756] (-905.988) (-902.738) * (-903.965) (-902.189) (-903.494) [-902.921] -- 0:00:46
243000 -- (-906.155) [-903.209] (-905.183) (-902.644) * (-901.625) [-903.277] (-905.901) (-902.524) -- 0:00:46
243500 -- (-904.319) (-905.937) (-903.995) [-904.748] * (-902.628) (-905.218) [-902.893] (-907.492) -- 0:00:46
244000 -- (-902.975) (-903.399) [-906.894] (-902.557) * (-908.168) (-904.523) [-903.548] (-902.758) -- 0:00:46
244500 -- [-902.124] (-903.149) (-907.751) (-902.501) * (-906.806) [-904.775] (-903.372) (-901.842) -- 0:00:46
245000 -- (-903.735) (-902.007) (-905.316) [-902.217] * (-903.259) (-908.734) (-907.474) [-903.690] -- 0:00:46
Average standard deviation of split frequencies: 0.011604
245500 -- (-903.399) (-904.341) [-901.822] (-904.648) * (-902.790) (-902.282) [-904.438] (-906.686) -- 0:00:46
246000 -- (-903.889) [-905.291] (-902.798) (-905.449) * (-905.447) (-904.133) (-903.995) [-904.124] -- 0:00:45
246500 -- [-904.833] (-904.084) (-901.689) (-905.098) * (-905.631) (-904.029) [-906.820] (-904.246) -- 0:00:45
247000 -- (-901.399) (-905.277) [-901.837] (-902.132) * (-904.045) (-907.439) [-903.892] (-903.914) -- 0:00:45
247500 -- (-901.755) (-904.263) [-902.151] (-902.869) * (-903.685) (-905.924) [-903.008] (-902.145) -- 0:00:45
248000 -- (-903.725) (-905.518) [-904.102] (-902.677) * (-903.720) (-904.857) [-903.488] (-902.125) -- 0:00:45
248500 -- (-903.653) [-903.658] (-904.467) (-903.799) * (-906.279) (-906.169) (-903.862) [-902.124] -- 0:00:45
249000 -- (-903.026) (-905.177) [-902.047] (-902.904) * (-907.057) (-902.840) (-902.418) [-904.919] -- 0:00:45
249500 -- (-903.983) (-906.058) [-904.534] (-902.301) * [-902.865] (-903.164) (-902.660) (-904.173) -- 0:00:48
250000 -- [-904.202] (-906.007) (-909.876) (-902.601) * (-902.859) (-901.883) (-903.161) [-902.866] -- 0:00:48
Average standard deviation of split frequencies: 0.011388
250500 -- (-905.061) [-902.153] (-904.596) (-905.397) * [-903.785] (-902.761) (-905.274) (-902.616) -- 0:00:47
251000 -- (-904.096) [-901.828] (-904.426) (-905.806) * (-903.144) [-903.271] (-901.878) (-903.475) -- 0:00:47
251500 -- (-903.395) [-901.829] (-903.054) (-902.117) * (-902.893) (-906.369) [-902.509] (-904.260) -- 0:00:47
252000 -- (-903.359) (-903.481) (-901.764) [-903.006] * [-906.089] (-904.258) (-902.392) (-902.898) -- 0:00:47
252500 -- [-903.167] (-902.915) (-903.105) (-903.430) * (-902.725) [-902.465] (-901.538) (-905.276) -- 0:00:47
253000 -- [-901.386] (-905.382) (-903.398) (-904.168) * [-901.642] (-902.072) (-902.631) (-903.125) -- 0:00:47
253500 -- (-901.628) [-904.510] (-902.603) (-906.198) * (-903.414) (-903.473) [-903.242] (-902.978) -- 0:00:47
254000 -- [-903.382] (-901.775) (-903.725) (-903.891) * (-902.211) (-902.499) (-903.067) [-906.508] -- 0:00:46
254500 -- (-903.291) (-902.289) [-903.657] (-904.883) * (-901.849) (-902.448) (-903.070) [-903.862] -- 0:00:46
255000 -- (-905.373) [-903.059] (-904.332) (-902.648) * (-906.020) [-904.171] (-901.803) (-903.336) -- 0:00:46
Average standard deviation of split frequencies: 0.011355
255500 -- (-904.754) [-904.197] (-902.426) (-903.029) * (-904.461) (-903.740) [-905.542] (-902.659) -- 0:00:46
256000 -- [-903.995] (-901.796) (-903.665) (-906.304) * (-902.685) [-903.610] (-903.169) (-904.635) -- 0:00:46
256500 -- (-903.373) [-902.593] (-905.469) (-903.233) * [-902.314] (-905.255) (-905.475) (-902.212) -- 0:00:46
257000 -- (-904.642) (-905.844) [-903.515] (-905.454) * [-903.496] (-906.932) (-904.434) (-902.415) -- 0:00:46
257500 -- (-903.156) (-904.375) (-904.939) [-904.177] * (-905.343) (-902.182) (-906.487) [-902.925] -- 0:00:46
258000 -- (-905.621) (-904.451) (-904.018) [-904.000] * (-902.675) (-901.917) [-906.324] (-905.530) -- 0:00:46
258500 -- [-902.727] (-907.289) (-904.279) (-902.431) * (-902.426) (-901.910) (-909.551) [-907.382] -- 0:00:45
259000 -- [-902.350] (-906.376) (-904.961) (-901.913) * (-904.177) (-901.658) [-906.353] (-903.911) -- 0:00:45
259500 -- (-903.655) (-903.305) [-902.810] (-901.292) * [-902.533] (-904.004) (-902.186) (-901.882) -- 0:00:45
260000 -- (-902.510) (-906.120) (-902.884) [-905.418] * (-902.195) (-902.154) [-901.936] (-904.899) -- 0:00:45
Average standard deviation of split frequencies: 0.011052
260500 -- (-902.407) (-904.447) (-902.126) [-902.198] * (-905.060) (-906.235) [-901.968] (-902.561) -- 0:00:45
261000 -- (-907.662) [-904.866] (-904.233) (-903.235) * (-904.584) (-902.734) [-902.158] (-906.270) -- 0:00:45
261500 -- (-906.052) (-903.403) (-908.666) [-902.462] * (-906.983) [-905.304] (-905.048) (-910.088) -- 0:00:45
262000 -- (-901.934) [-903.143] (-904.592) (-902.502) * (-908.736) (-902.943) [-902.305] (-904.954) -- 0:00:45
262500 -- (-902.078) [-901.479] (-904.685) (-902.895) * (-903.948) (-902.244) [-902.471] (-903.410) -- 0:00:44
263000 -- [-903.485] (-902.797) (-904.967) (-903.388) * [-901.858] (-907.291) (-902.238) (-906.857) -- 0:00:44
263500 -- (-909.982) (-903.479) [-904.285] (-905.390) * [-901.656] (-904.251) (-904.136) (-905.148) -- 0:00:44
264000 -- [-907.472] (-902.289) (-904.670) (-902.729) * (-905.300) (-904.738) (-904.366) [-902.264] -- 0:00:44
264500 -- (-904.414) (-902.619) [-903.789] (-906.404) * (-903.163) [-905.037] (-905.588) (-907.934) -- 0:00:47
265000 -- (-902.597) (-902.174) (-904.176) [-904.067] * (-907.060) (-905.066) (-902.997) [-903.751] -- 0:00:47
Average standard deviation of split frequencies: 0.010436
265500 -- [-902.104] (-902.757) (-904.754) (-904.157) * (-908.504) (-903.136) (-902.487) [-902.375] -- 0:00:47
266000 -- (-902.983) (-902.061) [-903.689] (-903.215) * [-902.044] (-902.995) (-903.975) (-902.444) -- 0:00:46
266500 -- [-903.100] (-902.643) (-902.620) (-905.887) * (-904.387) (-904.699) (-905.115) [-904.735] -- 0:00:46
267000 -- [-901.856] (-903.598) (-904.408) (-905.087) * (-902.829) (-902.870) (-903.591) [-907.243] -- 0:00:46
267500 -- (-902.286) (-903.333) [-903.677] (-907.524) * (-904.098) (-903.617) (-903.549) [-903.121] -- 0:00:46
268000 -- (-903.665) (-903.482) (-905.928) [-902.286] * (-902.120) (-906.192) (-906.401) [-902.505] -- 0:00:46
268500 -- (-904.263) (-904.189) (-903.162) [-902.863] * (-904.396) (-904.555) (-906.403) [-902.740] -- 0:00:46
269000 -- (-908.187) (-902.125) [-904.406] (-906.682) * (-906.460) (-907.558) [-902.836] (-901.817) -- 0:00:46
269500 -- [-902.332] (-901.580) (-905.324) (-906.015) * (-903.037) (-904.465) (-907.302) [-902.095] -- 0:00:46
270000 -- (-903.969) (-903.841) (-902.500) [-904.860] * (-906.099) (-905.760) [-911.532] (-907.748) -- 0:00:45
Average standard deviation of split frequencies: 0.009579
270500 -- (-909.609) (-904.743) (-905.610) [-904.887] * (-902.162) [-904.869] (-909.000) (-907.904) -- 0:00:45
271000 -- (-902.356) (-902.383) [-903.074] (-902.596) * (-902.918) [-903.692] (-906.574) (-904.635) -- 0:00:45
271500 -- (-901.681) (-902.538) (-904.739) [-902.700] * [-902.405] (-906.908) (-905.195) (-902.711) -- 0:00:45
272000 -- (-903.892) (-903.291) [-902.961] (-902.271) * (-903.518) (-902.221) (-902.835) [-902.102] -- 0:00:45
272500 -- [-904.418] (-906.897) (-903.307) (-903.964) * (-904.179) (-902.623) [-902.543] (-903.429) -- 0:00:45
273000 -- (-907.837) (-903.275) [-904.014] (-903.241) * (-903.444) (-903.026) [-902.455] (-903.274) -- 0:00:45
273500 -- (-903.363) (-903.509) [-902.404] (-907.975) * [-906.249] (-902.541) (-908.715) (-903.625) -- 0:00:45
274000 -- (-902.599) (-902.580) (-904.993) [-903.198] * (-904.083) [-905.081] (-907.588) (-903.146) -- 0:00:45
274500 -- (-902.422) (-904.283) (-904.554) [-904.202] * [-904.014] (-903.608) (-905.186) (-909.019) -- 0:00:44
275000 -- (-903.785) (-903.622) [-904.523] (-908.686) * [-903.304] (-902.639) (-903.855) (-901.680) -- 0:00:44
Average standard deviation of split frequencies: 0.009204
275500 -- (-910.267) (-907.921) (-903.658) [-902.301] * (-902.345) (-906.147) (-903.868) [-902.062] -- 0:00:44
276000 -- [-903.591] (-910.986) (-904.580) (-903.983) * (-902.375) (-902.626) (-903.275) [-904.910] -- 0:00:44
276500 -- [-901.533] (-907.988) (-904.733) (-902.178) * (-902.693) (-902.094) (-904.671) [-905.228] -- 0:00:44
277000 -- (-905.102) (-907.307) (-909.848) [-905.724] * [-902.398] (-904.213) (-908.295) (-904.184) -- 0:00:44
277500 -- (-903.093) [-902.940] (-905.323) (-901.931) * (-906.123) (-903.905) [-901.300] (-904.543) -- 0:00:44
278000 -- (-904.201) (-906.927) [-905.195] (-902.420) * [-902.991] (-904.072) (-902.808) (-902.572) -- 0:00:44
278500 -- [-905.204] (-902.562) (-907.087) (-901.918) * [-902.486] (-905.195) (-901.533) (-902.510) -- 0:00:44
279000 -- (-901.987) (-903.691) (-906.235) [-902.190] * [-902.971] (-905.518) (-905.117) (-904.041) -- 0:00:43
279500 -- [-903.749] (-903.270) (-903.793) (-903.184) * [-901.726] (-913.218) (-902.891) (-903.228) -- 0:00:43
280000 -- (-903.520) (-902.177) [-905.431] (-902.124) * [-902.165] (-904.472) (-904.549) (-903.820) -- 0:00:43
Average standard deviation of split frequencies: 0.010357
280500 -- (-904.425) (-905.893) (-904.102) [-903.324] * [-907.240] (-903.556) (-902.617) (-906.534) -- 0:00:43
281000 -- (-902.775) (-909.003) [-905.421] (-903.130) * (-902.403) (-906.085) (-902.511) [-905.977] -- 0:00:46
281500 -- [-901.953] (-908.615) (-904.794) (-903.486) * (-902.213) [-907.086] (-901.348) (-902.631) -- 0:00:45
282000 -- (-904.632) [-902.163] (-902.835) (-903.389) * (-902.364) [-902.120] (-902.439) (-903.430) -- 0:00:45
282500 -- (-902.785) (-904.299) [-902.258] (-906.651) * (-902.552) (-906.532) [-902.012] (-905.184) -- 0:00:45
283000 -- (-901.800) [-903.859] (-902.762) (-908.323) * (-903.835) (-904.015) (-903.453) [-902.864] -- 0:00:45
283500 -- [-901.816] (-905.244) (-901.711) (-902.683) * [-903.728] (-904.187) (-903.239) (-905.266) -- 0:00:45
284000 -- [-904.374] (-904.041) (-903.296) (-902.955) * (-901.771) [-903.036] (-905.341) (-903.467) -- 0:00:45
284500 -- (-902.335) (-908.121) [-903.614] (-903.853) * (-901.544) (-903.144) [-902.485] (-901.840) -- 0:00:45
285000 -- (-902.473) (-905.105) (-903.115) [-905.045] * (-902.743) (-904.656) (-902.191) [-902.193] -- 0:00:45
Average standard deviation of split frequencies: 0.009890
285500 -- (-903.271) (-909.208) (-903.338) [-904.151] * (-903.877) (-904.705) (-910.503) [-902.978] -- 0:00:45
286000 -- [-905.477] (-904.684) (-904.416) (-904.705) * (-903.120) [-902.875] (-902.445) (-903.459) -- 0:00:44
286500 -- (-904.912) (-907.179) [-904.851] (-903.246) * (-909.286) [-903.725] (-906.476) (-902.034) -- 0:00:44
287000 -- (-905.287) (-906.760) [-903.710] (-904.689) * [-902.029] (-903.524) (-905.618) (-901.362) -- 0:00:44
287500 -- (-906.349) [-904.712] (-903.273) (-901.667) * [-905.143] (-903.436) (-902.869) (-902.817) -- 0:00:44
288000 -- (-904.783) (-902.589) (-902.696) [-902.684] * (-906.996) [-903.106] (-902.353) (-905.312) -- 0:00:44
288500 -- (-908.735) (-901.941) [-903.356] (-903.723) * (-902.442) (-904.176) [-903.864] (-902.113) -- 0:00:44
289000 -- (-903.505) (-902.042) (-906.084) [-903.069] * (-902.383) [-901.859] (-901.480) (-905.215) -- 0:00:44
289500 -- [-902.730] (-901.967) (-904.088) (-902.306) * (-904.530) (-902.281) (-902.517) [-907.153] -- 0:00:44
290000 -- (-901.410) (-904.630) [-904.309] (-904.572) * (-902.805) [-902.096] (-903.045) (-908.519) -- 0:00:44
Average standard deviation of split frequencies: 0.010812
290500 -- (-904.641) (-905.068) [-902.459] (-904.029) * (-903.242) [-902.192] (-904.894) (-908.039) -- 0:00:43
291000 -- (-902.086) [-902.804] (-902.459) (-904.153) * (-902.447) (-901.767) [-906.019] (-909.191) -- 0:00:43
291500 -- (-902.969) (-907.504) [-902.121] (-905.477) * [-901.656] (-902.235) (-906.099) (-905.388) -- 0:00:43
292000 -- (-902.913) (-911.014) (-902.460) [-902.640] * (-901.785) [-903.966] (-903.930) (-905.187) -- 0:00:43
292500 -- (-905.448) (-902.565) (-901.696) [-907.324] * (-904.594) (-902.346) (-903.182) [-904.207] -- 0:00:43
293000 -- (-910.871) [-905.091] (-901.696) (-905.519) * (-903.538) (-903.618) [-901.991] (-902.476) -- 0:00:43
293500 -- (-904.979) [-902.056] (-905.070) (-902.737) * (-904.025) (-902.641) (-905.473) [-902.537] -- 0:00:43
294000 -- (-909.768) (-902.295) (-907.073) [-904.464] * [-902.916] (-903.285) (-905.661) (-903.082) -- 0:00:43
294500 -- (-902.583) (-903.308) (-908.870) [-903.448] * (-905.746) [-904.024] (-906.806) (-906.142) -- 0:00:43
295000 -- [-902.400] (-902.971) (-902.476) (-904.410) * (-903.260) (-902.858) (-902.127) [-903.006] -- 0:00:43
Average standard deviation of split frequencies: 0.011237
295500 -- [-901.937] (-905.170) (-902.973) (-904.994) * (-904.516) [-903.245] (-902.528) (-903.360) -- 0:00:42
296000 -- (-905.029) (-907.276) (-903.032) [-903.220] * (-903.013) [-901.912] (-903.463) (-903.655) -- 0:00:42
296500 -- [-904.215] (-904.487) (-905.037) (-902.902) * (-903.044) (-907.320) [-904.738] (-907.577) -- 0:00:42
297000 -- [-903.751] (-904.989) (-906.940) (-907.207) * [-904.724] (-903.660) (-905.291) (-904.479) -- 0:00:44
297500 -- (-902.133) (-902.719) [-903.864] (-904.836) * (-911.906) [-901.647] (-903.635) (-904.063) -- 0:00:44
298000 -- [-903.706] (-903.220) (-903.829) (-905.366) * [-903.070] (-903.229) (-902.344) (-906.189) -- 0:00:44
298500 -- [-901.656] (-905.345) (-902.717) (-903.763) * (-903.515) (-903.261) [-903.644] (-904.372) -- 0:00:44
299000 -- [-903.186] (-904.527) (-904.181) (-902.241) * [-903.739] (-903.241) (-902.815) (-906.656) -- 0:00:44
299500 -- (-902.294) (-904.594) (-903.921) [-903.455] * (-905.414) [-903.809] (-902.089) (-903.125) -- 0:00:44
300000 -- (-905.774) [-902.667] (-904.042) (-906.114) * (-905.964) (-907.064) (-902.448) [-902.955] -- 0:00:44
Average standard deviation of split frequencies: 0.010191
300500 -- (-905.055) (-904.262) (-904.656) [-901.936] * [-902.787] (-905.513) (-901.482) (-904.510) -- 0:00:44
301000 -- (-903.185) [-904.724] (-903.627) (-903.468) * [-904.705] (-908.505) (-902.313) (-903.384) -- 0:00:44
301500 -- (-902.174) (-905.167) (-902.481) [-902.555] * (-902.761) (-904.549) [-901.882] (-904.523) -- 0:00:44
302000 -- (-903.203) [-908.107] (-904.289) (-906.716) * (-907.270) (-904.454) [-903.083] (-903.311) -- 0:00:43
302500 -- (-903.695) (-908.447) [-903.421] (-905.210) * (-913.831) (-903.738) (-903.140) [-906.207] -- 0:00:43
303000 -- (-902.636) (-905.302) (-902.724) [-904.023] * (-909.726) (-901.791) [-906.300] (-905.889) -- 0:00:43
303500 -- (-905.559) (-904.762) [-903.201] (-908.419) * (-904.441) [-901.905] (-905.845) (-904.260) -- 0:00:43
304000 -- (-902.380) (-903.481) [-901.887] (-902.360) * [-901.935] (-901.710) (-904.600) (-903.404) -- 0:00:43
304500 -- (-903.309) (-901.931) (-901.794) [-901.974] * (-905.005) [-904.877] (-906.049) (-905.058) -- 0:00:43
305000 -- (-902.318) (-904.271) (-902.056) [-902.224] * (-903.616) (-902.915) [-901.511] (-905.058) -- 0:00:43
Average standard deviation of split frequencies: 0.010185
305500 -- (-902.060) (-904.191) (-905.502) [-901.778] * (-902.460) (-903.032) [-903.163] (-905.075) -- 0:00:43
306000 -- (-905.425) (-903.557) (-903.420) [-901.823] * [-902.432] (-902.154) (-904.269) (-906.710) -- 0:00:43
306500 -- (-904.360) (-902.997) (-904.269) [-903.273] * (-904.857) (-904.839) (-904.269) [-905.391] -- 0:00:42
307000 -- (-906.767) (-906.430) [-902.012] (-907.614) * (-910.634) [-903.568] (-904.316) (-903.104) -- 0:00:42
307500 -- (-902.768) (-903.711) [-903.496] (-902.539) * (-905.495) (-903.801) (-903.133) [-911.074] -- 0:00:42
308000 -- (-903.894) (-905.759) [-903.730] (-906.837) * (-903.241) [-903.206] (-902.387) (-907.052) -- 0:00:42
308500 -- (-905.506) (-904.088) [-903.168] (-905.074) * (-901.528) (-904.740) (-903.819) [-903.316] -- 0:00:42
309000 -- (-907.406) (-902.971) [-904.516] (-903.766) * [-904.724] (-904.159) (-907.403) (-901.857) -- 0:00:42
309500 -- (-911.654) (-903.876) [-903.629] (-909.602) * (-902.075) (-903.154) [-903.137] (-904.055) -- 0:00:42
310000 -- (-906.777) (-904.674) (-905.936) [-901.969] * (-901.813) [-902.836] (-905.422) (-904.603) -- 0:00:42
Average standard deviation of split frequencies: 0.010622
310500 -- (-909.203) [-903.757] (-908.158) (-904.084) * (-903.306) (-902.285) [-903.959] (-904.228) -- 0:00:42
311000 -- (-906.938) (-904.275) (-902.489) [-903.531] * (-901.752) (-902.069) (-904.182) [-904.094] -- 0:00:42
311500 -- [-907.969] (-903.778) (-903.988) (-902.735) * (-902.525) [-905.647] (-905.273) (-905.998) -- 0:00:41
312000 -- (-905.736) [-904.242] (-904.416) (-904.163) * [-902.616] (-905.341) (-907.266) (-902.131) -- 0:00:41
312500 -- [-903.461] (-906.533) (-903.334) (-903.167) * (-903.792) [-904.368] (-907.196) (-902.076) -- 0:00:41
313000 -- [-903.276] (-906.470) (-905.758) (-902.713) * (-905.715) (-903.988) [-904.434] (-905.207) -- 0:00:41
313500 -- (-902.972) (-905.558) [-903.932] (-902.186) * (-903.120) (-904.090) (-905.321) [-903.859] -- 0:00:43
314000 -- (-904.734) (-906.334) (-903.566) [-903.278] * (-905.742) (-902.723) (-903.591) [-903.399] -- 0:00:43
314500 -- (-903.672) (-904.573) (-903.747) [-905.191] * (-903.353) [-902.161] (-902.017) (-903.357) -- 0:00:43
315000 -- (-908.385) [-903.257] (-903.900) (-902.882) * (-901.985) (-908.549) [-902.134] (-902.091) -- 0:00:43
Average standard deviation of split frequencies: 0.011271
315500 -- [-905.107] (-903.282) (-903.614) (-904.858) * (-902.539) (-907.326) (-902.302) [-903.228] -- 0:00:43
316000 -- [-902.037] (-901.539) (-902.938) (-903.819) * [-902.346] (-903.135) (-904.527) (-904.585) -- 0:00:43
316500 -- [-901.725] (-902.862) (-902.191) (-901.973) * (-904.860) (-901.946) [-901.750] (-904.182) -- 0:00:43
317000 -- [-903.161] (-904.288) (-902.005) (-902.294) * (-904.262) (-901.496) [-902.756] (-903.644) -- 0:00:43
317500 -- (-903.009) (-904.283) [-902.010] (-903.570) * [-903.355] (-903.337) (-901.922) (-906.229) -- 0:00:42
318000 -- [-902.757] (-901.930) (-905.061) (-903.246) * [-904.238] (-902.864) (-903.363) (-904.132) -- 0:00:42
318500 -- (-903.644) (-904.447) (-905.562) [-903.994] * [-903.998] (-903.260) (-902.720) (-903.798) -- 0:00:42
319000 -- [-902.410] (-902.485) (-907.546) (-903.506) * [-902.689] (-901.795) (-904.580) (-903.871) -- 0:00:42
319500 -- (-906.041) [-902.449] (-903.992) (-901.984) * (-904.293) [-902.519] (-902.631) (-902.393) -- 0:00:42
320000 -- (-905.283) (-902.823) (-904.654) [-901.843] * (-905.092) (-905.143) (-903.712) [-902.230] -- 0:00:42
Average standard deviation of split frequencies: 0.012087
320500 -- (-903.102) [-903.275] (-906.010) (-901.891) * (-905.383) [-903.745] (-905.561) (-902.230) -- 0:00:42
321000 -- (-902.344) [-902.216] (-906.099) (-902.890) * (-902.847) (-902.534) [-902.838] (-903.246) -- 0:00:42
321500 -- (-905.149) (-903.818) [-903.448] (-905.253) * (-902.740) (-904.529) (-907.878) [-904.235] -- 0:00:42
322000 -- (-907.237) (-901.482) [-902.807] (-902.197) * (-903.201) (-902.351) [-905.615] (-905.853) -- 0:00:42
322500 -- (-904.987) [-904.203] (-902.248) (-903.327) * (-902.319) (-903.235) (-903.344) [-905.764] -- 0:00:42
323000 -- [-903.396] (-904.372) (-902.212) (-908.430) * (-908.171) [-903.158] (-906.888) (-902.497) -- 0:00:41
323500 -- [-902.048] (-904.027) (-902.567) (-905.547) * (-906.510) (-901.469) (-903.503) [-903.121] -- 0:00:41
324000 -- [-901.871] (-901.822) (-908.336) (-904.436) * (-906.771) (-903.767) [-903.258] (-902.980) -- 0:00:41
324500 -- [-905.512] (-907.293) (-907.069) (-903.192) * (-901.874) (-905.063) (-902.125) [-905.045] -- 0:00:41
325000 -- [-902.873] (-903.368) (-905.278) (-903.114) * (-901.919) (-902.164) [-902.454] (-905.232) -- 0:00:41
Average standard deviation of split frequencies: 0.013577
325500 -- (-902.557) (-905.450) [-904.381] (-906.221) * (-901.913) [-903.778] (-904.600) (-908.340) -- 0:00:41
326000 -- (-903.635) (-910.031) (-903.602) [-904.820] * [-903.221] (-903.940) (-903.496) (-903.518) -- 0:00:41
326500 -- (-905.560) (-904.367) [-905.573] (-901.844) * [-902.673] (-903.135) (-904.401) (-902.476) -- 0:00:41
327000 -- (-906.794) (-905.791) (-903.816) [-903.713] * (-903.971) (-905.957) (-905.793) [-907.560] -- 0:00:41
327500 -- (-903.635) [-904.622] (-906.145) (-905.142) * (-907.164) (-902.422) (-902.141) [-903.233] -- 0:00:41
328000 -- [-903.581] (-906.037) (-905.004) (-904.515) * [-907.549] (-902.063) (-905.316) (-903.581) -- 0:00:40
328500 -- [-903.332] (-905.937) (-903.320) (-906.005) * [-908.104] (-904.749) (-904.614) (-903.018) -- 0:00:40
329000 -- (-903.063) (-906.566) (-904.385) [-902.535] * [-903.317] (-903.087) (-903.023) (-902.324) -- 0:00:40
329500 -- (-902.776) (-905.347) [-905.555] (-903.796) * (-904.994) (-903.350) (-904.007) [-902.267] -- 0:00:40
330000 -- (-903.430) [-903.069] (-904.234) (-906.039) * (-903.305) [-902.737] (-904.428) (-904.533) -- 0:00:42
Average standard deviation of split frequencies: 0.012118
330500 -- (-903.598) (-902.299) (-905.043) [-907.389] * (-903.559) [-903.513] (-902.294) (-904.038) -- 0:00:42
331000 -- (-905.094) [-906.486] (-905.632) (-904.007) * (-903.393) [-903.741] (-903.697) (-904.290) -- 0:00:42
331500 -- (-909.300) (-904.779) (-908.003) [-903.237] * [-901.953] (-904.846) (-902.019) (-903.372) -- 0:00:42
332000 -- (-902.303) (-902.132) (-908.063) [-904.648] * (-906.473) (-901.379) [-903.199] (-902.124) -- 0:00:42
332500 -- (-902.806) (-901.892) (-905.321) [-906.246] * (-902.472) (-901.391) [-903.984] (-903.289) -- 0:00:42
333000 -- (-902.305) (-904.231) [-903.353] (-905.190) * [-903.042] (-904.070) (-905.164) (-902.258) -- 0:00:42
333500 -- (-910.984) (-904.282) [-902.872] (-904.409) * (-901.518) [-902.766] (-902.697) (-902.050) -- 0:00:41
334000 -- (-902.605) [-903.556] (-904.209) (-906.531) * (-905.259) (-901.420) [-904.369] (-903.176) -- 0:00:41
334500 -- (-907.129) (-903.933) (-903.742) [-905.701] * [-901.590] (-901.386) (-902.919) (-902.911) -- 0:00:41
335000 -- (-904.353) (-902.922) (-903.686) [-904.665] * [-902.206] (-904.388) (-905.016) (-907.581) -- 0:00:41
Average standard deviation of split frequencies: 0.011536
335500 -- (-908.529) (-902.337) [-903.893] (-901.230) * (-902.820) (-902.713) [-902.552] (-906.928) -- 0:00:41
336000 -- (-904.631) [-904.580] (-903.262) (-901.219) * (-902.932) (-906.228) [-901.861] (-904.545) -- 0:00:41
336500 -- [-903.870] (-906.268) (-906.094) (-903.620) * (-903.033) [-904.601] (-905.654) (-901.489) -- 0:00:41
337000 -- (-905.035) [-903.798] (-902.819) (-904.971) * (-902.421) (-906.535) (-903.160) [-903.079] -- 0:00:41
337500 -- (-905.822) [-902.942] (-904.961) (-905.991) * (-901.520) (-903.551) [-905.371] (-903.549) -- 0:00:41
338000 -- (-903.735) [-904.801] (-905.046) (-904.661) * (-902.444) [-901.763] (-903.721) (-903.792) -- 0:00:41
338500 -- [-903.563] (-903.745) (-901.736) (-905.562) * (-904.027) (-902.122) [-903.965] (-903.455) -- 0:00:41
339000 -- (-903.718) (-902.863) (-906.737) [-904.301] * (-903.756) (-904.810) [-904.036] (-903.731) -- 0:00:40
339500 -- (-901.857) [-902.276] (-904.137) (-912.153) * (-904.455) (-903.333) [-905.936] (-902.360) -- 0:00:40
340000 -- [-905.595] (-904.256) (-903.062) (-905.409) * [-902.594] (-903.963) (-902.364) (-903.466) -- 0:00:40
Average standard deviation of split frequencies: 0.012454
340500 -- (-901.362) (-905.524) (-907.023) [-903.721] * (-902.300) [-902.766] (-909.021) (-902.676) -- 0:00:40
341000 -- [-903.576] (-904.390) (-902.132) (-903.992) * (-905.474) (-905.198) [-903.542] (-904.042) -- 0:00:40
341500 -- (-901.855) [-902.760] (-902.399) (-903.702) * (-905.619) (-903.637) [-902.777] (-906.704) -- 0:00:40
342000 -- (-903.493) (-903.420) [-904.774] (-903.811) * [-903.084] (-902.387) (-903.638) (-906.273) -- 0:00:40
342500 -- (-902.314) (-904.620) (-903.168) [-902.841] * (-903.226) [-903.069] (-906.107) (-904.177) -- 0:00:40
343000 -- [-902.584] (-904.722) (-902.765) (-902.334) * [-903.839] (-904.422) (-905.227) (-903.210) -- 0:00:40
343500 -- (-904.934) (-902.977) [-902.891] (-902.663) * (-901.655) (-904.796) [-902.133] (-903.734) -- 0:00:40
344000 -- (-904.744) (-902.291) (-902.330) [-902.760] * (-901.818) [-909.678] (-902.396) (-906.417) -- 0:00:40
344500 -- (-903.726) (-906.359) [-902.296] (-902.725) * (-903.325) [-904.265] (-906.802) (-902.932) -- 0:00:39
345000 -- (-903.699) (-908.901) (-903.840) [-906.177] * (-904.869) (-901.454) (-905.539) [-906.611] -- 0:00:41
Average standard deviation of split frequencies: 0.011505
345500 -- (-904.803) (-904.240) [-902.414] (-902.489) * (-903.753) (-907.888) [-906.261] (-903.466) -- 0:00:41
346000 -- (-904.860) (-908.227) [-904.409] (-903.424) * (-903.417) (-910.028) (-905.530) [-903.367] -- 0:00:41
346500 -- (-906.803) (-903.699) (-905.224) [-904.418] * (-902.574) (-906.424) (-903.370) [-903.033] -- 0:00:41
347000 -- [-905.851] (-909.736) (-905.202) (-902.831) * (-904.332) (-903.729) (-905.550) [-903.527] -- 0:00:41
347500 -- (-903.969) (-901.844) [-903.245] (-902.497) * (-902.670) (-902.905) [-902.040] (-903.025) -- 0:00:41
348000 -- (-906.175) (-901.835) (-904.679) [-901.894] * (-907.789) [-904.531] (-901.982) (-907.446) -- 0:00:41
348500 -- (-908.811) (-902.036) [-902.471] (-903.580) * [-902.411] (-903.661) (-903.154) (-904.587) -- 0:00:41
349000 -- (-904.968) [-901.676] (-910.070) (-905.035) * (-902.234) (-905.565) [-902.694] (-903.078) -- 0:00:41
349500 -- [-903.268] (-904.216) (-906.229) (-909.873) * [-904.780] (-905.712) (-901.565) (-903.929) -- 0:00:40
350000 -- (-902.585) (-905.698) (-911.382) [-905.103] * (-905.750) (-902.648) [-902.481] (-904.157) -- 0:00:40
Average standard deviation of split frequencies: 0.012920
350500 -- [-904.490] (-905.474) (-908.781) (-905.020) * (-906.267) (-903.920) (-903.041) [-904.358] -- 0:00:40
351000 -- (-902.516) (-905.627) [-902.509] (-902.281) * (-906.327) (-903.830) (-904.534) [-904.735] -- 0:00:40
351500 -- (-902.280) (-903.998) (-903.110) [-904.934] * (-902.217) (-906.706) (-905.929) [-907.757] -- 0:00:40
352000 -- (-904.122) [-906.388] (-902.954) (-905.851) * (-903.178) (-903.640) [-905.136] (-902.828) -- 0:00:40
352500 -- [-903.580] (-905.811) (-903.028) (-906.486) * (-902.737) [-902.494] (-904.126) (-905.012) -- 0:00:40
353000 -- (-902.173) [-902.394] (-901.967) (-908.442) * (-902.474) (-902.823) [-904.161] (-902.156) -- 0:00:40
353500 -- (-903.408) [-902.930] (-906.465) (-903.896) * (-902.929) (-904.008) (-901.765) [-906.047] -- 0:00:40
354000 -- (-906.215) (-903.343) (-906.862) [-903.752] * (-903.849) (-904.204) (-903.570) [-902.569] -- 0:00:40
354500 -- [-903.387] (-904.387) (-904.482) (-901.707) * (-906.741) [-901.802] (-902.350) (-903.280) -- 0:00:40
355000 -- [-906.460] (-904.558) (-903.066) (-904.033) * (-903.711) [-902.091] (-901.672) (-902.084) -- 0:00:39
Average standard deviation of split frequencies: 0.013904
355500 -- (-903.427) (-903.121) [-902.086] (-904.229) * (-902.611) (-901.383) [-902.539] (-902.383) -- 0:00:39
356000 -- (-904.056) (-906.003) [-904.981] (-909.160) * (-904.341) (-903.506) (-902.763) [-903.593] -- 0:00:39
356500 -- [-903.354] (-905.007) (-901.744) (-906.035) * (-906.011) [-902.254] (-902.059) (-904.139) -- 0:00:39
357000 -- (-903.250) (-902.820) [-903.246] (-905.727) * (-909.904) [-903.722] (-904.557) (-903.520) -- 0:00:39
357500 -- (-903.657) (-905.728) [-901.797] (-904.574) * (-903.882) (-903.463) (-905.041) [-906.027] -- 0:00:39
358000 -- (-902.632) [-904.131] (-901.930) (-902.513) * (-906.939) [-901.907] (-906.125) (-906.519) -- 0:00:39
358500 -- (-902.835) (-906.208) [-901.216] (-903.458) * (-906.095) [-904.277] (-904.101) (-902.955) -- 0:00:41
359000 -- (-904.415) (-904.302) (-902.150) [-902.255] * (-903.779) (-903.189) (-904.443) [-903.728] -- 0:00:41
359500 -- (-904.917) (-906.143) (-904.512) [-901.799] * [-904.735] (-904.229) (-906.370) (-904.063) -- 0:00:40
360000 -- [-902.751] (-907.686) (-907.226) (-902.815) * [-903.150] (-903.880) (-908.692) (-903.666) -- 0:00:40
Average standard deviation of split frequencies: 0.013916
360500 -- (-905.743) [-904.151] (-903.655) (-903.676) * (-908.430) (-905.747) [-902.306] (-903.779) -- 0:00:40
361000 -- (-903.824) (-904.016) (-906.908) [-902.290] * (-903.334) (-903.649) [-903.738] (-906.379) -- 0:00:40
361500 -- (-903.552) (-904.155) (-907.808) [-904.697] * (-904.370) [-903.029] (-903.084) (-902.443) -- 0:00:40
362000 -- [-903.119] (-905.419) (-905.120) (-903.584) * [-903.967] (-904.289) (-903.986) (-902.852) -- 0:00:40
362500 -- [-902.562] (-904.234) (-902.518) (-906.077) * (-903.204) [-902.565] (-908.347) (-904.398) -- 0:00:40
363000 -- (-903.089) [-902.363] (-902.792) (-905.414) * [-903.932] (-903.437) (-903.302) (-901.709) -- 0:00:40
363500 -- (-902.348) (-904.827) [-902.822] (-909.247) * (-903.942) (-905.185) (-902.467) [-901.461] -- 0:00:40
364000 -- (-902.240) (-904.544) [-904.389] (-904.908) * (-904.431) (-903.929) [-902.188] (-902.153) -- 0:00:40
364500 -- (-905.335) [-903.571] (-912.767) (-903.324) * (-902.532) (-903.907) (-902.183) [-902.282] -- 0:00:40
365000 -- (-902.125) (-902.891) [-905.582] (-902.742) * (-904.295) (-905.216) (-903.550) [-901.763] -- 0:00:40
Average standard deviation of split frequencies: 0.013941
365500 -- (-903.943) (-903.230) (-904.102) [-902.201] * [-904.550] (-903.486) (-907.439) (-902.020) -- 0:00:39
366000 -- (-902.348) (-902.887) [-904.700] (-902.226) * [-903.386] (-901.243) (-905.513) (-902.741) -- 0:00:39
366500 -- [-902.978] (-902.218) (-903.164) (-901.962) * (-904.185) [-902.724] (-903.703) (-903.049) -- 0:00:39
367000 -- (-905.428) (-902.168) (-904.503) [-902.340] * (-905.882) (-903.075) (-903.400) [-901.678] -- 0:00:39
367500 -- (-903.680) [-902.069] (-906.448) (-902.195) * [-907.927] (-902.680) (-905.097) (-902.850) -- 0:00:39
368000 -- [-903.849] (-902.429) (-903.945) (-903.511) * (-905.117) [-905.621] (-905.002) (-902.850) -- 0:00:39
368500 -- (-905.229) (-903.658) [-904.687] (-905.054) * (-903.439) (-902.922) [-901.675] (-905.113) -- 0:00:39
369000 -- (-907.461) (-903.660) [-905.419] (-907.461) * [-902.166] (-903.521) (-902.073) (-902.195) -- 0:00:39
369500 -- (-905.996) [-902.731] (-906.062) (-902.832) * (-902.292) [-902.208] (-906.205) (-906.344) -- 0:00:39
370000 -- (-903.939) [-901.650] (-911.276) (-902.856) * (-904.380) [-905.927] (-903.387) (-904.778) -- 0:00:39
Average standard deviation of split frequencies: 0.013840
370500 -- (-903.568) (-902.387) [-905.861] (-902.548) * [-903.700] (-903.311) (-906.206) (-908.515) -- 0:00:39
371000 -- (-907.012) [-903.676] (-908.248) (-905.315) * (-905.329) (-903.756) (-903.673) [-903.679] -- 0:00:38
371500 -- [-903.244] (-904.320) (-905.084) (-903.410) * (-906.621) (-903.764) [-907.299] (-903.660) -- 0:00:38
372000 -- (-903.852) [-905.342] (-906.118) (-905.136) * [-902.366] (-903.908) (-905.275) (-902.692) -- 0:00:38
372500 -- (-903.750) (-904.121) [-901.585] (-904.073) * (-904.217) (-903.306) (-901.449) [-902.359] -- 0:00:38
373000 -- [-903.915] (-907.402) (-902.153) (-903.849) * (-905.022) [-903.099] (-903.308) (-902.760) -- 0:00:38
373500 -- (-904.457) [-902.264] (-903.774) (-904.252) * (-904.572) [-901.996] (-903.819) (-903.315) -- 0:00:40
374000 -- (-903.934) [-903.799] (-903.645) (-905.625) * (-906.415) (-903.693) [-902.021] (-903.621) -- 0:00:40
374500 -- [-902.971] (-904.726) (-903.386) (-904.613) * (-906.251) [-904.298] (-902.998) (-904.163) -- 0:00:40
375000 -- (-902.582) (-903.385) [-903.229] (-903.805) * (-903.949) (-902.089) [-907.424] (-902.461) -- 0:00:40
Average standard deviation of split frequencies: 0.013349
375500 -- [-902.288] (-905.362) (-902.669) (-903.151) * [-902.629] (-904.440) (-902.721) (-904.876) -- 0:00:39
376000 -- (-902.457) (-903.412) [-902.627] (-907.259) * (-904.531) [-904.198] (-903.227) (-905.450) -- 0:00:39
376500 -- (-901.627) (-905.528) (-903.895) [-905.256] * (-902.816) (-904.963) [-903.335] (-909.387) -- 0:00:39
377000 -- (-902.669) [-905.248] (-905.539) (-906.654) * [-903.948] (-904.056) (-904.402) (-904.385) -- 0:00:39
377500 -- (-902.096) (-906.229) (-902.931) [-903.782] * (-909.198) [-904.115] (-909.325) (-902.149) -- 0:00:39
378000 -- (-903.682) (-905.406) (-903.700) [-902.370] * (-905.091) (-906.508) (-905.677) [-902.906] -- 0:00:39
378500 -- [-904.294] (-901.837) (-903.559) (-901.752) * (-907.947) (-901.510) (-902.378) [-902.674] -- 0:00:39
379000 -- (-903.577) (-901.692) [-909.709] (-904.148) * (-905.772) [-902.095] (-904.426) (-901.977) -- 0:00:39
379500 -- [-904.173] (-901.875) (-905.897) (-904.607) * (-904.940) (-904.233) (-907.385) [-902.806] -- 0:00:39
380000 -- (-903.121) (-903.270) [-905.053] (-902.090) * (-904.046) [-906.181] (-907.271) (-902.555) -- 0:00:39
Average standard deviation of split frequencies: 0.014205
380500 -- (-904.110) [-903.463] (-902.851) (-909.970) * [-901.810] (-912.799) (-903.225) (-905.064) -- 0:00:39
381000 -- (-905.044) (-902.208) [-902.130] (-905.981) * (-902.534) (-905.890) (-906.211) [-904.748] -- 0:00:38
381500 -- (-903.239) (-902.830) (-904.420) [-903.810] * [-902.071] (-902.145) (-903.067) (-904.176) -- 0:00:38
382000 -- (-904.030) [-903.078] (-905.344) (-904.860) * (-908.230) [-901.940] (-906.408) (-903.708) -- 0:00:38
382500 -- (-904.837) (-903.817) [-903.320] (-901.262) * (-906.207) (-902.148) (-904.838) [-902.807] -- 0:00:38
383000 -- [-902.425] (-902.959) (-903.652) (-901.556) * (-905.078) (-903.063) [-903.204] (-905.400) -- 0:00:38
383500 -- [-903.033] (-902.302) (-903.771) (-903.709) * (-903.662) (-908.645) [-905.611] (-903.484) -- 0:00:38
384000 -- (-903.723) [-904.394] (-903.685) (-904.010) * (-902.449) (-902.720) (-904.248) [-904.837] -- 0:00:38
384500 -- (-904.336) (-906.909) [-903.758] (-906.084) * (-902.925) (-903.793) [-902.892] (-902.092) -- 0:00:38
385000 -- (-905.249) (-906.103) (-902.721) [-906.690] * (-903.672) (-904.283) [-902.750] (-903.624) -- 0:00:38
Average standard deviation of split frequencies: 0.014368
385500 -- [-901.670] (-903.970) (-905.126) (-903.979) * (-902.771) (-902.785) [-902.035] (-903.804) -- 0:00:38
386000 -- (-903.026) [-904.007] (-902.854) (-901.545) * (-904.113) [-903.377] (-903.744) (-902.642) -- 0:00:38
386500 -- (-903.319) (-905.677) [-903.016] (-902.423) * [-902.577] (-905.097) (-906.482) (-902.639) -- 0:00:38
387000 -- (-905.829) (-904.187) (-905.075) [-902.489] * (-902.652) [-903.655] (-905.423) (-902.745) -- 0:00:38
387500 -- (-904.159) (-904.191) [-905.625] (-902.316) * (-902.643) (-902.831) [-902.407] (-905.012) -- 0:00:37
388000 -- [-905.068] (-902.779) (-903.999) (-903.466) * [-901.479] (-903.386) (-902.407) (-902.890) -- 0:00:37
388500 -- (-904.217) [-904.430] (-902.857) (-903.939) * (-901.420) (-905.529) [-902.923] (-903.141) -- 0:00:37
389000 -- [-904.323] (-904.283) (-909.349) (-903.838) * [-901.881] (-903.167) (-903.677) (-907.616) -- 0:00:37
389500 -- [-902.964] (-903.355) (-901.549) (-907.209) * (-906.996) (-906.040) (-902.889) [-903.034] -- 0:00:39
390000 -- (-902.723) (-903.417) (-905.037) [-907.698] * (-906.082) (-906.384) (-902.357) [-904.966] -- 0:00:39
Average standard deviation of split frequencies: 0.013841
390500 -- [-902.225] (-904.312) (-905.408) (-905.337) * (-909.225) (-904.668) [-904.042] (-903.700) -- 0:00:39
391000 -- [-904.501] (-905.157) (-903.008) (-905.214) * (-903.584) [-904.080] (-904.262) (-905.872) -- 0:00:38
391500 -- (-905.947) (-902.272) [-903.272] (-906.181) * (-902.780) [-903.113] (-902.305) (-904.593) -- 0:00:38
392000 -- (-902.240) [-901.885] (-902.798) (-904.281) * [-902.577] (-903.618) (-903.360) (-904.663) -- 0:00:38
392500 -- (-903.083) [-902.805] (-901.869) (-907.555) * (-903.279) (-903.789) [-905.022] (-904.017) -- 0:00:38
393000 -- [-902.777] (-902.147) (-901.895) (-907.220) * [-902.629] (-902.484) (-905.028) (-905.457) -- 0:00:38
393500 -- (-902.002) (-902.430) (-902.632) [-904.291] * (-903.361) (-902.008) [-903.941] (-904.445) -- 0:00:38
394000 -- (-904.031) [-902.195] (-901.638) (-904.898) * (-904.634) [-903.223] (-901.827) (-904.926) -- 0:00:38
394500 -- (-905.038) (-909.134) (-909.657) [-903.071] * (-907.562) (-903.483) (-907.369) [-902.948] -- 0:00:38
395000 -- (-902.565) (-907.075) (-906.777) [-903.186] * (-908.587) [-903.010] (-903.372) (-904.189) -- 0:00:38
Average standard deviation of split frequencies: 0.012744
395500 -- [-903.880] (-910.060) (-906.985) (-906.228) * [-905.371] (-902.322) (-910.253) (-905.459) -- 0:00:38
396000 -- (-903.200) (-907.652) (-901.898) [-905.728] * (-906.048) (-902.830) [-912.487] (-904.519) -- 0:00:38
396500 -- (-905.681) (-904.832) [-905.261] (-904.460) * (-901.938) [-903.503] (-904.634) (-902.629) -- 0:00:38
397000 -- (-904.989) (-902.564) (-905.678) [-908.090] * (-902.481) [-904.742] (-903.960) (-902.628) -- 0:00:37
397500 -- (-905.730) (-902.005) (-902.282) [-906.378] * (-904.501) [-902.976] (-903.008) (-905.215) -- 0:00:37
398000 -- (-901.945) (-903.554) (-903.837) [-902.004] * (-902.708) [-903.086] (-902.659) (-902.149) -- 0:00:37
398500 -- (-903.840) (-905.457) [-904.678] (-903.760) * (-902.002) (-902.512) (-905.800) [-903.014] -- 0:00:37
399000 -- [-901.787] (-910.194) (-911.220) (-903.790) * (-902.484) (-902.823) [-906.090] (-904.678) -- 0:00:37
399500 -- [-903.023] (-905.334) (-904.841) (-901.474) * [-903.039] (-902.992) (-904.851) (-906.450) -- 0:00:37
400000 -- [-901.683] (-903.341) (-905.714) (-902.345) * (-901.615) (-902.994) (-903.285) [-905.441] -- 0:00:37
Average standard deviation of split frequencies: 0.012734
400500 -- (-901.456) (-902.515) [-903.338] (-904.929) * (-901.511) [-902.124] (-903.868) (-901.845) -- 0:00:37
401000 -- (-905.204) [-903.143] (-903.380) (-905.216) * (-904.429) [-906.171] (-903.253) (-903.084) -- 0:00:37
401500 -- (-905.103) (-901.525) (-907.072) [-901.766] * (-904.082) (-909.463) (-904.483) [-902.308] -- 0:00:37
402000 -- (-908.845) (-902.340) (-905.331) [-904.728] * (-902.626) (-907.555) [-903.115] (-907.008) -- 0:00:37
402500 -- [-906.693] (-904.393) (-902.956) (-910.699) * (-903.222) (-905.210) [-901.358] (-903.499) -- 0:00:37
403000 -- (-909.830) (-909.043) [-902.306] (-904.278) * (-902.995) (-906.197) (-903.894) [-902.769] -- 0:00:37
403500 -- (-903.355) (-903.477) (-902.960) [-906.083] * (-905.091) (-904.745) [-902.826] (-904.613) -- 0:00:36
404000 -- (-903.653) (-902.744) [-902.240] (-901.748) * (-905.477) (-905.491) (-903.694) [-903.361] -- 0:00:36
404500 -- (-902.684) (-902.996) (-905.328) [-905.904] * [-907.031] (-907.940) (-904.051) (-903.774) -- 0:00:36
405000 -- (-902.839) [-901.853] (-904.483) (-906.432) * (-902.444) [-901.640] (-903.548) (-903.629) -- 0:00:36
Average standard deviation of split frequencies: 0.013592
405500 -- [-904.630] (-906.631) (-901.789) (-905.247) * [-903.256] (-906.733) (-905.900) (-903.196) -- 0:00:38
406000 -- (-902.884) (-902.194) (-902.546) [-904.527] * (-902.481) (-908.113) [-903.905] (-902.914) -- 0:00:38
406500 -- (-902.034) [-908.121] (-902.087) (-904.262) * [-902.800] (-902.661) (-909.094) (-901.701) -- 0:00:37
407000 -- (-905.207) (-904.351) [-902.174] (-902.497) * [-901.663] (-902.935) (-907.753) (-906.029) -- 0:00:37
407500 -- (-904.550) (-903.037) (-902.083) [-902.766] * (-902.577) [-905.295] (-904.801) (-903.285) -- 0:00:37
408000 -- [-903.291] (-904.596) (-902.085) (-906.111) * (-904.077) (-904.002) [-903.111] (-903.105) -- 0:00:37
408500 -- (-901.795) (-906.052) [-902.057] (-908.687) * (-902.624) [-901.588] (-902.698) (-903.596) -- 0:00:37
409000 -- [-901.960] (-906.478) (-901.447) (-902.252) * (-906.169) (-902.468) [-901.901] (-903.821) -- 0:00:37
409500 -- [-902.389] (-903.509) (-901.501) (-902.406) * (-902.724) (-901.905) [-904.434] (-907.153) -- 0:00:37
410000 -- [-903.173] (-902.419) (-902.875) (-902.863) * (-903.666) [-901.770] (-902.563) (-906.395) -- 0:00:37
Average standard deviation of split frequencies: 0.013707
410500 -- (-902.669) (-902.058) [-903.993] (-903.533) * (-901.857) [-902.809] (-902.707) (-904.080) -- 0:00:37
411000 -- (-903.015) (-904.234) [-904.804] (-902.834) * (-902.119) (-908.436) (-903.007) [-904.255] -- 0:00:37
411500 -- (-903.754) (-904.517) (-904.193) [-906.286] * (-904.896) (-903.948) [-902.189] (-910.588) -- 0:00:37
412000 -- (-903.843) (-905.450) (-906.433) [-903.464] * (-905.355) [-902.314] (-904.485) (-901.544) -- 0:00:37
412500 -- (-901.823) (-907.257) (-905.041) [-902.907] * [-901.478] (-905.960) (-902.404) (-901.794) -- 0:00:37
413000 -- (-901.964) (-904.359) (-902.953) [-904.480] * [-901.638] (-902.574) (-903.373) (-902.085) -- 0:00:36
413500 -- (-901.966) (-902.186) [-907.094] (-903.658) * (-901.992) (-902.466) [-902.484] (-903.530) -- 0:00:36
414000 -- [-902.349] (-903.913) (-912.540) (-902.929) * (-902.935) (-903.107) [-902.554] (-904.393) -- 0:00:36
414500 -- (-903.760) [-904.656] (-904.074) (-901.560) * [-902.987] (-903.393) (-904.221) (-902.593) -- 0:00:36
415000 -- [-903.514] (-902.969) (-905.268) (-901.616) * [-903.643] (-903.903) (-902.264) (-902.226) -- 0:00:36
Average standard deviation of split frequencies: 0.013532
415500 -- (-902.017) (-905.766) (-910.728) [-902.064] * [-901.844] (-904.844) (-902.459) (-903.335) -- 0:00:36
416000 -- (-902.255) (-904.478) (-902.635) [-903.044] * (-902.607) (-901.520) [-902.714] (-903.698) -- 0:00:36
416500 -- [-902.851] (-903.046) (-907.330) (-907.953) * [-903.312] (-903.096) (-902.643) (-903.554) -- 0:00:36
417000 -- [-902.650] (-905.629) (-904.436) (-903.969) * (-904.729) (-905.565) [-903.717] (-906.924) -- 0:00:36
417500 -- (-903.312) (-908.039) (-904.018) [-903.463] * (-903.706) (-904.206) (-902.918) [-903.488] -- 0:00:36
418000 -- [-904.074] (-902.540) (-904.619) (-904.332) * (-902.511) [-904.400] (-902.641) (-907.132) -- 0:00:36
418500 -- (-902.323) [-901.997] (-902.114) (-903.877) * [-902.925] (-904.191) (-906.331) (-905.811) -- 0:00:36
419000 -- (-906.120) (-906.931) [-901.499] (-903.975) * (-905.560) (-903.501) (-902.849) [-903.157] -- 0:00:36
419500 -- (-905.282) [-903.980] (-902.281) (-903.934) * (-903.420) (-903.282) (-902.685) [-904.928] -- 0:00:35
420000 -- (-902.679) [-903.350] (-901.400) (-904.758) * (-904.806) [-904.245] (-902.106) (-904.800) -- 0:00:35
Average standard deviation of split frequencies: 0.013250
420500 -- (-902.240) (-902.761) (-904.221) [-902.882] * (-905.691) (-903.103) (-902.483) [-903.859] -- 0:00:35
421000 -- (-901.759) [-903.529] (-904.146) (-902.406) * (-903.981) [-902.950] (-904.564) (-907.194) -- 0:00:35
421500 -- (-903.443) [-902.810] (-902.018) (-902.861) * (-904.612) [-903.606] (-904.501) (-911.943) -- 0:00:35
422000 -- (-903.204) (-902.718) [-905.293] (-905.386) * [-901.801] (-905.165) (-903.368) (-902.087) -- 0:00:36
422500 -- [-903.813] (-902.494) (-902.158) (-903.000) * (-903.771) [-902.238] (-903.125) (-902.342) -- 0:00:36
423000 -- (-901.754) (-904.676) [-902.481] (-902.332) * (-904.594) (-904.726) [-901.661] (-903.711) -- 0:00:36
423500 -- (-901.311) (-908.180) (-903.110) [-904.847] * (-902.913) (-902.056) [-902.858] (-902.383) -- 0:00:36
424000 -- [-902.307] (-905.107) (-901.859) (-905.305) * (-902.646) (-901.771) [-904.328] (-902.135) -- 0:00:36
424500 -- (-905.753) (-902.916) [-901.855] (-904.304) * (-906.946) (-905.651) [-905.301] (-903.275) -- 0:00:36
425000 -- (-908.680) (-907.082) [-901.799] (-909.225) * [-903.560] (-906.191) (-909.795) (-902.294) -- 0:00:36
Average standard deviation of split frequencies: 0.013402
425500 -- (-904.780) (-906.194) [-906.046] (-910.333) * [-903.620] (-902.730) (-906.123) (-902.785) -- 0:00:36
426000 -- [-903.817] (-906.595) (-902.327) (-902.780) * (-908.767) (-902.050) (-903.224) [-902.951] -- 0:00:36
426500 -- [-902.127] (-904.131) (-909.652) (-903.571) * (-908.390) (-904.759) [-903.275] (-908.126) -- 0:00:36
427000 -- (-902.191) [-903.915] (-909.252) (-904.093) * (-902.821) [-903.186] (-902.098) (-904.563) -- 0:00:36
427500 -- (-904.738) (-902.112) [-903.987] (-903.195) * (-903.781) (-902.998) (-902.608) [-903.642] -- 0:00:36
428000 -- (-903.942) (-904.612) [-904.167] (-902.778) * (-904.424) (-902.991) [-901.194] (-903.664) -- 0:00:36
428500 -- (-902.672) (-905.072) (-903.278) [-902.173] * (-908.876) (-905.130) [-903.236] (-903.520) -- 0:00:36
429000 -- (-903.646) [-907.018] (-906.119) (-902.174) * (-906.490) (-907.948) [-902.260] (-902.672) -- 0:00:35
429500 -- (-903.809) (-905.346) [-902.510] (-903.139) * (-903.621) [-903.562] (-905.067) (-905.839) -- 0:00:35
430000 -- [-903.906] (-905.274) (-903.709) (-904.261) * (-905.291) (-906.911) [-901.463] (-904.689) -- 0:00:35
Average standard deviation of split frequencies: 0.013013
430500 -- (-903.244) (-903.682) [-902.478] (-903.335) * [-905.034] (-901.610) (-906.756) (-903.892) -- 0:00:35
431000 -- (-905.873) (-904.591) (-904.051) [-905.315] * (-908.465) (-902.469) (-902.666) [-904.179] -- 0:00:35
431500 -- (-909.121) [-902.903] (-909.075) (-903.600) * (-910.660) (-902.955) [-904.084] (-903.047) -- 0:00:35
432000 -- [-906.832] (-904.170) (-904.129) (-905.175) * [-907.226] (-904.644) (-902.179) (-903.752) -- 0:00:35
432500 -- (-903.184) (-904.937) (-909.505) [-902.530] * [-908.322] (-902.367) (-903.220) (-903.079) -- 0:00:35
433000 -- (-902.284) [-901.412] (-901.926) (-902.136) * [-905.094] (-901.790) (-902.276) (-902.967) -- 0:00:35
433500 -- (-904.742) [-902.267] (-904.241) (-901.426) * (-903.434) (-901.523) [-904.315] (-902.942) -- 0:00:35
434000 -- (-902.265) (-907.457) [-902.368] (-903.950) * [-903.004] (-908.770) (-902.814) (-903.479) -- 0:00:35
434500 -- (-902.202) (-902.946) [-903.780] (-907.418) * (-903.736) (-903.521) (-905.003) [-901.569] -- 0:00:35
435000 -- (-902.406) [-904.574] (-904.185) (-905.201) * (-903.484) (-901.619) [-902.456] (-904.978) -- 0:00:35
Average standard deviation of split frequencies: 0.012338
435500 -- (-902.574) (-908.373) [-903.786] (-903.229) * (-902.246) (-903.133) [-904.292] (-905.212) -- 0:00:34
436000 -- [-903.226] (-902.045) (-907.645) (-903.710) * (-903.519) (-908.894) (-906.208) [-904.704] -- 0:00:34
436500 -- [-905.642] (-904.322) (-903.861) (-911.687) * [-902.749] (-905.502) (-910.117) (-904.390) -- 0:00:34
437000 -- [-901.649] (-906.171) (-904.313) (-904.580) * (-903.700) (-901.930) [-902.416] (-905.652) -- 0:00:34
437500 -- (-908.523) (-903.157) [-904.833] (-903.302) * [-904.347] (-905.043) (-901.572) (-909.025) -- 0:00:34
438000 -- (-906.916) [-902.056] (-902.559) (-903.211) * (-904.810) (-904.420) (-902.806) [-903.247] -- 0:00:34
438500 -- (-904.490) [-904.003] (-902.782) (-901.819) * (-903.001) (-903.769) [-902.637] (-903.913) -- 0:00:35
439000 -- [-904.036] (-904.355) (-906.644) (-902.735) * (-903.570) (-903.775) [-901.464] (-902.466) -- 0:00:35
439500 -- (-901.722) (-904.512) (-906.528) [-905.810] * [-903.068] (-903.408) (-902.685) (-902.008) -- 0:00:35
440000 -- [-904.455] (-903.638) (-908.219) (-904.178) * (-901.718) [-902.396] (-902.155) (-902.845) -- 0:00:35
Average standard deviation of split frequencies: 0.013253
440500 -- (-903.172) (-904.551) (-903.180) [-904.235] * (-902.203) (-902.882) [-901.979] (-901.986) -- 0:00:35
441000 -- (-904.547) (-907.762) [-905.236] (-906.272) * (-903.962) [-904.378] (-904.755) (-903.447) -- 0:00:35
441500 -- (-908.769) [-904.540] (-903.941) (-903.857) * (-904.888) (-903.241) [-902.510] (-904.580) -- 0:00:35
442000 -- [-905.826] (-903.833) (-904.550) (-903.142) * (-902.364) (-904.429) (-902.182) [-904.494] -- 0:00:35
442500 -- (-904.837) (-902.433) (-908.048) [-903.126] * [-902.951] (-904.410) (-905.226) (-905.943) -- 0:00:35
443000 -- (-904.837) [-902.222] (-903.396) (-904.487) * (-902.814) (-902.750) [-904.649] (-902.557) -- 0:00:35
443500 -- (-902.563) (-902.758) [-902.372] (-901.486) * (-903.892) [-902.523] (-906.304) (-905.710) -- 0:00:35
444000 -- (-901.666) (-902.898) (-906.638) [-901.983] * (-906.585) (-902.857) [-904.036] (-906.160) -- 0:00:35
444500 -- (-903.740) (-904.348) (-902.701) [-902.421] * (-903.159) [-904.425] (-904.189) (-903.150) -- 0:00:34
445000 -- [-903.423] (-906.719) (-904.076) (-904.805) * [-903.833] (-902.804) (-905.641) (-902.539) -- 0:00:34
Average standard deviation of split frequencies: 0.013799
445500 -- (-903.922) (-903.034) (-903.737) [-902.426] * [-902.723] (-905.819) (-902.662) (-902.790) -- 0:00:34
446000 -- (-902.510) [-902.136] (-902.821) (-902.044) * (-901.684) (-901.991) [-903.002] (-904.407) -- 0:00:34
446500 -- (-903.123) (-903.206) (-912.431) [-902.826] * (-903.720) (-904.237) [-901.957] (-903.120) -- 0:00:34
447000 -- (-904.079) [-902.226] (-906.213) (-906.249) * (-903.761) (-903.605) [-903.666] (-904.711) -- 0:00:34
447500 -- [-904.983] (-905.277) (-904.460) (-903.326) * (-902.733) (-902.913) [-902.328] (-906.511) -- 0:00:34
448000 -- (-903.395) (-908.997) (-905.661) [-902.734] * [-903.860] (-905.322) (-902.677) (-903.429) -- 0:00:34
448500 -- (-902.992) (-902.183) (-903.776) [-902.971] * [-902.939] (-903.144) (-901.763) (-903.552) -- 0:00:34
449000 -- (-905.923) (-903.445) [-904.418] (-902.228) * (-902.413) (-902.695) [-904.016] (-906.097) -- 0:00:34
449500 -- (-906.439) (-902.813) (-904.081) [-904.171] * (-902.629) [-904.610] (-902.858) (-902.291) -- 0:00:34
450000 -- [-901.794] (-903.251) (-905.835) (-905.780) * (-902.604) (-904.829) [-905.578] (-902.615) -- 0:00:34
Average standard deviation of split frequencies: 0.013308
450500 -- (-903.284) (-904.096) [-902.768] (-908.434) * [-902.906] (-903.681) (-905.447) (-902.537) -- 0:00:34
451000 -- [-903.671] (-903.080) (-904.537) (-901.862) * (-904.016) (-902.215) [-902.936] (-902.609) -- 0:00:34
451500 -- (-906.908) [-904.030] (-904.246) (-903.739) * (-904.527) (-903.935) (-903.848) [-903.339] -- 0:00:34
452000 -- (-902.919) [-904.922] (-903.700) (-903.791) * [-905.174] (-904.534) (-901.731) (-903.652) -- 0:00:33
452500 -- (-901.695) [-905.795] (-902.935) (-910.001) * (-906.547) (-905.978) (-901.510) [-902.760] -- 0:00:33
453000 -- (-902.448) (-907.076) (-906.484) [-903.822] * (-903.824) (-902.678) [-903.643] (-903.546) -- 0:00:33
453500 -- (-903.452) (-910.151) (-903.117) [-905.969] * [-906.656] (-903.408) (-904.434) (-901.654) -- 0:00:33
454000 -- (-902.438) (-903.781) [-902.487] (-903.412) * (-902.792) (-904.447) (-902.658) [-904.041] -- 0:00:33
454500 -- (-902.388) (-902.173) (-903.487) [-905.636] * [-902.137] (-904.625) (-902.739) (-907.819) -- 0:00:33
455000 -- (-903.233) (-907.511) [-904.710] (-907.762) * [-904.602] (-903.367) (-903.371) (-902.665) -- 0:00:34
Average standard deviation of split frequencies: 0.012635
455500 -- (-903.183) [-901.652] (-905.043) (-903.782) * [-902.779] (-903.557) (-905.895) (-903.844) -- 0:00:34
456000 -- (-902.545) [-902.928] (-905.855) (-902.729) * (-906.075) [-901.737] (-903.936) (-901.925) -- 0:00:34
456500 -- (-906.206) (-903.020) (-909.525) [-905.762] * (-902.760) (-903.836) (-906.348) [-901.640] -- 0:00:34
457000 -- [-901.795] (-909.663) (-904.746) (-903.527) * [-903.452] (-903.052) (-902.693) (-902.238) -- 0:00:34
457500 -- (-904.038) [-905.568] (-902.006) (-901.748) * (-902.938) [-902.336] (-901.915) (-902.238) -- 0:00:34
458000 -- [-903.807] (-902.820) (-902.006) (-903.319) * (-907.343) (-904.861) (-905.385) [-901.974] -- 0:00:34
458500 -- (-908.425) [-904.729] (-902.644) (-901.735) * (-904.719) [-903.481] (-905.850) (-902.189) -- 0:00:34
459000 -- (-902.906) (-903.923) (-902.856) [-901.765] * [-904.084] (-903.598) (-904.542) (-906.500) -- 0:00:34
459500 -- (-902.040) (-905.316) (-903.752) [-902.596] * (-906.373) [-901.522] (-903.816) (-903.214) -- 0:00:34
460000 -- (-905.396) (-907.459) [-903.881] (-904.055) * (-902.954) (-902.047) (-906.068) [-902.319] -- 0:00:34
Average standard deviation of split frequencies: 0.012340
460500 -- (-903.874) (-905.139) [-902.507] (-901.874) * (-904.352) [-904.318] (-901.450) (-905.115) -- 0:00:33
461000 -- [-904.300] (-904.042) (-902.184) (-904.530) * (-902.503) [-903.792] (-905.627) (-903.761) -- 0:00:33
461500 -- [-901.814] (-903.782) (-904.701) (-904.441) * (-903.668) (-902.851) [-904.190] (-903.208) -- 0:00:33
462000 -- [-903.759] (-904.842) (-913.316) (-904.444) * [-902.585] (-903.802) (-903.801) (-905.160) -- 0:00:33
462500 -- (-903.708) (-901.666) (-906.624) [-903.559] * (-902.436) (-902.463) [-903.549] (-902.127) -- 0:00:33
463000 -- (-903.242) (-902.281) [-904.199] (-903.405) * (-904.303) (-906.738) (-908.233) [-905.185] -- 0:00:33
463500 -- (-904.517) [-903.766] (-903.487) (-911.619) * (-905.213) (-902.328) (-906.954) [-904.069] -- 0:00:33
464000 -- (-904.170) [-905.034] (-902.811) (-909.119) * (-903.013) (-904.180) (-906.670) [-904.675] -- 0:00:33
464500 -- [-906.748] (-905.112) (-901.769) (-902.446) * (-904.699) (-905.571) [-903.350] (-903.046) -- 0:00:33
465000 -- (-905.565) [-903.151] (-902.652) (-901.725) * (-902.874) (-904.510) [-907.695] (-904.698) -- 0:00:33
Average standard deviation of split frequencies: 0.011842
465500 -- (-906.160) (-906.460) (-902.189) [-901.913] * (-903.576) (-903.329) [-904.215] (-907.009) -- 0:00:33
466000 -- (-903.375) [-904.104] (-902.675) (-904.342) * (-904.207) [-903.714] (-911.743) (-905.943) -- 0:00:33
466500 -- (-904.192) (-902.465) (-902.273) [-905.688] * (-904.627) [-905.944] (-906.407) (-908.762) -- 0:00:33
467000 -- (-905.665) (-906.424) (-901.522) [-902.650] * (-902.853) (-902.632) (-904.227) [-905.613] -- 0:00:33
467500 -- (-909.289) [-903.133] (-905.153) (-903.356) * (-903.404) (-904.126) (-906.395) [-904.254] -- 0:00:33
468000 -- (-904.044) [-903.734] (-905.159) (-904.870) * (-902.262) [-902.792] (-908.897) (-904.371) -- 0:00:32
468500 -- (-903.833) [-903.641] (-906.265) (-902.335) * [-901.955] (-902.206) (-906.782) (-903.939) -- 0:00:32
469000 -- (-903.476) [-905.331] (-906.036) (-904.844) * (-902.288) (-907.241) [-903.822] (-904.496) -- 0:00:32
469500 -- (-904.960) (-908.482) [-908.598] (-903.922) * (-904.600) (-908.362) [-902.289] (-909.297) -- 0:00:32
470000 -- (-903.505) (-906.780) (-910.608) [-903.902] * (-905.238) [-903.889] (-902.155) (-904.938) -- 0:00:32
Average standard deviation of split frequencies: 0.012431
470500 -- (-903.022) [-901.450] (-904.169) (-903.510) * [-906.861] (-907.101) (-903.731) (-908.258) -- 0:00:32
471000 -- (-902.079) (-902.591) [-903.101] (-902.313) * (-902.092) (-905.802) (-904.475) [-902.815] -- 0:00:33
471500 -- [-902.253] (-905.886) (-902.349) (-903.678) * [-901.956] (-906.194) (-903.196) (-906.072) -- 0:00:33
472000 -- [-901.399] (-902.829) (-903.128) (-903.511) * (-907.344) [-904.417] (-902.270) (-902.628) -- 0:00:33
472500 -- (-902.955) (-906.147) (-903.473) [-903.207] * (-901.820) (-905.776) (-901.732) [-901.963] -- 0:00:33
473000 -- [-904.805] (-905.680) (-905.910) (-901.738) * (-902.279) (-904.385) [-904.517] (-904.561) -- 0:00:33
473500 -- (-902.285) (-903.437) [-902.259] (-902.446) * (-903.650) (-904.133) (-902.720) [-903.718] -- 0:00:33
474000 -- (-902.755) (-906.878) (-901.712) [-902.823] * [-903.683] (-903.243) (-903.702) (-903.803) -- 0:00:33
474500 -- (-903.930) [-905.449] (-902.120) (-908.915) * (-902.864) (-903.665) [-904.057] (-908.566) -- 0:00:33
475000 -- (-902.349) [-908.226] (-901.767) (-904.432) * (-902.667) (-908.418) (-903.792) [-907.808] -- 0:00:33
Average standard deviation of split frequencies: 0.012104
475500 -- (-906.557) (-904.808) (-905.852) [-902.141] * (-902.041) (-903.211) (-904.161) [-905.275] -- 0:00:33
476000 -- [-905.603] (-904.527) (-902.937) (-904.574) * [-904.600] (-903.907) (-904.521) (-904.014) -- 0:00:33
476500 -- (-904.800) (-906.696) (-902.333) [-907.616] * (-902.879) [-901.858] (-904.139) (-902.352) -- 0:00:32
477000 -- [-906.389] (-908.168) (-902.857) (-905.597) * (-907.196) (-902.679) [-902.601] (-902.981) -- 0:00:32
477500 -- (-905.479) (-902.170) [-903.064] (-902.188) * (-910.502) [-903.452] (-902.412) (-901.574) -- 0:00:32
478000 -- (-903.681) [-905.147] (-902.276) (-902.889) * (-901.455) (-903.238) (-905.662) [-901.607] -- 0:00:32
478500 -- (-904.264) [-901.720] (-904.198) (-901.715) * (-907.704) (-903.892) (-905.999) [-903.292] -- 0:00:32
479000 -- (-903.545) (-902.738) [-902.296] (-903.056) * (-902.641) (-904.371) [-903.400] (-902.107) -- 0:00:32
479500 -- [-903.076] (-904.061) (-904.239) (-902.158) * (-906.586) (-902.170) [-905.708] (-905.448) -- 0:00:32
480000 -- [-903.814] (-904.382) (-905.272) (-907.075) * [-903.370] (-901.737) (-905.462) (-906.459) -- 0:00:32
Average standard deviation of split frequencies: 0.012858
480500 -- (-904.979) [-902.782] (-903.879) (-902.836) * (-903.420) (-904.449) [-902.172] (-904.388) -- 0:00:32
481000 -- [-902.289] (-903.336) (-902.142) (-902.432) * (-901.563) [-903.472] (-902.150) (-903.579) -- 0:00:32
481500 -- (-904.910) [-902.610] (-902.098) (-906.050) * (-902.335) (-905.051) (-905.203) [-904.291] -- 0:00:32
482000 -- [-904.274] (-901.496) (-901.908) (-904.007) * (-902.099) (-903.725) [-902.599] (-903.612) -- 0:00:32
482500 -- [-905.963] (-904.767) (-905.022) (-904.734) * (-903.271) [-902.782] (-903.618) (-902.298) -- 0:00:32
483000 -- (-905.982) (-903.815) [-902.628] (-902.571) * (-905.997) [-903.508] (-908.458) (-903.555) -- 0:00:32
483500 -- (-905.071) (-904.686) (-901.732) [-903.761] * [-903.861] (-902.149) (-909.223) (-903.832) -- 0:00:32
484000 -- (-903.345) (-904.032) [-903.286] (-902.326) * [-902.183] (-908.310) (-903.284) (-902.428) -- 0:00:31
484500 -- (-903.440) (-903.203) (-903.766) [-902.750] * (-903.211) (-902.771) [-902.576] (-902.706) -- 0:00:31
485000 -- (-902.788) (-905.721) (-904.353) [-903.082] * (-902.643) (-903.236) [-901.764] (-902.429) -- 0:00:31
Average standard deviation of split frequencies: 0.013148
485500 -- (-907.787) (-903.238) [-902.314] (-901.585) * [-903.755] (-904.627) (-907.622) (-902.393) -- 0:00:31
486000 -- [-904.632] (-904.187) (-903.879) (-902.021) * (-906.589) (-906.111) (-906.432) [-902.059] -- 0:00:31
486500 -- [-902.426] (-902.346) (-902.506) (-902.259) * (-901.577) (-904.846) (-906.045) [-902.540] -- 0:00:31
487000 -- (-904.020) (-902.822) [-903.381] (-903.663) * (-902.460) (-907.017) (-906.591) [-905.116] -- 0:00:31
487500 -- (-901.917) (-903.187) (-903.215) [-903.509] * (-903.432) [-902.341] (-908.590) (-905.254) -- 0:00:32
488000 -- (-903.920) (-905.231) (-901.967) [-902.761] * [-903.305] (-904.137) (-902.692) (-903.717) -- 0:00:32
488500 -- (-902.649) [-903.805] (-902.054) (-903.970) * (-903.005) (-903.032) (-901.955) [-904.009] -- 0:00:32
489000 -- [-903.162] (-902.497) (-903.755) (-904.929) * [-904.027] (-903.383) (-905.215) (-904.147) -- 0:00:32
489500 -- (-903.580) [-902.785] (-903.534) (-903.810) * [-903.464] (-906.669) (-903.225) (-904.690) -- 0:00:32
490000 -- [-903.902] (-903.168) (-903.146) (-904.189) * (-905.043) (-903.072) [-905.393] (-903.380) -- 0:00:32
Average standard deviation of split frequencies: 0.013344
490500 -- (-903.146) [-901.685] (-902.321) (-904.102) * (-902.360) (-902.291) [-903.889] (-901.698) -- 0:00:32
491000 -- (-903.678) [-901.476] (-903.480) (-903.237) * (-902.476) (-905.726) [-902.780] (-904.280) -- 0:00:32
491500 -- (-903.756) (-902.520) (-905.658) [-902.555] * (-902.764) (-904.506) [-903.898] (-904.335) -- 0:00:32
492000 -- (-903.798) (-909.125) [-902.906] (-902.675) * (-902.070) (-904.187) (-905.016) [-903.863] -- 0:00:32
492500 -- (-903.167) (-901.277) [-903.370] (-903.668) * (-908.024) [-902.701] (-904.526) (-904.504) -- 0:00:31
493000 -- (-901.708) (-902.312) [-907.391] (-905.325) * (-905.439) (-904.147) [-902.964] (-903.428) -- 0:00:31
493500 -- (-903.107) (-908.838) [-903.655] (-908.194) * (-903.821) [-902.432] (-903.541) (-904.117) -- 0:00:31
494000 -- [-901.929] (-903.907) (-903.773) (-907.639) * (-907.844) (-904.179) [-904.941] (-906.021) -- 0:00:31
494500 -- (-903.188) (-905.739) (-905.957) [-902.465] * (-905.022) (-904.936) [-902.195] (-906.412) -- 0:00:31
495000 -- [-903.201] (-903.293) (-903.118) (-902.178) * (-907.464) (-903.659) (-902.237) [-906.585] -- 0:00:31
Average standard deviation of split frequencies: 0.013939
495500 -- (-905.931) [-903.276] (-904.224) (-904.599) * (-904.602) [-904.973] (-902.668) (-904.667) -- 0:00:31
496000 -- (-903.002) (-904.099) (-902.176) [-902.735] * (-909.469) [-902.137] (-902.389) (-906.531) -- 0:00:31
496500 -- [-904.029] (-903.759) (-902.218) (-903.615) * (-904.269) (-907.079) [-902.268] (-903.257) -- 0:00:31
497000 -- (-903.935) [-903.575] (-901.892) (-904.071) * (-906.150) (-906.673) (-904.799) [-902.372] -- 0:00:31
497500 -- (-904.449) (-904.350) (-903.077) [-904.057] * (-903.841) [-904.981] (-904.230) (-902.917) -- 0:00:31
498000 -- [-902.304] (-910.048) (-903.822) (-907.664) * (-903.653) (-905.636) (-902.637) [-904.286] -- 0:00:31
498500 -- (-904.948) (-905.191) (-903.774) [-906.571] * (-902.672) (-903.582) [-902.163] (-902.208) -- 0:00:31
499000 -- (-904.638) (-905.782) [-904.613] (-902.171) * (-903.990) [-901.591] (-902.826) (-902.668) -- 0:00:31
499500 -- (-904.293) [-906.657] (-913.254) (-903.864) * (-904.834) (-905.777) (-905.349) [-902.950] -- 0:00:31
500000 -- (-905.930) [-904.652] (-916.194) (-903.723) * (-907.692) (-903.328) (-902.312) [-903.113] -- 0:00:31
Average standard deviation of split frequencies: 0.013862
500500 -- [-902.827] (-904.078) (-907.305) (-901.894) * [-905.457] (-902.915) (-901.366) (-904.536) -- 0:00:30
501000 -- (-905.096) [-902.771] (-907.325) (-905.097) * (-902.194) (-903.917) [-902.198] (-906.427) -- 0:00:30
501500 -- (-904.453) [-903.390] (-904.276) (-902.431) * (-902.398) (-903.849) (-904.627) [-901.958] -- 0:00:30
502000 -- (-905.282) (-903.250) [-902.057] (-904.713) * (-902.819) (-903.508) [-901.902] (-903.629) -- 0:00:30
502500 -- (-905.739) [-903.250] (-906.091) (-903.056) * (-903.380) [-902.020] (-903.565) (-902.753) -- 0:00:30
503000 -- (-902.862) (-903.324) [-902.879] (-903.328) * (-903.522) [-902.843] (-904.258) (-902.242) -- 0:00:30
503500 -- (-904.286) (-905.885) [-910.578] (-902.986) * (-902.233) (-907.750) [-902.571] (-902.208) -- 0:00:31
504000 -- (-906.417) [-902.619] (-904.438) (-902.584) * (-902.197) (-906.045) (-904.325) [-905.927] -- 0:00:31
504500 -- (-903.180) (-903.025) [-904.211] (-903.693) * (-902.737) [-903.703] (-902.857) (-903.113) -- 0:00:31
505000 -- (-903.853) (-902.897) (-904.217) [-903.073] * (-904.460) (-903.551) (-901.776) [-904.106] -- 0:00:31
Average standard deviation of split frequencies: 0.014751
505500 -- (-910.204) (-903.724) (-905.206) [-905.675] * (-902.334) (-901.690) (-901.848) [-907.274] -- 0:00:31
506000 -- (-902.206) [-902.705] (-906.674) (-902.247) * (-905.501) [-902.920] (-902.020) (-907.103) -- 0:00:31
506500 -- (-908.428) (-902.179) (-904.434) [-904.469] * (-902.455) (-903.248) [-901.843] (-902.176) -- 0:00:31
507000 -- (-902.730) (-902.156) (-913.129) [-902.501] * (-903.628) (-902.864) (-903.514) [-901.733] -- 0:00:31
507500 -- [-903.434] (-906.512) (-905.566) (-902.921) * (-903.784) (-902.572) (-902.968) [-902.067] -- 0:00:31
508000 -- (-903.630) [-903.619] (-902.115) (-904.264) * [-902.392] (-904.025) (-902.968) (-910.158) -- 0:00:30
508500 -- [-907.694] (-908.768) (-905.981) (-907.530) * (-904.976) (-902.935) [-903.206] (-902.732) -- 0:00:30
509000 -- (-902.892) (-903.253) (-904.573) [-904.117] * (-904.605) (-904.363) (-904.739) [-903.690] -- 0:00:30
509500 -- (-904.380) (-902.516) [-902.680] (-904.283) * (-905.225) [-904.769] (-901.954) (-902.333) -- 0:00:30
510000 -- [-903.019] (-907.291) (-902.569) (-901.944) * (-905.644) (-903.142) (-904.039) [-903.845] -- 0:00:30
Average standard deviation of split frequencies: 0.014154
510500 -- (-904.352) (-904.436) (-906.036) [-902.506] * (-906.573) (-904.022) [-903.643] (-903.010) -- 0:00:30
511000 -- (-905.688) (-902.101) [-902.548] (-906.933) * (-908.077) (-902.698) (-902.694) [-902.142] -- 0:00:30
511500 -- [-903.735] (-901.421) (-905.600) (-902.881) * (-905.577) [-903.023] (-902.215) (-902.083) -- 0:00:30
512000 -- (-902.402) [-905.379] (-908.401) (-904.307) * (-902.430) [-903.313] (-902.511) (-902.173) -- 0:00:30
512500 -- (-904.302) (-902.441) [-904.586] (-902.191) * [-902.418] (-904.315) (-902.681) (-901.392) -- 0:00:30
513000 -- (-902.456) (-902.715) [-903.003] (-901.521) * (-903.958) (-905.235) (-901.831) [-902.065] -- 0:00:30
513500 -- (-903.205) (-904.486) (-902.577) [-901.851] * [-905.804] (-909.363) (-907.302) (-902.265) -- 0:00:30
514000 -- [-904.115] (-903.497) (-902.408) (-902.255) * (-903.621) (-902.968) [-907.198] (-903.966) -- 0:00:30
514500 -- (-904.103) (-907.348) (-905.856) [-902.521] * (-903.257) (-902.490) (-904.981) [-902.226] -- 0:00:30
515000 -- (-903.079) (-904.456) (-902.490) [-903.381] * (-905.702) (-902.773) [-903.691] (-904.767) -- 0:00:30
Average standard deviation of split frequencies: 0.013551
515500 -- (-902.859) [-903.948] (-904.360) (-903.406) * (-903.750) (-903.581) (-904.753) [-901.986] -- 0:00:30
516000 -- (-904.695) [-902.215] (-904.099) (-904.719) * [-902.914] (-906.325) (-903.948) (-902.185) -- 0:00:30
516500 -- (-904.368) (-905.348) [-903.979] (-904.177) * (-902.216) (-903.862) [-905.348] (-904.703) -- 0:00:29
517000 -- (-904.121) (-905.207) (-904.846) [-904.872] * (-902.348) (-903.147) [-906.094] (-903.129) -- 0:00:29
517500 -- (-904.465) [-902.733] (-907.574) (-902.191) * (-905.151) [-902.655] (-904.861) (-905.887) -- 0:00:29
518000 -- (-905.088) [-904.448] (-903.886) (-904.218) * [-904.258] (-903.430) (-903.430) (-904.315) -- 0:00:29
518500 -- (-904.234) (-902.127) (-903.069) [-903.900] * (-904.314) [-903.755] (-905.791) (-906.529) -- 0:00:29
519000 -- (-904.031) [-903.392] (-903.900) (-902.107) * (-905.207) (-902.185) (-903.829) [-904.725] -- 0:00:29
519500 -- (-907.241) (-903.931) [-904.231] (-903.362) * (-906.736) (-908.527) [-908.180] (-904.022) -- 0:00:30
520000 -- [-905.418] (-901.941) (-905.374) (-902.377) * (-904.831) [-903.256] (-907.232) (-902.999) -- 0:00:30
Average standard deviation of split frequencies: 0.013732
520500 -- (-902.280) [-904.753] (-903.573) (-904.751) * (-907.059) [-902.982] (-907.917) (-906.331) -- 0:00:30
521000 -- [-903.232] (-905.133) (-902.125) (-902.509) * (-901.541) [-902.654] (-904.214) (-903.653) -- 0:00:30
521500 -- (-901.539) [-902.803] (-903.364) (-903.298) * (-903.026) (-908.211) (-903.421) [-903.398] -- 0:00:30
522000 -- (-903.447) (-903.899) [-904.644] (-902.877) * [-902.697] (-903.229) (-904.090) (-902.476) -- 0:00:30
522500 -- (-904.396) [-903.245] (-902.154) (-902.543) * (-902.404) (-906.521) (-902.992) [-902.189] -- 0:00:30
523000 -- (-905.921) [-904.426] (-902.964) (-905.562) * [-903.364] (-904.098) (-904.923) (-902.851) -- 0:00:30
523500 -- [-903.239] (-901.954) (-905.175) (-904.958) * [-901.459] (-904.183) (-905.799) (-904.221) -- 0:00:30
524000 -- (-903.524) (-901.905) (-904.551) [-904.089] * (-903.863) (-903.036) [-903.331] (-902.741) -- 0:00:29
524500 -- (-904.489) (-903.750) (-906.512) [-903.328] * (-904.282) [-906.805] (-903.770) (-904.599) -- 0:00:29
525000 -- [-903.984] (-906.342) (-903.975) (-903.936) * (-904.769) (-905.786) (-906.002) [-904.791] -- 0:00:29
Average standard deviation of split frequencies: 0.013792
525500 -- (-903.636) (-908.605) (-903.202) [-906.003] * (-902.716) [-902.704] (-905.396) (-904.233) -- 0:00:29
526000 -- (-901.787) (-907.520) (-903.513) [-904.172] * (-901.976) [-902.410] (-902.966) (-903.054) -- 0:00:29
526500 -- (-906.186) [-904.451] (-903.256) (-902.538) * (-903.134) (-903.093) (-903.058) [-903.650] -- 0:00:29
527000 -- [-904.664] (-902.796) (-905.689) (-904.873) * (-906.067) (-910.381) (-903.001) [-903.003] -- 0:00:29
527500 -- (-902.472) [-902.313] (-903.997) (-904.980) * [-902.454] (-902.995) (-904.969) (-907.483) -- 0:00:29
528000 -- (-903.073) [-901.954] (-901.942) (-902.865) * (-902.188) (-903.046) (-904.745) [-904.911] -- 0:00:29
528500 -- [-902.923] (-901.728) (-902.446) (-902.493) * (-903.813) (-904.140) [-903.010] (-908.851) -- 0:00:29
529000 -- [-905.420] (-902.002) (-902.257) (-903.717) * [-902.976] (-903.553) (-902.813) (-904.374) -- 0:00:29
529500 -- (-901.637) [-907.380] (-902.669) (-902.227) * [-902.850] (-904.516) (-904.614) (-904.081) -- 0:00:29
530000 -- [-901.730] (-904.273) (-902.804) (-902.606) * (-904.164) [-907.938] (-903.473) (-904.097) -- 0:00:29
Average standard deviation of split frequencies: 0.013605
530500 -- (-904.516) (-904.826) [-904.519] (-902.860) * (-905.053) [-905.754] (-903.092) (-902.901) -- 0:00:29
531000 -- (-904.860) (-904.357) (-902.058) [-903.179] * (-902.982) (-904.990) (-905.426) [-903.058] -- 0:00:29
531500 -- (-902.283) [-902.225] (-902.215) (-905.726) * (-903.528) [-902.477] (-905.887) (-903.520) -- 0:00:29
532000 -- (-902.883) (-906.001) [-901.931] (-905.715) * (-901.745) (-903.798) (-908.181) [-903.617] -- 0:00:29
532500 -- (-905.457) (-904.946) [-909.528] (-903.531) * (-904.026) [-904.441] (-902.338) (-904.419) -- 0:00:28
533000 -- (-902.651) (-903.137) (-901.980) [-905.054] * (-902.025) (-902.328) [-907.341] (-904.121) -- 0:00:28
533500 -- (-901.499) (-903.329) (-902.913) [-901.622] * [-902.144] (-902.837) (-903.880) (-904.879) -- 0:00:28
534000 -- (-901.581) (-902.283) [-902.125] (-903.369) * (-901.888) (-902.459) [-906.249] (-905.132) -- 0:00:28
534500 -- [-902.595] (-904.147) (-902.036) (-903.473) * (-902.507) (-905.624) (-909.765) [-903.958] -- 0:00:28
535000 -- (-905.135) (-904.122) [-902.490] (-905.492) * (-901.912) (-904.656) [-902.916] (-905.035) -- 0:00:29
Average standard deviation of split frequencies: 0.013655
535500 -- (-904.990) (-903.645) (-902.479) [-903.899] * (-906.057) (-903.390) [-903.148] (-905.856) -- 0:00:29
536000 -- (-905.611) (-908.543) (-902.479) [-902.839] * (-908.392) [-903.219] (-904.301) (-903.398) -- 0:00:29
536500 -- (-901.931) (-905.388) (-904.426) [-905.977] * (-905.563) (-902.643) [-905.430] (-902.548) -- 0:00:29
537000 -- (-903.058) [-902.915] (-904.117) (-904.991) * (-904.387) (-901.832) (-904.690) [-904.446] -- 0:00:29
537500 -- (-902.944) [-905.477] (-902.155) (-902.598) * (-908.852) [-902.331] (-902.655) (-904.358) -- 0:00:29
538000 -- [-901.805] (-907.954) (-903.921) (-903.570) * (-903.788) [-901.535] (-902.936) (-906.122) -- 0:00:29
538500 -- (-903.508) (-902.733) [-903.650] (-906.106) * (-901.326) (-901.891) [-902.165] (-905.385) -- 0:00:29
539000 -- (-902.634) (-904.078) (-903.631) [-903.495] * (-904.327) (-908.449) (-906.472) [-907.754] -- 0:00:29
539500 -- (-905.120) [-903.256] (-901.867) (-904.413) * [-904.161] (-912.998) (-902.897) (-903.741) -- 0:00:29
540000 -- (-902.876) (-905.320) (-902.184) [-906.707] * (-905.536) [-911.991] (-903.695) (-902.271) -- 0:00:28
Average standard deviation of split frequencies: 0.014096
540500 -- (-902.869) [-903.437] (-903.041) (-902.633) * (-905.708) (-901.943) [-904.044] (-902.130) -- 0:00:28
541000 -- (-902.619) (-905.157) (-906.477) [-902.518] * [-901.570] (-902.458) (-904.372) (-905.229) -- 0:00:28
541500 -- (-909.980) (-903.853) [-902.674] (-904.943) * [-901.770] (-902.946) (-904.256) (-904.327) -- 0:00:28
542000 -- [-904.717] (-905.512) (-905.892) (-903.504) * (-902.543) (-903.893) (-907.384) [-905.321] -- 0:00:28
542500 -- (-904.424) (-902.410) (-904.403) [-903.623] * (-902.968) (-906.991) (-903.259) [-902.434] -- 0:00:28
543000 -- (-901.630) [-903.329] (-904.510) (-902.598) * (-905.657) (-909.429) (-901.903) [-903.263] -- 0:00:28
543500 -- (-902.097) [-902.308] (-904.949) (-902.186) * (-902.815) [-904.089] (-906.335) (-902.270) -- 0:00:28
544000 -- (-903.985) (-906.466) (-906.422) [-901.882] * (-902.934) (-904.563) (-903.608) [-903.350] -- 0:00:28
544500 -- (-902.835) (-905.959) (-909.880) [-901.964] * (-908.290) (-903.585) (-902.886) [-901.519] -- 0:00:28
545000 -- (-902.899) (-902.658) [-903.731] (-901.975) * (-904.628) (-905.610) (-901.399) [-901.746] -- 0:00:28
Average standard deviation of split frequencies: 0.013238
545500 -- [-902.269] (-901.707) (-905.052) (-906.326) * (-907.215) (-905.751) [-905.976] (-904.145) -- 0:00:28
546000 -- (-903.586) (-903.062) (-905.094) [-903.720] * [-905.038] (-908.574) (-904.753) (-903.170) -- 0:00:28
546500 -- (-902.098) (-903.427) [-905.442] (-903.707) * (-908.424) [-906.266] (-906.555) (-904.886) -- 0:00:28
547000 -- (-903.317) [-903.518] (-906.474) (-903.666) * (-904.472) [-901.491] (-902.195) (-903.462) -- 0:00:28
547500 -- (-903.765) [-902.486] (-902.331) (-902.254) * (-916.095) [-901.586] (-908.300) (-904.232) -- 0:00:28
548000 -- [-906.431] (-904.123) (-902.258) (-903.378) * (-902.770) [-902.185] (-901.965) (-902.614) -- 0:00:28
548500 -- (-907.783) (-903.818) [-903.196] (-905.378) * [-902.532] (-901.524) (-903.371) (-903.362) -- 0:00:27
549000 -- (-903.688) (-904.190) [-903.505] (-903.936) * (-902.580) [-902.878] (-901.286) (-902.575) -- 0:00:27
549500 -- (-903.819) [-904.527] (-903.307) (-906.241) * (-904.206) [-903.462] (-903.758) (-902.269) -- 0:00:28
550000 -- [-902.710] (-902.431) (-902.834) (-913.513) * [-903.955] (-902.391) (-902.759) (-908.820) -- 0:00:28
Average standard deviation of split frequencies: 0.013364
550500 -- (-904.520) (-903.322) [-906.917] (-904.872) * (-908.463) (-905.055) (-903.770) [-904.018] -- 0:00:28
551000 -- [-902.734] (-905.626) (-904.772) (-902.594) * (-905.798) [-905.723] (-901.986) (-906.441) -- 0:00:28
551500 -- (-901.499) (-903.851) [-903.662] (-902.311) * (-904.058) [-905.580] (-902.376) (-905.787) -- 0:00:28
552000 -- (-902.233) (-907.028) [-902.078] (-902.027) * (-903.279) [-902.873] (-903.682) (-906.307) -- 0:00:28
552500 -- (-908.010) (-909.313) (-902.705) [-903.306] * (-903.155) (-904.858) (-903.333) [-907.435] -- 0:00:28
553000 -- (-905.753) (-902.968) (-903.245) [-903.193] * [-905.177] (-905.383) (-908.049) (-905.951) -- 0:00:28
553500 -- (-903.329) [-903.199] (-901.926) (-903.554) * [-906.875] (-902.599) (-904.624) (-904.325) -- 0:00:28
554000 -- (-902.376) (-904.353) [-902.786] (-903.120) * (-903.373) (-901.829) [-904.145] (-902.494) -- 0:00:28
554500 -- (-901.858) (-905.172) (-901.971) [-902.666] * (-904.904) [-903.493] (-905.115) (-903.340) -- 0:00:28
555000 -- [-903.154] (-906.210) (-903.602) (-903.857) * (-907.722) (-908.432) [-904.601] (-905.855) -- 0:00:28
Average standard deviation of split frequencies: 0.013236
555500 -- (-902.651) (-903.523) [-901.359] (-902.263) * (-902.670) (-911.204) (-906.728) [-903.694] -- 0:00:28
556000 -- (-905.170) (-903.894) [-901.355] (-904.814) * (-902.384) [-905.411] (-904.114) (-903.791) -- 0:00:27
556500 -- (-903.785) [-908.380] (-903.703) (-907.323) * (-904.566) (-902.936) (-903.331) [-902.183] -- 0:00:27
557000 -- [-902.723] (-917.874) (-903.703) (-902.980) * (-904.668) (-904.956) (-902.660) [-901.449] -- 0:00:27
557500 -- [-903.182] (-905.684) (-903.041) (-903.789) * (-905.601) (-901.814) (-906.083) [-904.019] -- 0:00:27
558000 -- (-903.705) [-904.368] (-907.168) (-901.902) * (-902.844) [-902.570] (-904.399) (-906.750) -- 0:00:27
558500 -- [-904.606] (-905.317) (-910.158) (-902.439) * (-905.366) [-901.972] (-906.895) (-906.302) -- 0:00:27
559000 -- (-901.445) [-903.581] (-906.688) (-906.466) * (-905.872) [-902.746] (-906.234) (-905.595) -- 0:00:27
559500 -- (-903.501) (-905.578) (-904.685) [-906.112] * [-904.234] (-904.077) (-905.838) (-902.897) -- 0:00:27
560000 -- [-903.548] (-908.845) (-903.937) (-903.389) * [-904.337] (-906.715) (-901.691) (-902.033) -- 0:00:27
Average standard deviation of split frequencies: 0.013546
560500 -- (-903.977) (-908.172) (-906.526) [-901.857] * (-903.555) (-901.542) [-903.016] (-902.260) -- 0:00:27
561000 -- (-903.772) (-902.325) [-905.675] (-906.477) * (-903.096) (-902.635) (-904.785) [-902.370] -- 0:00:27
561500 -- (-903.454) [-903.597] (-906.284) (-901.661) * (-902.703) [-902.623] (-907.321) (-906.516) -- 0:00:27
562000 -- (-906.253) (-904.462) (-903.445) [-901.705] * (-902.371) (-904.235) (-904.208) [-902.227] -- 0:00:27
562500 -- (-904.864) [-902.305] (-902.610) (-901.926) * (-902.791) [-905.465] (-904.663) (-905.513) -- 0:00:27
563000 -- (-903.523) (-905.453) [-902.377] (-902.774) * (-901.986) (-904.054) (-904.911) [-902.629] -- 0:00:27
563500 -- (-913.594) (-904.905) [-904.592] (-902.150) * (-902.048) (-903.478) [-905.014] (-905.704) -- 0:00:27
564000 -- (-902.639) [-903.846] (-902.458) (-902.811) * (-904.078) (-904.902) [-901.772] (-904.800) -- 0:00:27
564500 -- (-905.175) (-902.317) [-902.471] (-903.453) * (-901.513) (-905.081) (-902.425) [-902.503] -- 0:00:27
565000 -- [-902.615] (-906.675) (-903.443) (-902.563) * (-904.450) [-903.844] (-901.854) (-901.459) -- 0:00:27
Average standard deviation of split frequencies: 0.012678
565500 -- [-904.832] (-901.773) (-906.764) (-903.101) * [-901.834] (-904.540) (-904.665) (-902.908) -- 0:00:27
566000 -- (-903.487) [-902.124] (-907.870) (-901.555) * (-901.805) (-903.314) (-902.334) [-902.890] -- 0:00:27
566500 -- [-903.618] (-903.431) (-904.048) (-903.065) * [-902.914] (-902.818) (-902.505) (-903.065) -- 0:00:27
567000 -- (-907.313) (-903.012) (-902.993) [-904.186] * (-903.776) (-902.825) (-902.455) [-902.608] -- 0:00:27
567500 -- (-905.313) (-902.901) [-904.950] (-908.475) * (-902.832) [-904.135] (-902.311) (-902.971) -- 0:00:27
568000 -- (-904.656) (-907.233) [-904.952] (-903.022) * (-903.802) (-905.086) (-903.694) [-903.429] -- 0:00:27
568500 -- (-904.352) (-901.809) (-901.707) [-903.052] * [-903.522] (-903.730) (-903.932) (-905.060) -- 0:00:27
569000 -- (-907.039) [-902.419] (-902.180) (-903.286) * (-903.263) (-904.710) [-902.261] (-903.257) -- 0:00:27
569500 -- (-908.064) (-906.192) (-903.937) [-904.528] * (-902.655) (-904.980) (-903.857) [-902.469] -- 0:00:27
570000 -- (-910.958) [-903.227] (-902.087) (-905.781) * [-904.341] (-905.663) (-904.421) (-904.613) -- 0:00:27
Average standard deviation of split frequencies: 0.012439
570500 -- (-904.834) [-902.458] (-903.059) (-902.441) * (-902.408) [-904.135] (-903.567) (-904.878) -- 0:00:27
571000 -- (-904.692) (-906.195) [-902.142] (-902.401) * (-901.633) [-904.245] (-907.848) (-906.589) -- 0:00:27
571500 -- (-902.373) [-908.290] (-904.908) (-906.169) * [-903.362] (-901.796) (-905.691) (-904.385) -- 0:00:26
572000 -- (-903.662) [-902.927] (-902.348) (-911.879) * (-902.739) (-903.076) [-903.998] (-904.370) -- 0:00:26
572500 -- [-902.177] (-903.151) (-905.983) (-903.067) * [-903.261] (-903.476) (-903.834) (-901.914) -- 0:00:26
573000 -- (-902.048) (-903.002) (-902.450) [-902.069] * [-903.261] (-902.939) (-903.896) (-902.715) -- 0:00:26
573500 -- [-903.445] (-902.626) (-901.255) (-902.123) * [-902.918] (-902.202) (-903.193) (-911.998) -- 0:00:26
574000 -- (-905.418) (-902.865) (-902.087) [-903.918] * (-906.443) [-906.070] (-904.730) (-902.900) -- 0:00:26
574500 -- (-903.930) (-902.461) [-901.906] (-903.765) * (-903.142) (-905.124) [-902.880] (-901.805) -- 0:00:26
575000 -- (-904.144) (-902.948) (-903.276) [-903.689] * [-902.883] (-905.448) (-902.784) (-904.810) -- 0:00:26
Average standard deviation of split frequencies: 0.012469
575500 -- (-902.989) (-903.087) (-903.090) [-903.157] * (-901.828) (-901.425) (-904.212) [-903.294] -- 0:00:26
576000 -- (-905.349) (-904.522) [-902.384] (-905.015) * (-904.625) (-902.182) [-902.488] (-905.494) -- 0:00:26
576500 -- [-903.513] (-904.478) (-902.939) (-904.443) * (-902.794) (-902.232) [-905.696] (-902.501) -- 0:00:26
577000 -- [-902.093] (-903.763) (-907.284) (-905.764) * [-903.854] (-902.196) (-903.360) (-902.706) -- 0:00:26
577500 -- (-905.049) [-902.625] (-904.145) (-902.338) * (-902.203) [-903.940] (-905.238) (-903.633) -- 0:00:26
578000 -- (-910.564) (-905.620) (-904.284) [-905.453] * (-906.042) [-902.084] (-912.967) (-905.355) -- 0:00:26
578500 -- (-904.192) [-909.610] (-904.450) (-903.547) * (-904.068) (-903.433) (-903.262) [-907.122] -- 0:00:26
579000 -- (-903.766) [-904.554] (-910.458) (-904.783) * (-907.081) [-901.646] (-905.090) (-907.277) -- 0:00:26
579500 -- (-904.359) [-902.687] (-903.861) (-901.626) * (-902.647) (-903.622) [-904.717] (-903.653) -- 0:00:26
580000 -- (-904.628) (-902.152) [-902.897] (-902.114) * [-902.980] (-903.971) (-903.677) (-901.780) -- 0:00:26
Average standard deviation of split frequencies: 0.011700
580500 -- (-903.606) (-902.771) [-904.333] (-901.868) * (-902.110) (-910.136) [-903.427] (-902.681) -- 0:00:26
581000 -- [-904.158] (-902.505) (-903.656) (-901.881) * (-901.917) (-903.152) (-902.412) [-902.701] -- 0:00:26
581500 -- [-904.013] (-901.757) (-902.834) (-904.130) * (-903.352) [-906.751] (-903.855) (-905.458) -- 0:00:26
582000 -- [-904.385] (-904.151) (-905.375) (-901.658) * [-903.199] (-903.911) (-901.696) (-903.693) -- 0:00:26
582500 -- (-903.765) (-904.000) (-904.870) [-902.172] * [-902.307] (-902.749) (-904.820) (-904.439) -- 0:00:26
583000 -- [-903.163] (-904.984) (-903.533) (-903.333) * (-905.785) [-905.015] (-904.325) (-902.398) -- 0:00:26
583500 -- [-903.847] (-906.918) (-902.716) (-904.596) * (-901.936) [-902.304] (-907.067) (-902.636) -- 0:00:26
584000 -- (-904.934) (-903.965) (-903.457) [-902.816] * (-903.043) [-904.164] (-902.148) (-901.449) -- 0:00:26
584500 -- (-901.746) (-903.630) (-901.854) [-904.246] * (-906.515) [-901.956] (-903.723) (-906.847) -- 0:00:26
585000 -- (-902.049) (-904.023) (-902.969) [-903.021] * [-903.223] (-903.818) (-903.676) (-906.627) -- 0:00:26
Average standard deviation of split frequencies: 0.011173
585500 -- (-903.002) (-903.272) (-903.099) [-902.040] * [-904.458] (-903.137) (-902.023) (-901.874) -- 0:00:26
586000 -- (-903.331) (-904.753) [-902.251] (-904.275) * (-902.835) (-903.819) (-904.733) [-903.011] -- 0:00:26
586500 -- [-902.566] (-902.809) (-905.680) (-903.137) * (-904.624) (-904.155) [-903.830] (-902.878) -- 0:00:26
587000 -- (-903.392) (-902.688) [-904.888] (-902.054) * (-903.422) (-904.005) (-908.470) [-902.971] -- 0:00:26
587500 -- (-904.168) (-904.125) (-907.790) [-903.373] * (-902.293) (-903.023) [-904.228] (-903.620) -- 0:00:25
588000 -- [-905.525] (-905.257) (-902.091) (-901.480) * (-905.572) (-903.799) (-903.057) [-903.743] -- 0:00:25
588500 -- [-905.820] (-903.291) (-903.156) (-909.163) * (-902.379) (-902.366) (-905.237) [-902.024] -- 0:00:25
589000 -- [-903.869] (-903.578) (-903.792) (-906.562) * (-903.166) (-902.530) [-905.657] (-901.396) -- 0:00:25
589500 -- (-906.376) (-906.189) (-902.048) [-902.658] * [-906.529] (-903.602) (-901.846) (-901.718) -- 0:00:25
590000 -- (-904.104) (-906.534) (-903.227) [-905.329] * (-904.117) (-904.214) (-902.659) [-903.989] -- 0:00:25
Average standard deviation of split frequencies: 0.011737
590500 -- (-901.480) [-905.093] (-903.960) (-904.397) * [-907.340] (-902.864) (-902.736) (-905.745) -- 0:00:25
591000 -- (-902.853) (-904.840) [-902.733] (-905.902) * (-912.001) (-902.090) [-901.606] (-905.358) -- 0:00:25
591500 -- (-902.833) (-903.013) [-904.050] (-902.927) * [-901.990] (-904.154) (-909.291) (-907.110) -- 0:00:25
592000 -- (-906.291) (-902.798) [-908.267] (-903.916) * (-904.306) [-903.280] (-909.179) (-902.516) -- 0:00:25
592500 -- (-904.099) (-904.637) (-903.737) [-902.837] * [-903.810] (-903.022) (-908.145) (-904.210) -- 0:00:25
593000 -- (-904.700) [-903.746] (-907.330) (-902.377) * (-904.482) (-903.647) (-904.169) [-904.093] -- 0:00:25
593500 -- (-907.652) (-903.747) (-903.411) [-901.695] * (-901.729) (-904.172) (-905.967) [-903.289] -- 0:00:25
594000 -- (-909.329) [-902.733] (-905.892) (-903.613) * (-902.382) [-902.646] (-902.092) (-904.211) -- 0:00:25
594500 -- (-903.641) [-902.959] (-902.485) (-903.680) * (-903.281) (-907.126) [-906.232] (-906.736) -- 0:00:25
595000 -- (-904.535) (-904.080) [-902.734] (-903.168) * (-904.286) (-904.829) (-902.475) [-902.266] -- 0:00:25
Average standard deviation of split frequencies: 0.011492
595500 -- [-901.706] (-904.656) (-902.425) (-904.554) * (-906.123) (-905.294) (-904.457) [-902.511] -- 0:00:25
596000 -- [-904.559] (-903.015) (-903.357) (-904.795) * (-905.630) (-903.208) (-901.724) [-901.807] -- 0:00:25
596500 -- (-903.409) [-909.339] (-902.327) (-906.467) * (-904.632) (-905.609) (-903.203) [-901.784] -- 0:00:25
597000 -- (-905.572) (-902.320) [-903.937] (-906.532) * (-904.862) (-903.734) [-903.674] (-912.142) -- 0:00:25
597500 -- (-902.492) [-903.366] (-902.145) (-904.366) * (-901.502) (-903.642) (-902.649) [-901.842] -- 0:00:25
598000 -- [-903.381] (-902.416) (-906.959) (-903.291) * (-901.470) (-902.049) (-902.843) [-901.766] -- 0:00:25
598500 -- [-902.454] (-902.019) (-905.595) (-902.903) * (-901.827) (-901.745) [-902.586] (-902.135) -- 0:00:25
599000 -- (-903.109) [-903.149] (-902.239) (-902.937) * [-901.942] (-903.960) (-902.810) (-903.573) -- 0:00:25
599500 -- (-902.858) (-906.516) (-905.001) [-904.086] * (-902.252) (-905.851) (-902.068) [-901.833] -- 0:00:25
600000 -- (-902.870) (-904.278) [-902.415] (-902.986) * (-905.613) [-902.216] (-902.152) (-901.614) -- 0:00:25
Average standard deviation of split frequencies: 0.010849
600500 -- (-902.671) (-902.944) [-904.363] (-905.506) * [-904.253] (-903.474) (-903.555) (-901.634) -- 0:00:25
601000 -- (-901.718) [-903.853] (-905.050) (-904.369) * (-903.431) [-907.536] (-902.528) (-903.236) -- 0:00:25
601500 -- (-904.624) (-905.023) (-903.404) [-905.468] * (-904.171) (-904.072) (-905.142) [-903.287] -- 0:00:25
602000 -- (-903.220) (-902.739) [-905.304] (-902.854) * [-902.318] (-903.281) (-908.211) (-903.170) -- 0:00:25
602500 -- (-903.597) (-904.324) (-906.304) [-906.944] * [-902.955] (-903.822) (-902.123) (-904.402) -- 0:00:25
603000 -- (-903.700) (-902.639) [-904.828] (-907.652) * (-904.095) (-902.766) [-902.041] (-905.276) -- 0:00:25
603500 -- [-905.229] (-902.915) (-902.249) (-908.412) * (-903.968) (-903.121) [-901.634] (-905.829) -- 0:00:24
604000 -- (-903.830) (-906.354) (-905.686) [-902.825] * (-903.268) (-904.011) (-903.000) [-903.847] -- 0:00:24
604500 -- (-903.447) (-903.533) (-901.795) [-904.143] * (-903.602) (-903.068) [-904.656] (-902.317) -- 0:00:24
605000 -- (-903.059) (-903.301) [-901.789] (-903.620) * (-902.516) [-901.668] (-905.772) (-903.807) -- 0:00:24
Average standard deviation of split frequencies: 0.010296
605500 -- (-906.142) (-902.788) [-904.190] (-908.576) * (-902.104) [-903.642] (-903.331) (-904.292) -- 0:00:24
606000 -- [-904.177] (-904.756) (-904.713) (-906.072) * (-907.190) [-902.046] (-904.505) (-904.300) -- 0:00:24
606500 -- (-902.828) [-902.562] (-902.156) (-902.719) * [-902.889] (-904.064) (-909.400) (-904.689) -- 0:00:24
607000 -- (-902.655) (-906.149) [-901.852] (-904.392) * (-904.408) (-903.297) (-906.046) [-903.315] -- 0:00:24
607500 -- (-902.184) [-902.127] (-901.756) (-903.259) * (-904.918) (-914.656) (-903.060) [-904.383] -- 0:00:24
608000 -- (-903.519) (-901.864) [-902.356] (-903.866) * (-903.164) [-903.427] (-906.126) (-902.232) -- 0:00:24
608500 -- (-904.209) (-902.956) (-903.604) [-903.606] * (-903.102) (-903.147) [-903.598] (-903.773) -- 0:00:24
609000 -- (-905.155) (-905.350) (-902.671) [-902.421] * (-903.005) (-901.911) [-903.118] (-903.657) -- 0:00:24
609500 -- [-903.671] (-905.056) (-902.401) (-902.754) * (-906.868) (-901.396) (-903.992) [-901.473] -- 0:00:24
610000 -- [-903.613] (-902.423) (-905.663) (-905.363) * (-905.263) (-903.933) (-907.670) [-901.460] -- 0:00:24
Average standard deviation of split frequencies: 0.010399
610500 -- (-904.462) [-904.339] (-902.334) (-904.534) * (-906.949) [-903.381] (-906.620) (-905.260) -- 0:00:24
611000 -- [-903.055] (-901.875) (-902.139) (-902.143) * (-902.898) [-902.857] (-902.043) (-907.044) -- 0:00:24
611500 -- (-903.051) (-906.395) (-904.395) [-902.704] * (-904.439) (-903.659) (-904.402) [-905.295] -- 0:00:24
612000 -- [-902.959] (-904.899) (-902.640) (-902.801) * (-902.237) (-903.486) [-903.665] (-906.715) -- 0:00:24
612500 -- (-905.638) (-906.391) (-904.622) [-904.005] * [-905.178] (-903.466) (-905.191) (-905.133) -- 0:00:24
613000 -- (-906.648) [-906.957] (-903.749) (-907.976) * [-907.619] (-905.979) (-904.006) (-904.077) -- 0:00:24
613500 -- [-904.977] (-906.459) (-905.520) (-903.298) * (-902.870) (-904.474) [-903.317] (-903.715) -- 0:00:24
614000 -- (-906.826) (-905.211) [-904.991] (-906.038) * (-904.779) (-904.296) [-904.831] (-906.210) -- 0:00:24
614500 -- (-903.463) [-902.331] (-905.459) (-901.303) * [-906.810] (-903.002) (-906.518) (-903.106) -- 0:00:24
615000 -- [-902.725] (-905.342) (-909.373) (-901.316) * (-902.973) [-904.209] (-905.833) (-902.751) -- 0:00:24
Average standard deviation of split frequencies: 0.010034
615500 -- (-904.646) [-902.675] (-902.425) (-903.040) * (-903.746) (-903.713) (-904.554) [-904.536] -- 0:00:24
616000 -- (-904.876) [-901.627] (-903.209) (-902.042) * (-904.605) (-902.912) [-905.589] (-906.035) -- 0:00:24
616500 -- (-901.809) (-902.661) (-904.033) [-901.415] * (-908.009) (-907.291) [-905.115] (-905.751) -- 0:00:24
617000 -- [-902.043] (-905.671) (-903.534) (-903.965) * (-901.975) (-902.678) [-903.757] (-905.526) -- 0:00:24
617500 -- (-905.875) [-902.379] (-902.766) (-901.993) * [-906.540] (-906.368) (-905.719) (-903.401) -- 0:00:24
618000 -- (-903.791) [-907.538] (-905.079) (-902.030) * (-905.836) (-904.999) [-902.394] (-905.585) -- 0:00:24
618500 -- (-906.140) [-904.364] (-907.530) (-901.925) * [-905.436] (-902.863) (-902.487) (-904.689) -- 0:00:24
619000 -- (-902.001) (-902.701) [-902.631] (-905.694) * (-901.702) (-903.393) (-908.613) [-903.504] -- 0:00:24
619500 -- (-903.913) (-902.242) (-903.384) [-904.706] * (-903.693) (-906.101) [-905.047] (-904.452) -- 0:00:23
620000 -- (-903.048) (-901.990) [-902.017] (-902.289) * (-903.066) (-901.642) [-903.226] (-904.407) -- 0:00:23
Average standard deviation of split frequencies: 0.009283
620500 -- (-906.715) (-903.582) (-905.641) [-903.840] * [-902.554] (-903.233) (-903.903) (-907.910) -- 0:00:23
621000 -- (-904.628) [-903.627] (-906.397) (-905.421) * (-903.206) [-901.996] (-903.070) (-906.296) -- 0:00:23
621500 -- (-907.864) (-907.884) [-904.603] (-903.758) * [-903.774] (-903.581) (-904.285) (-905.781) -- 0:00:23
622000 -- (-904.441) (-907.077) [-902.647] (-905.768) * (-905.962) (-902.502) [-903.334] (-906.534) -- 0:00:23
622500 -- (-903.264) (-904.006) [-905.684] (-906.354) * (-903.816) [-901.764] (-904.754) (-907.392) -- 0:00:23
623000 -- (-903.905) (-906.608) [-901.701] (-903.334) * [-902.221] (-902.885) (-903.461) (-903.278) -- 0:00:23
623500 -- (-904.610) [-901.707] (-902.517) (-902.938) * (-902.759) (-903.016) (-903.954) [-904.285] -- 0:00:23
624000 -- (-903.396) (-903.496) [-903.609] (-903.211) * (-902.174) [-902.962] (-905.369) (-901.844) -- 0:00:23
624500 -- [-902.426] (-902.168) (-903.878) (-907.000) * (-903.070) (-909.673) (-903.443) [-903.766] -- 0:00:23
625000 -- [-904.656] (-903.168) (-903.020) (-904.259) * (-904.709) [-903.857] (-906.284) (-904.833) -- 0:00:23
Average standard deviation of split frequencies: 0.009329
625500 -- [-908.062] (-904.416) (-901.754) (-903.187) * (-903.371) (-902.757) (-903.207) [-902.684] -- 0:00:23
626000 -- [-903.020] (-908.219) (-901.754) (-905.505) * (-902.554) (-907.553) [-903.113] (-904.628) -- 0:00:23
626500 -- (-904.016) [-911.334] (-905.546) (-904.157) * (-903.292) [-906.831] (-907.189) (-904.716) -- 0:00:23
627000 -- (-902.406) [-904.917] (-903.753) (-907.397) * (-905.156) [-901.650] (-903.408) (-904.118) -- 0:00:23
627500 -- (-910.116) [-901.400] (-903.253) (-907.715) * (-903.268) (-901.650) [-903.317] (-903.718) -- 0:00:23
628000 -- [-902.221] (-902.985) (-904.444) (-904.893) * [-903.077] (-903.123) (-902.133) (-905.674) -- 0:00:23
628500 -- (-905.597) [-904.254] (-904.285) (-901.959) * (-902.351) (-904.286) (-903.120) [-902.337] -- 0:00:23
629000 -- (-905.738) (-904.113) (-903.669) [-902.218] * (-902.571) [-902.698] (-902.215) (-905.804) -- 0:00:23
629500 -- [-903.937] (-903.178) (-906.154) (-906.202) * (-902.396) (-905.434) [-904.133] (-907.033) -- 0:00:23
630000 -- (-901.546) (-904.265) [-904.249] (-902.590) * (-902.811) [-904.074] (-902.260) (-906.583) -- 0:00:23
Average standard deviation of split frequencies: 0.009541
630500 -- (-903.567) (-903.803) [-904.190] (-907.298) * (-906.728) (-903.025) [-903.325] (-903.668) -- 0:00:23
631000 -- [-903.559] (-905.302) (-903.910) (-904.686) * (-903.684) (-903.246) (-905.566) [-903.428] -- 0:00:23
631500 -- [-908.924] (-904.877) (-902.507) (-907.713) * [-901.636] (-905.920) (-902.191) (-903.121) -- 0:00:23
632000 -- (-904.240) (-905.814) [-903.831] (-902.755) * (-902.851) [-902.401] (-907.580) (-903.530) -- 0:00:23
632500 -- [-903.041] (-905.318) (-906.168) (-902.773) * (-902.802) (-903.288) [-903.851] (-903.647) -- 0:00:23
633000 -- (-902.560) (-902.632) (-903.981) [-902.773] * (-902.446) [-903.124] (-906.561) (-903.477) -- 0:00:23
633500 -- [-902.530] (-902.373) (-903.928) (-902.888) * (-902.292) (-902.989) [-904.960] (-902.380) -- 0:00:23
634000 -- (-904.049) (-902.602) (-902.637) [-902.696] * (-902.838) (-904.052) (-901.451) [-903.223] -- 0:00:23
634500 -- (-906.075) (-904.146) [-904.108] (-904.256) * (-903.312) [-902.596] (-902.168) (-904.111) -- 0:00:23
635000 -- (-906.690) (-906.062) (-909.235) [-902.984] * (-903.950) [-902.769] (-903.082) (-905.426) -- 0:00:22
Average standard deviation of split frequencies: 0.009679
635500 -- (-904.420) [-902.304] (-906.972) (-901.525) * (-905.630) (-904.940) [-903.878] (-904.272) -- 0:00:22
636000 -- (-903.590) (-902.341) (-908.909) [-901.532] * (-902.859) [-903.448] (-904.554) (-904.308) -- 0:00:22
636500 -- (-904.307) (-902.184) (-902.535) [-906.319] * (-901.920) [-902.101] (-902.784) (-904.533) -- 0:00:22
637000 -- (-902.640) (-902.456) [-903.540] (-903.572) * (-901.731) (-902.877) [-902.974] (-907.779) -- 0:00:22
637500 -- (-904.414) [-902.361] (-902.886) (-905.001) * (-902.685) (-902.073) [-903.303] (-902.119) -- 0:00:22
638000 -- (-905.531) (-902.960) [-903.607] (-902.929) * (-903.436) (-905.826) [-908.443] (-903.310) -- 0:00:22
638500 -- (-906.123) (-902.848) [-904.238] (-903.705) * (-902.801) [-902.090] (-901.930) (-902.216) -- 0:00:22
639000 -- (-903.160) (-902.572) [-908.071] (-903.586) * (-905.131) (-903.188) (-901.935) [-902.907] -- 0:00:22
639500 -- (-902.100) (-902.413) (-904.000) [-903.181] * (-905.296) (-902.515) (-902.990) [-902.073] -- 0:00:22
640000 -- [-902.592] (-906.985) (-902.826) (-904.501) * (-903.963) [-902.294] (-903.971) (-901.857) -- 0:00:22
Average standard deviation of split frequencies: 0.010085
640500 -- [-902.284] (-902.583) (-905.431) (-902.201) * (-904.055) (-902.459) (-903.698) [-904.089] -- 0:00:22
641000 -- [-902.931] (-903.282) (-903.197) (-906.852) * (-903.395) (-903.613) [-903.727] (-904.797) -- 0:00:22
641500 -- (-903.244) (-904.067) [-903.041] (-904.275) * [-902.600] (-903.757) (-904.924) (-905.671) -- 0:00:22
642000 -- [-904.874] (-903.299) (-902.591) (-903.566) * (-902.601) (-902.725) [-901.838] (-904.265) -- 0:00:22
642500 -- [-904.066] (-903.155) (-902.604) (-906.949) * (-901.699) [-905.555] (-902.222) (-903.433) -- 0:00:22
643000 -- (-902.654) (-903.097) (-902.474) [-903.622] * (-901.292) (-904.452) [-902.203] (-905.080) -- 0:00:22
643500 -- (-904.429) [-902.800] (-904.851) (-903.361) * (-903.357) (-903.591) (-902.352) [-903.546] -- 0:00:22
644000 -- [-902.927] (-903.636) (-905.295) (-903.461) * (-905.106) [-902.800] (-902.962) (-905.363) -- 0:00:22
644500 -- (-902.291) (-901.339) [-906.103] (-907.591) * (-910.961) (-904.442) [-904.297] (-905.676) -- 0:00:22
645000 -- [-903.348] (-904.263) (-902.666) (-904.215) * (-912.125) (-904.807) [-902.627] (-902.401) -- 0:00:22
Average standard deviation of split frequencies: 0.010054
645500 -- [-903.423] (-902.799) (-906.685) (-903.490) * (-906.016) (-904.876) (-902.593) [-904.838] -- 0:00:22
646000 -- (-902.099) (-901.909) [-902.714] (-905.231) * (-906.461) [-904.310] (-901.908) (-904.982) -- 0:00:22
646500 -- (-902.550) [-903.702] (-902.394) (-903.551) * (-902.160) (-911.434) (-902.847) [-912.588] -- 0:00:22
647000 -- (-904.921) (-902.864) (-903.363) [-903.866] * (-903.113) (-907.381) [-903.340] (-906.735) -- 0:00:22
647500 -- (-903.981) (-902.620) [-901.971] (-902.944) * (-904.032) (-908.917) (-905.273) [-904.267] -- 0:00:22
648000 -- (-905.436) (-901.932) (-903.447) [-902.032] * (-908.132) (-906.371) [-903.819] (-902.752) -- 0:00:22
648500 -- (-903.890) [-902.062] (-903.254) (-904.144) * [-904.773] (-903.929) (-915.345) (-908.736) -- 0:00:22
649000 -- (-902.734) (-902.202) [-902.471] (-903.539) * (-903.323) [-904.855] (-903.624) (-901.595) -- 0:00:22
649500 -- [-908.870] (-901.939) (-904.611) (-903.925) * [-904.434] (-906.305) (-907.124) (-906.147) -- 0:00:22
650000 -- [-903.828] (-904.602) (-902.982) (-902.199) * (-902.442) (-905.276) (-905.254) [-905.998] -- 0:00:22
Average standard deviation of split frequencies: 0.009762
650500 -- [-902.835] (-903.194) (-904.621) (-902.506) * [-902.246] (-904.003) (-902.620) (-905.035) -- 0:00:22
651000 -- [-906.662] (-903.763) (-906.070) (-903.385) * (-901.998) (-913.027) [-904.304] (-904.688) -- 0:00:21
651500 -- [-907.743] (-903.533) (-903.479) (-906.057) * (-905.969) (-912.002) [-902.852] (-901.598) -- 0:00:21
652000 -- (-904.314) [-902.239] (-902.995) (-904.210) * (-904.170) (-904.416) [-906.075] (-907.015) -- 0:00:21
652500 -- (-903.694) [-901.938] (-903.494) (-905.953) * (-904.892) (-904.505) [-905.038] (-903.144) -- 0:00:21
653000 -- [-902.610] (-902.878) (-903.612) (-904.250) * [-902.586] (-905.577) (-907.272) (-904.875) -- 0:00:21
653500 -- (-902.719) (-907.768) (-904.832) [-906.466] * (-905.372) [-903.539] (-905.590) (-903.439) -- 0:00:21
654000 -- (-903.135) (-902.676) (-902.417) [-906.179] * [-902.558] (-905.127) (-903.806) (-903.508) -- 0:00:21
654500 -- (-904.324) (-905.328) (-903.973) [-902.843] * (-905.691) (-901.515) (-904.474) [-904.109] -- 0:00:21
655000 -- (-907.578) (-902.823) (-905.632) [-901.322] * (-901.956) (-901.864) (-902.321) [-902.123] -- 0:00:21
Average standard deviation of split frequencies: 0.009569
655500 -- [-908.271] (-903.190) (-902.937) (-903.158) * (-902.704) (-903.237) [-901.703] (-901.941) -- 0:00:21
656000 -- (-907.769) (-903.850) (-904.417) [-904.174] * [-903.072] (-902.696) (-903.697) (-901.813) -- 0:00:21
656500 -- [-902.324] (-907.479) (-904.401) (-904.439) * (-908.854) (-903.141) (-903.043) [-902.274] -- 0:00:21
657000 -- (-903.847) [-907.479] (-905.090) (-904.601) * (-902.539) (-905.637) [-903.273] (-904.285) -- 0:00:21
657500 -- (-903.011) (-904.759) (-904.021) [-905.890] * (-906.940) [-904.403] (-902.454) (-903.042) -- 0:00:21
658000 -- [-901.635] (-905.286) (-904.465) (-905.725) * [-901.384] (-905.745) (-903.308) (-902.613) -- 0:00:21
658500 -- (-905.180) (-901.779) (-904.406) [-905.271] * (-903.434) (-907.274) [-902.602] (-907.896) -- 0:00:21
659000 -- [-902.445] (-903.882) (-905.140) (-902.743) * (-904.213) (-903.215) (-903.071) [-904.689] -- 0:00:21
659500 -- (-903.587) (-903.743) [-902.051] (-901.733) * [-903.629] (-906.603) (-903.327) (-902.697) -- 0:00:21
660000 -- (-905.811) (-907.555) [-902.548] (-901.474) * [-902.359] (-904.619) (-903.288) (-903.084) -- 0:00:21
Average standard deviation of split frequencies: 0.010065
660500 -- (-902.285) (-906.329) (-903.857) [-902.912] * (-903.056) (-907.468) (-904.639) [-904.238] -- 0:00:21
661000 -- (-902.242) [-902.906] (-909.397) (-903.342) * [-903.926] (-903.163) (-904.637) (-905.424) -- 0:00:21
661500 -- [-903.050] (-906.411) (-903.272) (-902.309) * (-907.782) [-907.221] (-902.615) (-902.535) -- 0:00:21
662000 -- (-903.322) (-903.712) (-903.328) [-903.350] * [-902.343] (-907.448) (-903.673) (-903.883) -- 0:00:21
662500 -- (-905.399) [-902.563] (-901.423) (-903.904) * (-903.269) (-905.678) (-903.326) [-903.362] -- 0:00:21
663000 -- (-903.220) (-901.768) [-901.706] (-903.753) * (-904.367) (-904.502) [-901.466] (-903.963) -- 0:00:21
663500 -- [-901.985] (-902.503) (-904.519) (-902.882) * (-904.735) (-903.717) [-904.261] (-904.401) -- 0:00:21
664000 -- (-902.491) [-903.924] (-904.000) (-903.953) * (-902.559) (-904.637) [-901.984] (-907.616) -- 0:00:21
664500 -- (-901.760) [-904.363] (-905.876) (-903.403) * (-903.460) (-904.123) (-905.321) [-902.027] -- 0:00:21
665000 -- (-906.566) (-902.727) (-907.475) [-902.918] * [-902.892] (-901.619) (-905.892) (-901.886) -- 0:00:21
Average standard deviation of split frequencies: 0.009760
665500 -- (-904.435) (-902.308) (-903.263) [-904.124] * (-901.979) (-903.860) (-904.435) [-903.544] -- 0:00:21
666000 -- (-903.520) (-902.621) [-905.506] (-903.202) * [-905.136] (-908.982) (-903.063) (-903.994) -- 0:00:21
666500 -- (-902.821) [-907.300] (-901.802) (-903.739) * (-904.280) (-904.029) [-906.844] (-904.491) -- 0:00:21
667000 -- (-902.781) (-904.063) (-902.059) [-903.449] * (-903.761) (-903.243) [-904.160] (-904.776) -- 0:00:20
667500 -- (-902.740) (-904.827) (-903.515) [-904.653] * (-906.017) (-902.518) [-902.740] (-906.134) -- 0:00:20
668000 -- (-902.677) (-902.769) (-902.464) [-903.355] * [-906.363] (-905.489) (-904.293) (-903.358) -- 0:00:20
668500 -- (-907.726) (-905.103) [-903.600] (-903.527) * (-906.394) (-909.562) (-904.825) [-904.425] -- 0:00:20
669000 -- (-905.566) (-903.015) [-902.105] (-902.682) * (-904.263) (-906.109) [-905.584] (-904.331) -- 0:00:20
669500 -- [-905.071] (-902.536) (-901.979) (-906.130) * (-904.757) (-906.258) (-904.411) [-902.480] -- 0:00:20
670000 -- (-903.129) (-902.250) [-903.999] (-905.037) * (-906.318) [-902.487] (-901.745) (-901.770) -- 0:00:20
Average standard deviation of split frequencies: 0.009880
670500 -- [-903.769] (-903.036) (-907.337) (-902.050) * (-904.169) [-902.148] (-901.734) (-902.169) -- 0:00:20
671000 -- (-903.303) [-903.217] (-905.050) (-903.670) * [-906.180] (-903.163) (-903.348) (-902.131) -- 0:00:20
671500 -- [-904.452] (-902.539) (-904.406) (-902.796) * (-904.686) (-903.476) (-903.885) [-904.491] -- 0:00:20
672000 -- (-903.560) (-905.016) [-905.195] (-905.615) * (-903.236) (-905.433) [-902.867] (-903.971) -- 0:00:20
672500 -- [-903.714] (-904.143) (-903.865) (-908.758) * (-902.078) (-905.976) [-904.132] (-902.400) -- 0:00:20
673000 -- (-902.871) (-901.338) [-905.208] (-907.903) * (-904.272) [-906.179] (-902.504) (-903.441) -- 0:00:20
673500 -- [-906.779] (-902.351) (-904.149) (-903.825) * (-901.852) (-905.076) (-905.094) [-902.581] -- 0:00:20
674000 -- (-906.178) [-903.365] (-907.404) (-904.867) * [-903.115] (-906.230) (-902.418) (-903.419) -- 0:00:20
674500 -- [-904.263] (-905.034) (-907.111) (-904.828) * [-903.669] (-904.547) (-902.572) (-903.488) -- 0:00:20
675000 -- (-901.934) (-906.938) (-904.411) [-901.646] * [-902.775] (-902.691) (-902.211) (-903.034) -- 0:00:20
Average standard deviation of split frequencies: 0.010266
675500 -- [-901.605] (-903.752) (-903.278) (-903.547) * [-903.800] (-905.714) (-902.318) (-904.855) -- 0:00:20
676000 -- (-901.984) (-902.448) [-902.445] (-902.485) * (-901.740) [-904.359] (-903.534) (-903.080) -- 0:00:20
676500 -- (-905.349) (-903.292) [-902.761] (-905.944) * (-902.716) [-903.542] (-904.444) (-903.985) -- 0:00:20
677000 -- (-906.404) [-903.297] (-905.606) (-903.383) * (-903.256) (-904.755) (-904.096) [-901.639] -- 0:00:20
677500 -- (-904.294) [-903.988] (-907.280) (-904.158) * (-905.187) (-902.714) (-904.434) [-902.027] -- 0:00:19
678000 -- [-903.148] (-902.780) (-905.080) (-903.345) * (-904.484) (-903.562) [-905.844] (-901.877) -- 0:00:20
678500 -- (-905.810) (-904.162) [-902.055] (-902.073) * (-904.423) (-904.534) [-901.831] (-907.629) -- 0:00:20
679000 -- (-903.064) (-903.800) [-904.137] (-902.340) * (-906.221) [-902.311] (-904.876) (-901.873) -- 0:00:20
679500 -- (-904.352) [-905.712] (-904.629) (-905.542) * (-904.068) [-903.625] (-903.559) (-905.518) -- 0:00:20
680000 -- (-906.010) (-903.068) (-913.805) [-903.852] * (-903.218) [-902.236] (-903.740) (-902.763) -- 0:00:20
Average standard deviation of split frequencies: 0.009811
680500 -- (-909.534) (-902.946) [-902.755] (-903.112) * (-902.121) [-903.005] (-903.809) (-903.063) -- 0:00:20
681000 -- (-903.638) [-903.815] (-904.004) (-902.641) * [-901.727] (-906.561) (-903.264) (-904.407) -- 0:00:20
681500 -- [-903.248] (-902.011) (-903.762) (-902.448) * (-902.337) (-906.659) (-904.588) [-903.519] -- 0:00:20
682000 -- (-906.308) (-904.122) [-903.459] (-902.604) * (-904.665) (-905.866) [-904.285] (-904.741) -- 0:00:20
682500 -- (-902.015) (-904.374) [-902.258] (-904.106) * (-908.035) [-902.455] (-901.935) (-905.453) -- 0:00:20
683000 -- (-903.014) (-905.034) (-903.396) [-903.232] * (-903.095) (-903.342) [-905.227] (-903.903) -- 0:00:19
683500 -- (-904.244) (-905.525) [-902.004] (-902.685) * (-906.840) [-904.203] (-902.216) (-901.642) -- 0:00:19
684000 -- (-904.247) (-903.540) [-902.508] (-901.627) * [-902.390] (-906.388) (-904.215) (-902.691) -- 0:00:19
684500 -- (-904.999) [-904.982] (-906.252) (-903.372) * (-902.212) (-904.278) (-906.006) [-901.483] -- 0:00:19
685000 -- [-902.265] (-903.790) (-907.572) (-903.484) * (-903.580) [-903.387] (-904.125) (-904.211) -- 0:00:19
Average standard deviation of split frequencies: 0.009697
685500 -- (-901.798) (-904.226) (-902.351) [-905.092] * [-902.520] (-902.535) (-902.118) (-905.976) -- 0:00:19
686000 -- (-903.939) (-903.493) [-903.979] (-903.705) * (-905.461) [-902.213] (-903.330) (-901.983) -- 0:00:19
686500 -- [-903.198] (-903.318) (-903.934) (-901.979) * (-904.134) [-901.940] (-903.289) (-903.789) -- 0:00:19
687000 -- (-908.132) [-903.340] (-905.094) (-903.062) * (-902.422) [-902.361] (-909.428) (-903.269) -- 0:00:19
687500 -- (-906.998) [-903.521] (-904.569) (-903.441) * [-901.803] (-901.596) (-903.281) (-902.274) -- 0:00:19
688000 -- (-904.402) (-904.068) (-904.068) [-902.933] * (-902.108) (-903.686) [-904.607] (-902.317) -- 0:00:19
688500 -- [-902.480] (-903.148) (-907.115) (-905.680) * (-902.122) (-911.065) (-902.303) [-903.488] -- 0:00:19
689000 -- (-907.743) (-902.348) (-904.265) [-902.908] * (-902.778) [-904.161] (-903.250) (-902.399) -- 0:00:19
689500 -- (-904.483) [-902.155] (-904.230) (-903.436) * (-902.075) [-902.518] (-912.718) (-903.529) -- 0:00:19
690000 -- [-904.144] (-904.562) (-905.696) (-903.901) * (-902.364) [-902.187] (-905.922) (-903.925) -- 0:00:19
Average standard deviation of split frequencies: 0.009859
690500 -- (-905.790) [-902.993] (-904.492) (-902.821) * (-902.603) (-905.906) (-903.161) [-904.164] -- 0:00:19
691000 -- (-910.546) [-904.998] (-903.878) (-903.067) * (-904.838) [-904.661] (-903.026) (-903.225) -- 0:00:19
691500 -- (-908.527) [-905.050] (-907.603) (-906.353) * (-902.324) (-904.329) (-901.968) [-904.699] -- 0:00:19
692000 -- [-904.394] (-904.535) (-902.465) (-903.745) * (-902.589) [-903.339] (-907.256) (-903.512) -- 0:00:19
692500 -- (-902.189) [-904.833] (-904.358) (-904.059) * (-902.589) (-902.515) [-904.077] (-904.556) -- 0:00:19
693000 -- [-902.639] (-904.227) (-903.063) (-903.247) * (-905.991) [-902.088] (-902.414) (-903.000) -- 0:00:19
693500 -- (-903.063) (-901.785) (-905.339) [-905.539] * (-905.646) (-905.385) [-902.862] (-903.928) -- 0:00:19
694000 -- [-902.885] (-904.122) (-903.994) (-905.432) * [-902.699] (-904.162) (-901.836) (-901.873) -- 0:00:18
694500 -- (-902.690) (-902.686) (-902.924) [-904.476] * (-902.623) (-903.273) (-902.124) [-904.230] -- 0:00:19
695000 -- (-902.387) (-903.967) (-902.381) [-903.298] * (-908.837) (-902.177) (-904.277) [-903.542] -- 0:00:19
Average standard deviation of split frequencies: 0.009681
695500 -- [-904.900] (-905.062) (-903.013) (-903.231) * (-903.011) (-902.642) [-902.238] (-904.603) -- 0:00:19
696000 -- (-905.030) (-904.498) (-904.155) [-903.273] * (-903.236) (-905.539) (-903.994) [-903.498] -- 0:00:19
696500 -- (-905.720) [-907.786] (-908.988) (-903.607) * [-903.071] (-906.170) (-906.691) (-903.582) -- 0:00:19
697000 -- [-902.270] (-906.446) (-903.681) (-902.319) * [-904.863] (-903.842) (-903.078) (-907.154) -- 0:00:19
697500 -- (-901.714) (-906.160) [-903.429] (-903.194) * [-903.822] (-902.311) (-904.182) (-902.033) -- 0:00:19
698000 -- [-902.594] (-902.866) (-903.815) (-905.294) * (-905.938) (-902.803) [-902.680] (-903.740) -- 0:00:19
698500 -- (-903.662) (-907.695) [-901.947] (-904.189) * (-904.201) [-901.610] (-902.190) (-902.028) -- 0:00:18
699000 -- (-902.482) [-905.740] (-901.921) (-902.629) * (-903.323) [-903.194] (-901.610) (-903.760) -- 0:00:18
699500 -- (-905.107) (-905.273) (-903.607) [-902.487] * (-903.507) (-903.242) (-901.965) [-902.383] -- 0:00:18
700000 -- [-902.673] (-902.802) (-901.908) (-905.723) * (-908.147) [-902.116] (-904.893) (-902.808) -- 0:00:18
Average standard deviation of split frequencies: 0.009815
700500 -- (-902.973) (-908.884) [-901.826] (-903.675) * (-905.174) (-902.474) [-902.415] (-902.522) -- 0:00:18
701000 -- (-907.117) [-904.521] (-904.503) (-902.793) * [-902.369] (-902.696) (-908.507) (-905.539) -- 0:00:18
701500 -- [-903.294] (-902.727) (-902.486) (-904.721) * [-902.353] (-905.367) (-906.251) (-905.449) -- 0:00:18
702000 -- (-903.825) (-906.383) [-902.905] (-901.663) * (-902.746) (-904.388) [-902.915] (-903.898) -- 0:00:18
702500 -- [-902.584] (-903.625) (-905.733) (-903.844) * (-903.445) [-902.829] (-903.471) (-902.156) -- 0:00:18
703000 -- (-902.417) (-905.346) (-902.324) [-903.701] * (-905.184) (-903.366) (-904.874) [-902.685] -- 0:00:18
703500 -- [-903.973] (-902.790) (-903.307) (-906.623) * [-902.912] (-903.886) (-902.427) (-905.925) -- 0:00:18
704000 -- (-901.638) (-904.202) [-904.195] (-904.147) * (-901.759) [-904.672] (-903.505) (-905.885) -- 0:00:18
704500 -- (-904.983) (-905.800) [-904.746] (-905.035) * (-901.617) [-904.080] (-902.761) (-903.578) -- 0:00:18
705000 -- (-903.684) (-907.110) [-905.944] (-912.295) * [-904.234] (-902.290) (-906.279) (-903.948) -- 0:00:18
Average standard deviation of split frequencies: 0.010201
705500 -- (-909.100) (-908.213) (-905.356) [-906.214] * [-902.563] (-903.242) (-904.031) (-903.342) -- 0:00:18
706000 -- (-903.488) [-904.544] (-903.880) (-901.876) * [-903.031] (-903.746) (-902.580) (-905.340) -- 0:00:18
706500 -- (-903.638) [-903.617] (-905.400) (-905.115) * (-902.055) [-902.138] (-903.301) (-904.188) -- 0:00:18
707000 -- (-903.692) (-902.027) [-904.352] (-903.721) * (-903.620) [-902.639] (-902.584) (-903.535) -- 0:00:18
707500 -- (-905.551) (-903.604) [-901.951] (-904.875) * [-901.939] (-907.302) (-905.309) (-904.844) -- 0:00:18
708000 -- [-902.271] (-902.519) (-903.462) (-904.343) * (-902.966) (-908.515) (-904.329) [-903.961] -- 0:00:18
708500 -- (-902.086) (-906.611) (-907.941) [-904.081] * (-901.427) [-905.506] (-903.960) (-906.099) -- 0:00:18
709000 -- (-903.126) (-910.058) [-906.183] (-905.619) * (-901.959) [-904.804] (-903.025) (-904.640) -- 0:00:18
709500 -- (-904.468) (-904.458) (-909.081) [-904.479] * (-905.262) (-905.465) (-903.462) [-902.423] -- 0:00:18
710000 -- (-908.521) (-910.306) (-902.766) [-902.822] * (-905.126) (-903.082) (-903.769) [-903.080] -- 0:00:18
Average standard deviation of split frequencies: 0.010808
710500 -- (-901.997) (-908.451) [-905.882] (-904.329) * (-902.573) [-904.706] (-905.020) (-902.272) -- 0:00:18
711000 -- [-902.689] (-906.200) (-908.408) (-903.062) * (-905.259) [-903.024] (-901.464) (-905.359) -- 0:00:18
711500 -- [-903.304] (-904.601) (-907.893) (-903.103) * (-906.378) (-902.361) [-906.421] (-902.850) -- 0:00:18
712000 -- (-903.342) (-902.882) (-904.648) [-903.024] * (-904.193) (-902.906) [-903.525] (-905.560) -- 0:00:18
712500 -- (-904.534) (-901.897) [-902.492] (-904.343) * [-902.631] (-904.218) (-904.866) (-903.156) -- 0:00:18
713000 -- (-905.380) [-904.883] (-902.716) (-904.523) * (-905.759) [-909.871] (-901.967) (-903.514) -- 0:00:18
713500 -- [-905.606] (-904.712) (-903.315) (-905.040) * [-902.489] (-904.862) (-905.173) (-902.429) -- 0:00:18
714000 -- (-903.001) (-903.725) [-902.563] (-902.836) * [-904.344] (-906.193) (-904.097) (-903.468) -- 0:00:18
714500 -- [-907.525] (-909.813) (-903.688) (-907.548) * (-903.854) [-902.754] (-901.892) (-904.890) -- 0:00:17
715000 -- (-907.154) [-905.667] (-906.165) (-902.183) * (-904.039) [-903.796] (-903.312) (-904.930) -- 0:00:17
Average standard deviation of split frequencies: 0.010612
715500 -- (-902.020) [-901.557] (-902.688) (-904.224) * (-902.749) (-904.609) (-903.897) [-903.451] -- 0:00:17
716000 -- (-902.421) (-903.542) [-903.427] (-908.138) * (-903.322) [-902.823] (-904.070) (-905.104) -- 0:00:17
716500 -- (-902.182) [-903.369] (-903.962) (-902.084) * (-904.558) (-906.322) [-902.524] (-905.304) -- 0:00:17
717000 -- (-904.216) (-905.944) [-906.558] (-903.257) * (-904.243) (-901.729) [-903.477] (-903.566) -- 0:00:17
717500 -- (-908.736) (-902.943) (-904.951) [-906.113] * (-902.491) [-902.845] (-902.053) (-904.358) -- 0:00:17
718000 -- (-907.442) (-902.753) (-906.896) [-906.591] * [-902.467] (-902.354) (-907.272) (-901.882) -- 0:00:17
718500 -- (-904.474) [-901.797] (-902.129) (-903.927) * (-904.052) [-901.863] (-906.506) (-904.210) -- 0:00:17
719000 -- [-901.650] (-905.650) (-902.161) (-906.632) * (-904.231) [-902.235] (-905.662) (-902.686) -- 0:00:17
719500 -- (-902.750) (-904.587) [-901.392] (-902.352) * (-901.746) [-908.634] (-905.190) (-906.832) -- 0:00:17
720000 -- (-902.997) (-904.433) [-902.211] (-902.176) * (-901.725) [-902.339] (-904.878) (-905.262) -- 0:00:17
Average standard deviation of split frequencies: 0.010274
720500 -- (-904.274) (-901.296) [-903.341] (-905.236) * (-905.766) (-902.358) [-902.537] (-907.094) -- 0:00:17
721000 -- (-902.939) (-901.503) (-902.105) [-903.954] * (-908.718) [-902.451] (-902.675) (-905.572) -- 0:00:17
721500 -- [-902.442] (-903.323) (-906.985) (-905.656) * (-906.352) [-903.904] (-903.050) (-904.510) -- 0:00:17
722000 -- (-905.340) (-907.582) (-904.906) [-903.002] * [-902.222] (-903.576) (-901.789) (-902.147) -- 0:00:17
722500 -- [-901.707] (-905.104) (-903.369) (-902.386) * (-903.196) (-904.688) (-905.832) [-904.064] -- 0:00:17
723000 -- (-902.198) (-903.740) [-903.537] (-902.430) * (-903.746) (-903.797) [-905.556] (-903.515) -- 0:00:17
723500 -- [-901.624] (-902.099) (-902.967) (-903.482) * (-902.749) (-904.375) [-905.819] (-902.383) -- 0:00:17
724000 -- (-902.186) [-903.242] (-903.948) (-903.989) * [-903.523] (-903.609) (-905.546) (-903.515) -- 0:00:17
724500 -- [-902.790] (-902.152) (-904.918) (-904.797) * (-904.747) (-906.038) [-901.730] (-901.708) -- 0:00:17
725000 -- (-905.400) (-902.646) (-902.186) [-906.092] * (-909.458) [-907.664] (-904.402) (-903.809) -- 0:00:17
Average standard deviation of split frequencies: 0.010122
725500 -- (-903.987) (-904.814) (-903.263) [-904.733] * (-907.046) (-902.611) (-905.922) [-902.169] -- 0:00:17
726000 -- (-907.951) [-902.170] (-906.623) (-903.161) * (-904.660) [-902.251] (-905.605) (-906.604) -- 0:00:17
726500 -- (-906.595) [-904.796] (-901.707) (-901.995) * (-903.237) (-902.765) [-902.206] (-908.341) -- 0:00:17
727000 -- (-902.886) (-905.891) (-903.878) [-902.689] * (-901.853) (-906.437) [-902.160] (-906.062) -- 0:00:17
727500 -- (-902.616) (-905.806) (-903.586) [-902.461] * (-903.372) (-906.825) [-902.017] (-904.734) -- 0:00:17
728000 -- (-902.893) (-905.507) [-903.606] (-905.100) * (-903.758) (-909.779) (-902.586) [-905.293] -- 0:00:17
728500 -- (-902.075) [-906.388] (-906.738) (-903.728) * (-902.071) (-906.923) [-904.122] (-902.356) -- 0:00:17
729000 -- (-901.878) (-904.648) (-902.111) [-902.357] * (-903.389) [-905.891] (-902.639) (-903.938) -- 0:00:17
729500 -- [-901.658] (-904.241) (-902.830) (-907.528) * (-904.261) (-903.911) [-902.842] (-905.915) -- 0:00:17
730000 -- (-904.810) [-903.041] (-902.137) (-910.663) * (-904.236) [-903.202] (-903.608) (-904.607) -- 0:00:17
Average standard deviation of split frequencies: 0.010588
730500 -- (-902.783) (-903.157) [-903.416] (-905.110) * (-902.165) [-906.261] (-903.210) (-904.846) -- 0:00:16
731000 -- [-904.121] (-902.468) (-902.389) (-907.981) * [-903.823] (-908.131) (-905.147) (-906.325) -- 0:00:16
731500 -- (-909.757) (-902.797) [-902.149] (-903.924) * (-904.339) [-905.318] (-907.365) (-902.770) -- 0:00:16
732000 -- (-905.594) [-903.101] (-904.006) (-902.631) * (-905.819) [-902.218] (-903.905) (-901.725) -- 0:00:16
732500 -- (-905.270) (-903.759) (-905.784) [-902.158] * [-904.171] (-904.174) (-904.217) (-904.042) -- 0:00:16
733000 -- [-903.628] (-902.596) (-902.833) (-909.201) * [-903.582] (-902.962) (-906.819) (-904.482) -- 0:00:16
733500 -- (-907.935) (-902.202) [-903.531] (-902.142) * (-903.810) (-906.560) (-906.293) [-902.012] -- 0:00:16
734000 -- (-903.457) (-902.180) (-902.097) [-902.265] * (-903.893) [-905.362] (-903.599) (-902.111) -- 0:00:16
734500 -- (-904.311) (-902.052) [-902.958] (-902.783) * (-904.711) [-903.291] (-901.796) (-902.318) -- 0:00:16
735000 -- (-907.024) [-905.352] (-902.414) (-902.717) * (-906.882) (-904.930) (-903.219) [-904.084] -- 0:00:16
Average standard deviation of split frequencies: 0.009796
735500 -- (-901.714) (-903.178) [-903.686] (-903.818) * (-905.112) [-902.601] (-905.372) (-903.779) -- 0:00:16
736000 -- (-906.472) [-903.571] (-903.662) (-905.580) * (-901.866) (-902.977) [-902.327] (-901.717) -- 0:00:16
736500 -- [-903.298] (-903.122) (-903.152) (-903.139) * (-901.312) (-906.494) (-904.473) [-902.623] -- 0:00:16
737000 -- (-901.483) (-906.165) (-902.976) [-902.943] * (-902.320) (-903.858) [-905.879] (-902.621) -- 0:00:16
737500 -- (-902.166) (-906.238) (-904.288) [-904.193] * (-901.703) (-907.503) (-904.659) [-903.796] -- 0:00:16
738000 -- (-904.412) [-905.922] (-903.991) (-903.155) * (-903.705) (-904.605) [-905.098] (-903.164) -- 0:00:16
738500 -- (-902.660) (-903.563) (-904.034) [-904.611] * (-907.223) (-902.295) (-908.849) [-902.120] -- 0:00:16
739000 -- [-902.187] (-903.840) (-905.625) (-904.274) * (-908.452) (-901.803) [-903.468] (-902.241) -- 0:00:16
739500 -- (-903.489) [-908.555] (-903.693) (-902.647) * (-907.079) (-904.207) [-904.326] (-904.348) -- 0:00:16
740000 -- (-903.899) (-903.281) (-907.799) [-906.555] * (-907.199) (-904.723) [-901.979] (-903.863) -- 0:00:16
Average standard deviation of split frequencies: 0.009285
740500 -- (-905.548) (-904.249) [-902.334] (-903.797) * (-905.366) [-906.122] (-903.826) (-907.113) -- 0:00:16
741000 -- (-902.034) (-902.968) (-903.959) [-902.783] * (-906.060) (-906.374) (-902.219) [-901.671] -- 0:00:16
741500 -- [-902.035] (-902.770) (-901.873) (-903.006) * (-903.656) (-904.532) (-903.926) [-904.010] -- 0:00:16
742000 -- (-906.718) (-902.504) [-902.809] (-903.385) * (-904.666) [-903.664] (-904.875) (-905.202) -- 0:00:16
742500 -- (-903.880) (-903.085) [-905.477] (-903.112) * [-901.974] (-902.873) (-903.933) (-907.583) -- 0:00:16
743000 -- [-903.108] (-905.065) (-905.895) (-902.131) * [-903.127] (-905.080) (-904.696) (-903.106) -- 0:00:16
743500 -- (-903.459) (-903.495) (-904.897) [-904.844] * (-905.423) (-906.034) (-906.131) [-902.874] -- 0:00:16
744000 -- (-905.080) [-902.521] (-902.748) (-905.221) * (-902.705) [-903.510] (-904.768) (-904.044) -- 0:00:16
744500 -- (-904.500) (-902.327) (-904.501) [-902.166] * (-902.960) [-904.245] (-902.412) (-905.611) -- 0:00:16
745000 -- (-905.797) [-904.847] (-901.333) (-902.947) * (-904.152) [-904.157] (-902.469) (-903.742) -- 0:00:16
Average standard deviation of split frequencies: 0.008921
745500 -- (-905.012) (-903.311) (-902.055) [-904.281] * (-901.687) (-902.949) [-903.069] (-907.932) -- 0:00:16
746000 -- (-905.261) [-902.534] (-907.646) (-907.980) * (-904.805) (-902.939) [-902.588] (-904.895) -- 0:00:16
746500 -- (-904.760) [-902.319] (-905.525) (-902.602) * (-904.501) (-901.966) [-902.998] (-901.510) -- 0:00:15
747000 -- (-902.402) [-902.085] (-904.473) (-903.410) * (-903.644) (-905.478) (-905.530) [-901.467] -- 0:00:15
747500 -- (-903.944) (-907.407) (-901.601) [-902.773] * [-903.444] (-905.115) (-904.073) (-902.882) -- 0:00:15
748000 -- (-903.204) (-903.272) [-901.844] (-901.876) * (-901.816) (-903.442) (-904.491) [-906.877] -- 0:00:15
748500 -- (-909.040) (-903.043) [-903.125] (-904.042) * (-905.709) (-905.381) [-904.650] (-902.196) -- 0:00:15
749000 -- [-902.431] (-903.535) (-904.138) (-904.453) * (-903.760) [-905.279] (-906.112) (-901.581) -- 0:00:15
749500 -- (-904.257) (-901.873) (-902.516) [-906.657] * (-904.102) [-905.109] (-904.956) (-902.661) -- 0:00:15
750000 -- (-903.126) [-902.789] (-902.437) (-906.777) * (-904.046) (-904.439) (-906.666) [-901.812] -- 0:00:15
Average standard deviation of split frequencies: 0.008939
750500 -- (-905.953) (-904.132) (-902.391) [-904.345] * [-901.437] (-903.294) (-904.006) (-902.200) -- 0:00:15
751000 -- (-903.114) (-908.663) (-902.419) [-903.164] * (-903.638) (-908.719) [-905.178] (-904.318) -- 0:00:15
751500 -- (-902.170) (-904.573) [-901.948] (-904.510) * (-903.369) (-903.729) [-904.250] (-903.520) -- 0:00:15
752000 -- [-901.494] (-901.738) (-902.427) (-901.957) * (-904.726) (-901.874) (-904.361) [-901.995] -- 0:00:15
752500 -- [-901.525] (-904.483) (-903.196) (-902.295) * [-903.697] (-901.871) (-904.640) (-902.114) -- 0:00:15
753000 -- (-902.083) (-905.190) (-904.635) [-902.296] * [-902.083] (-906.988) (-905.200) (-903.230) -- 0:00:15
753500 -- (-906.271) [-903.153] (-905.132) (-902.294) * (-901.880) [-902.150] (-901.916) (-907.058) -- 0:00:15
754000 -- [-902.625] (-908.320) (-904.699) (-903.353) * (-902.725) [-902.265] (-904.818) (-902.840) -- 0:00:15
754500 -- (-903.703) (-903.307) [-904.382] (-906.065) * (-906.791) (-902.969) [-902.438] (-903.362) -- 0:00:15
755000 -- (-903.327) (-904.551) [-902.070] (-902.110) * (-906.481) (-904.111) [-902.885] (-903.484) -- 0:00:15
Average standard deviation of split frequencies: 0.008730
755500 -- (-903.571) [-905.731] (-904.555) (-902.426) * (-903.795) (-901.709) (-906.329) [-903.592] -- 0:00:15
756000 -- (-909.040) [-903.545] (-902.730) (-905.852) * (-903.956) [-902.605] (-904.770) (-907.532) -- 0:00:15
756500 -- (-902.853) (-902.984) [-903.730] (-905.100) * (-903.556) (-902.152) (-902.661) [-902.770] -- 0:00:15
757000 -- (-901.878) (-904.938) (-911.084) [-906.262] * (-903.928) (-902.580) (-902.104) [-908.048] -- 0:00:15
757500 -- [-902.240] (-904.495) (-906.877) (-901.894) * (-902.432) [-903.145] (-904.688) (-907.023) -- 0:00:15
758000 -- (-911.948) [-905.996] (-904.236) (-902.263) * (-903.825) [-906.244] (-903.191) (-903.700) -- 0:00:15
758500 -- (-908.328) (-902.113) [-901.690] (-903.152) * (-903.086) [-903.603] (-903.051) (-903.439) -- 0:00:15
759000 -- (-903.144) (-905.716) [-903.636] (-904.328) * (-906.037) (-903.756) [-907.490] (-904.238) -- 0:00:15
759500 -- (-904.056) [-903.881] (-903.145) (-903.743) * (-903.889) (-903.668) (-902.656) [-903.418] -- 0:00:15
760000 -- [-903.152] (-903.481) (-904.769) (-902.885) * (-903.978) (-905.245) [-904.188] (-906.105) -- 0:00:15
Average standard deviation of split frequencies: 0.008385
760500 -- (-906.378) (-902.426) [-901.313] (-903.988) * [-902.162] (-903.731) (-904.786) (-903.854) -- 0:00:15
761000 -- (-907.748) (-905.078) [-903.311] (-903.085) * [-903.756] (-903.782) (-902.398) (-901.967) -- 0:00:15
761500 -- (-906.118) (-903.222) (-901.716) [-903.517] * (-903.706) (-903.022) [-902.263] (-904.620) -- 0:00:15
762000 -- (-901.636) [-903.305] (-904.649) (-904.076) * (-902.500) [-903.332] (-903.866) (-903.386) -- 0:00:14
762500 -- (-901.493) (-902.855) [-904.078] (-903.777) * (-902.941) (-904.332) (-902.423) [-906.162] -- 0:00:14
763000 -- (-903.500) (-903.263) (-903.184) [-902.525] * (-908.276) [-903.459] (-906.812) (-904.435) -- 0:00:14
763500 -- [-904.710] (-907.225) (-903.154) (-905.696) * (-903.829) (-903.428) (-904.462) [-905.950] -- 0:00:14
764000 -- [-903.754] (-904.563) (-902.242) (-903.693) * [-902.945] (-902.517) (-905.271) (-903.004) -- 0:00:14
764500 -- [-902.793] (-904.422) (-903.471) (-903.500) * [-902.969] (-902.479) (-905.959) (-902.989) -- 0:00:14
765000 -- (-907.632) (-907.300) [-901.809] (-902.933) * [-905.943] (-901.643) (-905.289) (-902.838) -- 0:00:14
Average standard deviation of split frequencies: 0.008435
765500 -- (-902.613) (-905.622) [-901.306] (-901.781) * (-904.646) [-901.527] (-906.934) (-903.107) -- 0:00:14
766000 -- (-904.309) (-903.869) [-904.414] (-903.318) * (-902.872) (-903.169) [-906.370] (-904.000) -- 0:00:14
766500 -- (-905.200) [-902.652] (-905.070) (-903.698) * (-901.450) (-902.934) [-904.633] (-905.905) -- 0:00:14
767000 -- (-905.100) [-901.654] (-914.616) (-904.577) * (-906.214) (-903.644) (-901.672) [-902.854] -- 0:00:14
767500 -- (-905.317) (-902.671) [-904.570] (-905.622) * (-902.130) (-903.640) (-901.631) [-902.540] -- 0:00:14
768000 -- (-909.287) [-905.892] (-904.163) (-903.573) * (-902.395) [-901.889] (-905.654) (-901.386) -- 0:00:14
768500 -- (-904.702) [-902.672] (-901.878) (-908.564) * (-903.708) (-901.744) (-903.596) [-902.504] -- 0:00:14
769000 -- [-910.156] (-903.712) (-905.012) (-903.077) * [-904.900] (-901.621) (-904.089) (-903.024) -- 0:00:14
769500 -- (-902.917) (-901.953) [-905.402] (-905.311) * (-903.070) (-903.838) (-904.252) [-902.028] -- 0:00:14
770000 -- (-905.759) (-902.816) (-904.231) [-904.200] * (-906.507) [-907.204] (-909.272) (-902.891) -- 0:00:14
Average standard deviation of split frequencies: 0.008312
770500 -- [-904.836] (-902.904) (-904.025) (-902.772) * [-906.323] (-903.314) (-904.812) (-904.887) -- 0:00:14
771000 -- (-907.372) (-906.320) [-902.015] (-901.634) * (-906.591) [-903.575] (-904.655) (-909.096) -- 0:00:14
771500 -- [-903.818] (-901.887) (-901.978) (-903.215) * (-904.458) (-903.702) [-908.272] (-908.493) -- 0:00:14
772000 -- (-904.771) [-902.917] (-903.066) (-903.686) * (-906.015) [-904.467] (-905.639) (-904.490) -- 0:00:14
772500 -- (-905.775) (-902.621) (-905.115) [-903.893] * (-905.470) (-907.342) (-908.268) [-901.967] -- 0:00:14
773000 -- (-903.529) (-901.685) (-902.929) [-903.654] * [-904.688] (-906.925) (-904.865) (-903.262) -- 0:00:14
773500 -- (-903.442) [-902.894] (-902.472) (-904.502) * (-903.573) (-901.737) [-901.904] (-902.755) -- 0:00:14
774000 -- (-904.542) (-904.840) [-902.424] (-908.853) * [-902.960] (-905.482) (-901.377) (-905.496) -- 0:00:14
774500 -- (-905.640) [-902.574] (-904.866) (-905.752) * (-901.752) [-902.513] (-901.380) (-903.837) -- 0:00:13
775000 -- (-904.045) (-902.838) [-906.955] (-909.392) * (-901.776) (-903.975) (-903.745) [-910.708] -- 0:00:14
Average standard deviation of split frequencies: 0.008648
775500 -- (-908.149) (-904.540) (-906.025) [-905.215] * (-901.976) (-907.430) [-905.965] (-908.543) -- 0:00:14
776000 -- [-903.392] (-903.790) (-902.535) (-904.437) * (-905.609) (-904.850) [-904.856] (-904.593) -- 0:00:14
776500 -- (-903.661) [-903.358] (-903.269) (-904.630) * (-904.279) (-907.406) [-902.308] (-906.658) -- 0:00:14
777000 -- (-903.203) (-906.431) (-902.819) [-904.342] * (-905.914) (-903.737) (-903.120) [-901.987] -- 0:00:14
777500 -- (-903.496) [-905.637] (-902.830) (-906.272) * (-902.361) [-901.438] (-903.546) (-903.366) -- 0:00:14
778000 -- [-903.440] (-902.039) (-902.603) (-906.106) * (-902.279) (-903.300) (-904.132) [-905.153] -- 0:00:13
778500 -- (-903.669) [-901.962] (-902.220) (-903.986) * (-903.309) [-907.196] (-902.264) (-902.981) -- 0:00:13
779000 -- (-904.595) (-903.679) (-902.884) [-903.859] * (-902.154) [-908.533] (-902.648) (-903.015) -- 0:00:13
779500 -- (-903.734) (-903.630) (-904.783) [-902.433] * [-902.192] (-908.109) (-904.144) (-903.238) -- 0:00:13
780000 -- (-904.045) [-901.946] (-903.049) (-905.511) * (-902.119) (-904.654) [-902.593] (-902.793) -- 0:00:13
Average standard deviation of split frequencies: 0.008703
780500 -- (-903.434) (-903.117) (-901.303) [-905.306] * [-903.788] (-904.395) (-904.513) (-902.830) -- 0:00:13
781000 -- [-902.481] (-904.881) (-904.415) (-905.435) * (-904.285) [-903.785] (-905.796) (-903.913) -- 0:00:13
781500 -- (-903.247) (-903.274) (-902.132) [-904.152] * (-904.882) (-904.515) [-903.080] (-904.085) -- 0:00:13
782000 -- [-902.646] (-903.640) (-901.888) (-903.107) * (-906.811) (-902.073) [-904.462] (-906.446) -- 0:00:13
782500 -- [-901.975] (-901.697) (-901.888) (-905.529) * (-903.284) (-902.424) [-903.546] (-904.639) -- 0:00:13
783000 -- [-901.625] (-902.541) (-902.252) (-903.494) * (-902.059) (-904.066) (-904.470) [-902.490] -- 0:00:13
783500 -- [-903.493] (-901.630) (-904.305) (-907.708) * [-901.483] (-903.581) (-903.415) (-902.371) -- 0:00:13
784000 -- [-902.969] (-903.760) (-904.719) (-902.474) * [-904.613] (-902.454) (-904.725) (-904.252) -- 0:00:13
784500 -- (-903.137) (-902.561) [-902.711] (-908.329) * (-904.488) (-903.745) [-902.974] (-904.816) -- 0:00:13
785000 -- (-902.262) (-904.749) (-902.737) [-903.359] * (-902.037) [-903.950] (-903.160) (-902.712) -- 0:00:13
Average standard deviation of split frequencies: 0.008643
785500 -- [-902.021] (-902.320) (-902.298) (-903.068) * (-902.154) [-902.746] (-902.635) (-903.598) -- 0:00:13
786000 -- (-907.860) [-902.248] (-906.886) (-905.067) * (-903.356) (-905.005) [-901.659] (-906.988) -- 0:00:13
786500 -- [-904.463] (-903.824) (-905.341) (-903.836) * (-907.280) [-904.249] (-904.998) (-903.405) -- 0:00:13
787000 -- (-906.486) (-903.613) [-903.488] (-902.613) * (-904.286) (-902.375) [-903.710] (-905.166) -- 0:00:13
787500 -- (-905.416) (-901.922) (-908.290) [-905.122] * [-905.001] (-904.590) (-903.005) (-905.442) -- 0:00:13
788000 -- [-905.083] (-904.789) (-904.091) (-906.320) * [-905.769] (-903.468) (-902.413) (-904.120) -- 0:00:13
788500 -- (-903.681) (-902.356) (-904.288) [-903.868] * [-905.497] (-903.716) (-902.570) (-902.447) -- 0:00:13
789000 -- (-903.133) (-908.874) [-905.225] (-902.402) * (-904.377) [-903.474] (-903.397) (-904.559) -- 0:00:13
789500 -- (-907.578) (-904.172) (-903.150) [-903.389] * (-901.829) (-901.845) (-904.001) [-904.749] -- 0:00:13
790000 -- (-904.812) (-903.182) [-903.788] (-903.668) * (-904.085) (-903.030) (-904.151) [-903.242] -- 0:00:13
Average standard deviation of split frequencies: 0.008733
790500 -- (-903.875) (-901.909) [-902.890] (-905.162) * (-903.497) (-905.332) [-904.025] (-906.047) -- 0:00:12
791000 -- (-901.399) (-904.836) [-902.536] (-904.541) * [-902.285] (-904.177) (-906.709) (-904.115) -- 0:00:13
791500 -- (-902.153) [-903.004] (-904.472) (-905.458) * (-908.052) (-905.349) (-907.930) [-906.428] -- 0:00:13
792000 -- (-903.478) [-902.491] (-902.067) (-907.939) * (-907.018) (-904.401) (-903.476) [-902.783] -- 0:00:13
792500 -- [-904.426] (-905.084) (-908.599) (-905.416) * (-906.196) [-902.209] (-905.692) (-907.401) -- 0:00:13
793000 -- (-903.672) [-904.616] (-904.627) (-902.217) * (-902.739) (-901.764) [-904.991] (-907.315) -- 0:00:13
793500 -- (-906.187) (-901.935) [-904.025] (-903.517) * (-902.149) (-903.004) [-903.562] (-906.182) -- 0:00:13
794000 -- [-901.961] (-904.729) (-904.931) (-903.423) * [-907.413] (-902.210) (-904.935) (-906.213) -- 0:00:12
794500 -- (-905.305) [-902.807] (-903.627) (-902.944) * (-905.287) (-902.404) (-904.148) [-907.722] -- 0:00:12
795000 -- [-902.493] (-903.390) (-905.116) (-906.491) * [-903.529] (-906.083) (-908.288) (-903.664) -- 0:00:12
Average standard deviation of split frequencies: 0.008291
795500 -- (-901.782) (-909.040) [-902.168] (-905.258) * (-902.939) (-903.542) [-902.201] (-904.286) -- 0:00:12
796000 -- [-903.007] (-903.621) (-904.266) (-906.249) * [-903.694] (-901.430) (-902.194) (-903.798) -- 0:00:12
796500 -- (-903.021) (-902.654) [-904.826] (-905.133) * (-901.338) (-902.145) [-901.923] (-903.414) -- 0:00:12
797000 -- (-903.174) (-910.896) (-904.073) [-906.322] * (-904.757) (-903.789) [-901.821] (-907.209) -- 0:00:12
797500 -- (-902.562) [-903.360] (-904.385) (-910.045) * (-904.420) (-904.197) (-908.930) [-904.354] -- 0:00:12
798000 -- [-903.219] (-902.742) (-905.768) (-902.171) * (-904.159) [-909.271] (-906.917) (-904.863) -- 0:00:12
798500 -- (-902.895) (-902.376) (-906.275) [-903.341] * (-903.919) (-907.025) [-903.632] (-905.102) -- 0:00:12
799000 -- [-902.845] (-904.119) (-905.020) (-902.835) * (-904.299) (-903.228) (-902.594) [-903.550] -- 0:00:12
799500 -- (-904.165) [-902.454] (-901.264) (-902.287) * (-906.321) (-904.678) (-902.595) [-903.349] -- 0:00:12
800000 -- (-904.758) (-902.298) [-904.647] (-902.210) * [-903.160] (-902.109) (-903.579) (-903.054) -- 0:00:12
Average standard deviation of split frequencies: 0.008070
800500 -- [-905.604] (-904.115) (-905.777) (-905.283) * (-909.211) (-905.279) (-902.032) [-903.238] -- 0:00:12
801000 -- (-903.296) (-904.394) [-903.313] (-903.889) * (-903.371) (-903.243) [-903.150] (-904.515) -- 0:00:12
801500 -- (-901.776) [-904.531] (-903.441) (-905.167) * (-902.468) [-903.598] (-904.403) (-903.654) -- 0:00:12
802000 -- [-906.172] (-907.882) (-902.916) (-905.964) * (-902.126) [-908.617] (-904.605) (-902.707) -- 0:00:12
802500 -- (-910.419) (-906.820) (-903.996) [-902.610] * (-902.533) (-902.914) [-903.284] (-903.454) -- 0:00:12
803000 -- (-902.061) (-905.352) [-901.957] (-907.279) * (-903.148) [-902.878] (-903.984) (-903.240) -- 0:00:12
803500 -- [-903.776] (-904.965) (-901.979) (-905.011) * (-903.047) (-904.552) (-907.183) [-904.211] -- 0:00:12
804000 -- (-901.845) (-904.332) [-904.192] (-904.572) * (-904.009) (-903.129) [-909.468] (-902.644) -- 0:00:12
804500 -- (-908.886) (-903.205) [-903.868] (-905.249) * (-902.189) (-902.356) [-904.145] (-902.704) -- 0:00:12
805000 -- [-906.712] (-903.595) (-908.882) (-909.648) * (-904.030) (-904.790) (-906.914) [-903.852] -- 0:00:12
Average standard deviation of split frequencies: 0.008546
805500 -- (-907.853) [-902.131] (-903.322) (-911.115) * (-905.212) (-904.687) [-904.463] (-903.483) -- 0:00:12
806000 -- (-906.871) (-901.780) [-902.141] (-906.250) * (-906.844) (-902.233) (-903.913) [-901.956] -- 0:00:12
806500 -- (-905.722) [-902.746] (-903.173) (-902.319) * (-902.386) [-902.300] (-903.607) (-902.094) -- 0:00:12
807000 -- (-902.630) [-902.948] (-903.904) (-903.533) * (-902.201) (-902.582) (-903.598) [-902.116] -- 0:00:12
807500 -- (-902.792) (-903.268) [-903.393] (-905.031) * (-903.080) [-905.665] (-906.612) (-903.107) -- 0:00:12
808000 -- (-903.066) (-901.842) (-907.130) [-903.248] * (-904.323) (-903.354) [-902.922] (-903.994) -- 0:00:12
808500 -- (-903.325) (-903.404) (-907.354) [-901.961] * (-903.057) (-903.876) (-902.848) [-902.971] -- 0:00:12
809000 -- (-903.181) [-902.638] (-907.586) (-901.804) * [-901.885] (-903.436) (-905.156) (-903.860) -- 0:00:12
809500 -- (-908.266) (-910.910) (-903.723) [-902.584] * (-904.064) (-903.279) [-902.965] (-901.808) -- 0:00:12
810000 -- (-902.642) (-903.092) (-904.313) [-902.272] * (-906.267) [-901.930] (-903.091) (-901.943) -- 0:00:11
Average standard deviation of split frequencies: 0.008561
810500 -- [-902.686] (-908.145) (-901.641) (-904.929) * (-902.086) [-902.485] (-902.711) (-903.432) -- 0:00:11
811000 -- [-901.726] (-905.193) (-903.712) (-906.014) * (-902.184) (-902.861) [-902.967] (-902.355) -- 0:00:11
811500 -- (-902.915) [-902.543] (-906.265) (-904.270) * (-905.000) (-904.287) (-903.154) [-902.059] -- 0:00:11
812000 -- (-902.488) [-903.167] (-905.573) (-903.941) * [-905.500] (-906.862) (-902.028) (-901.854) -- 0:00:11
812500 -- (-907.890) [-902.580] (-903.393) (-903.781) * (-904.701) (-902.474) (-903.462) [-902.349] -- 0:00:11
813000 -- (-905.292) [-903.123] (-902.551) (-908.436) * (-905.866) (-905.132) (-904.246) [-904.447] -- 0:00:11
813500 -- [-904.062] (-904.183) (-902.470) (-905.334) * (-905.677) (-902.088) [-904.274] (-910.435) -- 0:00:11
814000 -- [-904.196] (-902.574) (-903.254) (-903.906) * [-904.533] (-901.910) (-905.066) (-904.593) -- 0:00:11
814500 -- (-903.740) (-902.328) [-903.120] (-903.767) * (-901.653) (-903.809) (-902.490) [-903.165] -- 0:00:11
815000 -- [-903.653] (-903.789) (-905.049) (-902.496) * (-905.834) [-904.716] (-909.562) (-901.509) -- 0:00:11
Average standard deviation of split frequencies: 0.008462
815500 -- (-904.018) (-904.235) [-908.978] (-903.032) * (-908.282) (-905.769) (-905.474) [-901.437] -- 0:00:11
816000 -- (-903.101) (-905.301) (-901.948) [-903.243] * (-905.554) (-905.429) (-902.788) [-902.228] -- 0:00:11
816500 -- [-904.465] (-903.214) (-903.191) (-903.749) * (-905.308) (-904.398) [-901.606] (-903.549) -- 0:00:11
817000 -- (-901.629) [-904.282] (-904.629) (-903.788) * (-904.814) (-903.694) (-901.833) [-905.280] -- 0:00:11
817500 -- [-901.682] (-908.380) (-902.585) (-903.389) * (-902.405) (-905.276) (-902.141) [-903.243] -- 0:00:11
818000 -- [-901.413] (-907.134) (-901.629) (-904.632) * [-903.733] (-906.531) (-906.962) (-905.765) -- 0:00:11
818500 -- (-904.913) (-907.072) [-901.479] (-905.652) * (-902.605) (-903.007) [-905.342] (-903.337) -- 0:00:11
819000 -- (-902.282) [-902.884] (-903.285) (-905.241) * (-902.484) [-905.156] (-905.486) (-902.913) -- 0:00:11
819500 -- [-903.475] (-902.372) (-903.440) (-905.459) * (-905.313) (-902.198) [-904.505] (-902.807) -- 0:00:11
820000 -- [-903.010] (-904.521) (-902.839) (-905.137) * [-903.415] (-903.622) (-905.403) (-902.333) -- 0:00:11
Average standard deviation of split frequencies: 0.008380
820500 -- (-902.197) (-904.188) [-901.765] (-905.781) * [-904.539] (-904.052) (-904.500) (-906.253) -- 0:00:11
821000 -- [-904.149] (-905.741) (-901.542) (-903.179) * (-902.758) [-902.790] (-908.383) (-903.851) -- 0:00:11
821500 -- (-902.518) (-901.830) [-902.756] (-904.662) * (-902.032) [-901.992] (-912.370) (-901.620) -- 0:00:11
822000 -- (-904.182) (-902.309) [-902.410] (-904.638) * (-903.037) [-901.716] (-904.335) (-903.055) -- 0:00:11
822500 -- [-904.206] (-903.077) (-902.966) (-904.046) * (-903.150) [-903.768] (-905.516) (-904.731) -- 0:00:11
823000 -- (-901.933) (-903.296) (-902.480) [-903.223] * [-901.832] (-906.601) (-903.153) (-911.504) -- 0:00:11
823500 -- (-901.833) (-905.877) (-902.730) [-902.444] * (-901.926) (-904.864) (-903.276) [-903.769] -- 0:00:11
824000 -- (-902.850) (-904.903) (-902.758) [-902.042] * (-903.014) (-905.477) (-903.122) [-902.032] -- 0:00:11
824500 -- (-905.828) (-907.816) (-903.829) [-903.730] * (-901.781) (-905.457) (-904.696) [-902.535] -- 0:00:11
825000 -- (-903.742) [-902.652] (-902.687) (-909.564) * (-904.149) (-902.783) (-903.189) [-902.247] -- 0:00:11
Average standard deviation of split frequencies: 0.008592
825500 -- (-902.406) [-903.269] (-905.103) (-906.997) * [-901.615] (-902.499) (-904.131) (-904.715) -- 0:00:10
826000 -- (-905.032) (-902.614) (-902.818) [-908.505] * (-901.950) (-905.489) (-902.693) [-902.546] -- 0:00:10
826500 -- [-903.608] (-902.845) (-904.048) (-906.691) * (-903.336) [-903.390] (-902.843) (-903.555) -- 0:00:10
827000 -- (-904.495) (-903.119) [-905.604] (-905.579) * [-901.661] (-903.052) (-902.063) (-903.790) -- 0:00:10
827500 -- [-902.618] (-903.223) (-902.550) (-905.762) * (-903.129) [-904.647] (-906.308) (-905.183) -- 0:00:10
828000 -- (-902.448) [-904.349] (-905.669) (-904.220) * (-902.819) (-901.609) (-906.191) [-903.086] -- 0:00:10
828500 -- [-902.063] (-903.489) (-910.262) (-904.556) * (-901.353) [-903.308] (-907.535) (-903.743) -- 0:00:10
829000 -- (-905.611) (-903.482) (-904.506) [-903.582] * (-902.797) (-904.605) (-909.870) [-902.123] -- 0:00:10
829500 -- [-902.553] (-904.896) (-902.125) (-903.277) * [-902.924] (-903.667) (-902.774) (-905.030) -- 0:00:10
830000 -- (-902.475) (-904.100) [-903.063] (-902.375) * (-903.973) [-902.358] (-901.680) (-905.836) -- 0:00:10
Average standard deviation of split frequencies: 0.008922
830500 -- [-902.992] (-905.912) (-906.117) (-906.410) * (-903.972) (-902.460) (-901.365) [-910.380] -- 0:00:10
831000 -- [-903.104] (-902.308) (-907.349) (-904.786) * (-903.616) [-903.675] (-904.707) (-903.797) -- 0:00:10
831500 -- (-903.817) [-902.203] (-902.907) (-903.637) * (-903.577) (-907.807) [-903.178] (-902.462) -- 0:00:10
832000 -- (-904.275) [-903.146] (-903.640) (-903.051) * (-906.385) [-905.577] (-903.086) (-902.039) -- 0:00:10
832500 -- [-902.615] (-902.991) (-906.508) (-902.703) * (-905.326) (-906.116) (-904.412) [-903.710] -- 0:00:10
833000 -- (-904.271) (-905.169) [-902.924] (-903.914) * [-902.603] (-905.529) (-901.805) (-906.447) -- 0:00:10
833500 -- (-904.848) (-903.959) [-906.827] (-904.368) * (-901.562) [-907.685] (-901.745) (-903.326) -- 0:00:10
834000 -- (-903.306) (-902.082) (-901.836) [-902.794] * [-902.941] (-902.968) (-909.998) (-907.236) -- 0:00:10
834500 -- [-905.057] (-902.595) (-901.918) (-901.484) * (-903.749) (-903.247) (-902.582) [-905.619] -- 0:00:10
835000 -- [-903.846] (-901.732) (-905.199) (-902.393) * (-903.707) (-904.233) [-904.230] (-905.328) -- 0:00:10
Average standard deviation of split frequencies: 0.008127
835500 -- [-901.676] (-902.598) (-904.774) (-906.879) * (-906.927) [-902.642] (-905.617) (-904.551) -- 0:00:10
836000 -- (-903.785) [-901.961] (-903.482) (-905.430) * (-902.126) (-901.454) [-902.774] (-903.502) -- 0:00:10
836500 -- [-904.097] (-905.047) (-908.068) (-902.753) * [-903.229] (-902.243) (-902.068) (-904.065) -- 0:00:10
837000 -- (-903.554) (-903.751) (-906.378) [-903.484] * [-905.072] (-907.572) (-903.732) (-905.329) -- 0:00:10
837500 -- [-903.864] (-907.757) (-906.779) (-902.500) * (-901.821) (-907.291) [-902.781] (-903.191) -- 0:00:10
838000 -- (-905.727) (-906.064) (-904.143) [-902.258] * (-902.068) (-902.520) [-905.025] (-903.488) -- 0:00:10
838500 -- [-903.845] (-910.134) (-903.212) (-903.819) * (-902.021) [-903.046] (-908.376) (-901.429) -- 0:00:10
839000 -- (-906.496) (-904.253) [-904.748] (-904.103) * [-903.306] (-902.289) (-912.303) (-904.185) -- 0:00:09
839500 -- (-901.845) [-905.450] (-903.310) (-903.618) * [-902.864] (-902.183) (-906.007) (-906.635) -- 0:00:10
840000 -- (-904.068) [-902.014] (-904.640) (-902.286) * (-903.919) [-902.613] (-908.770) (-902.306) -- 0:00:10
Average standard deviation of split frequencies: 0.007752
840500 -- (-902.393) (-906.985) (-902.892) [-901.425] * [-904.910] (-903.162) (-909.384) (-903.840) -- 0:00:10
841000 -- (-905.635) (-902.839) (-904.023) [-903.989] * (-904.294) (-903.085) [-903.276] (-904.894) -- 0:00:10
841500 -- [-903.061] (-905.274) (-911.405) (-904.509) * (-903.346) (-903.762) [-905.070] (-905.483) -- 0:00:09
842000 -- (-903.996) (-905.811) (-904.424) [-904.373] * [-903.578] (-906.144) (-905.315) (-905.263) -- 0:00:09
842500 -- (-903.029) (-902.370) [-903.861] (-903.890) * (-902.772) [-904.452] (-902.574) (-905.563) -- 0:00:09
843000 -- (-901.744) [-904.728] (-902.641) (-905.979) * (-901.972) [-902.408] (-907.397) (-904.321) -- 0:00:09
843500 -- (-905.624) [-902.768] (-902.555) (-902.916) * [-903.703] (-903.907) (-905.733) (-902.980) -- 0:00:09
844000 -- [-906.962] (-904.622) (-902.424) (-901.667) * (-906.005) (-904.840) [-903.666] (-903.467) -- 0:00:09
844500 -- (-903.003) (-902.957) [-902.399] (-906.033) * (-904.317) [-902.537] (-903.384) (-903.077) -- 0:00:09
845000 -- (-903.870) [-903.867] (-901.991) (-906.028) * [-902.514] (-903.202) (-905.515) (-904.551) -- 0:00:09
Average standard deviation of split frequencies: 0.008030
845500 -- (-901.441) (-906.868) [-901.932] (-908.476) * (-906.597) (-905.782) [-902.544] (-903.286) -- 0:00:09
846000 -- [-903.234] (-904.720) (-903.235) (-907.075) * (-902.047) (-906.823) (-907.759) [-902.364] -- 0:00:09
846500 -- (-902.391) [-903.123] (-901.928) (-907.461) * (-903.353) (-903.236) [-904.035] (-907.241) -- 0:00:09
847000 -- (-902.780) (-902.945) [-901.842] (-904.058) * (-903.947) (-903.746) [-903.264] (-905.721) -- 0:00:09
847500 -- [-905.203] (-902.838) (-903.289) (-905.668) * (-903.235) [-902.281] (-902.767) (-903.735) -- 0:00:09
848000 -- (-902.779) (-902.591) [-904.077] (-903.738) * [-902.639] (-905.505) (-903.620) (-906.223) -- 0:00:09
848500 -- [-903.087] (-902.185) (-905.022) (-908.846) * (-903.404) [-902.439] (-903.868) (-904.052) -- 0:00:09
849000 -- (-903.856) (-903.696) (-904.815) [-903.644] * (-904.656) [-903.949] (-904.714) (-903.031) -- 0:00:09
849500 -- [-905.655] (-902.082) (-905.182) (-902.939) * (-902.357) (-913.365) (-904.607) [-906.890] -- 0:00:09
850000 -- [-904.398] (-903.034) (-902.928) (-902.746) * (-903.700) [-906.088] (-906.107) (-905.956) -- 0:00:09
Average standard deviation of split frequencies: 0.008620
850500 -- (-904.280) (-905.517) (-907.619) [-903.073] * (-905.474) (-904.877) (-901.972) [-902.998] -- 0:00:09
851000 -- (-904.751) [-903.068] (-904.818) (-903.734) * (-910.747) (-905.824) (-906.369) [-901.668] -- 0:00:09
851500 -- (-902.579) (-901.873) [-904.413] (-902.858) * (-903.690) (-904.810) (-901.703) [-905.784] -- 0:00:09
852000 -- (-908.661) [-902.984] (-904.609) (-903.442) * [-903.423] (-902.808) (-902.114) (-906.216) -- 0:00:09
852500 -- (-908.337) [-903.049] (-902.139) (-902.845) * [-903.470] (-901.879) (-902.330) (-906.359) -- 0:00:09
853000 -- [-903.970] (-904.352) (-902.058) (-902.923) * (-902.650) [-903.087] (-901.767) (-908.353) -- 0:00:09
853500 -- (-904.171) (-903.779) [-903.121] (-902.494) * (-906.212) [-905.426] (-902.358) (-905.774) -- 0:00:09
854000 -- (-903.210) (-903.408) (-903.761) [-902.267] * (-903.984) (-903.369) (-904.210) [-904.688] -- 0:00:09
854500 -- (-904.614) (-903.201) (-902.595) [-902.272] * (-904.672) [-903.102] (-902.891) (-904.512) -- 0:00:09
855000 -- (-902.081) [-903.209] (-903.358) (-904.474) * (-902.052) [-901.730] (-902.755) (-906.069) -- 0:00:08
Average standard deviation of split frequencies: 0.008444
855500 -- (-905.483) [-903.049] (-902.980) (-904.396) * (-904.746) [-902.152] (-902.990) (-904.573) -- 0:00:08
856000 -- (-905.145) (-903.791) [-903.263] (-904.283) * (-905.651) [-903.581] (-903.043) (-902.244) -- 0:00:09
856500 -- (-902.403) [-902.455] (-902.474) (-902.286) * (-905.332) (-903.014) [-901.469] (-905.671) -- 0:00:09
857000 -- [-904.010] (-903.132) (-903.510) (-903.309) * (-901.898) (-907.117) (-905.303) [-903.956] -- 0:00:09
857500 -- (-903.681) (-902.604) (-904.380) [-905.230] * (-902.031) (-905.493) (-902.951) [-907.685] -- 0:00:08
858000 -- (-906.232) [-902.811] (-904.171) (-901.970) * [-901.997] (-904.653) (-904.272) (-904.691) -- 0:00:08
858500 -- (-907.271) (-904.020) (-902.933) [-901.758] * (-907.139) (-903.869) (-904.438) [-904.951] -- 0:00:08
859000 -- (-903.240) (-902.456) [-903.334] (-906.026) * (-902.548) (-905.095) [-902.286] (-904.654) -- 0:00:08
859500 -- (-904.415) (-902.765) (-904.589) [-902.366] * (-903.836) (-902.366) (-903.376) [-903.299] -- 0:00:08
860000 -- [-904.502] (-902.427) (-905.082) (-902.863) * [-905.800] (-902.298) (-902.447) (-901.757) -- 0:00:08
Average standard deviation of split frequencies: 0.007873
860500 -- [-901.826] (-904.605) (-901.643) (-902.208) * (-904.346) (-904.416) (-906.732) [-901.789] -- 0:00:08
861000 -- (-904.607) [-902.579] (-902.675) (-902.865) * (-905.019) (-904.312) (-907.847) [-903.544] -- 0:00:08
861500 -- (-906.433) (-901.948) (-903.993) [-904.004] * [-903.742] (-902.609) (-903.199) (-903.603) -- 0:00:08
862000 -- (-910.662) [-902.631] (-904.059) (-905.967) * (-902.790) (-902.731) [-902.845] (-903.448) -- 0:00:08
862500 -- (-911.298) (-904.722) (-902.563) [-905.021] * (-904.129) (-905.502) [-905.508] (-905.758) -- 0:00:08
863000 -- (-904.335) (-904.513) (-902.618) [-903.007] * [-902.530] (-904.742) (-903.893) (-903.275) -- 0:00:08
863500 -- (-907.576) (-904.015) [-902.289] (-903.393) * (-902.660) [-904.724] (-906.516) (-906.143) -- 0:00:08
864000 -- (-903.074) (-906.579) (-904.868) [-905.577] * (-901.832) (-904.275) (-904.780) [-905.353] -- 0:00:08
864500 -- (-903.528) (-904.210) [-901.756] (-903.295) * (-905.427) (-903.520) [-903.285] (-903.134) -- 0:00:08
865000 -- [-904.354] (-907.462) (-904.279) (-902.527) * [-904.867] (-902.950) (-905.200) (-903.624) -- 0:00:08
Average standard deviation of split frequencies: 0.008301
865500 -- [-904.313] (-902.670) (-904.304) (-905.285) * (-904.541) (-902.200) (-906.021) [-902.785] -- 0:00:08
866000 -- (-901.676) (-905.037) [-903.903] (-904.057) * (-903.119) (-902.434) (-908.431) [-904.549] -- 0:00:08
866500 -- (-901.674) [-904.289] (-905.464) (-902.940) * [-903.005] (-906.020) (-905.424) (-902.277) -- 0:00:08
867000 -- (-903.880) [-902.008] (-903.643) (-903.990) * [-903.522] (-902.673) (-906.324) (-901.496) -- 0:00:08
867500 -- (-904.697) [-901.516] (-903.701) (-903.835) * (-906.329) [-902.242] (-902.649) (-902.024) -- 0:00:08
868000 -- [-901.431] (-906.113) (-902.721) (-906.652) * (-902.613) [-904.353] (-903.280) (-906.079) -- 0:00:08
868500 -- (-901.456) (-909.178) (-902.074) [-901.634] * [-903.885] (-905.740) (-907.883) (-903.570) -- 0:00:08
869000 -- (-902.988) (-906.970) (-902.477) [-902.863] * (-902.164) [-903.820] (-903.889) (-903.519) -- 0:00:08
869500 -- (-902.916) (-904.489) (-903.514) [-902.544] * [-902.333] (-904.097) (-902.983) (-905.418) -- 0:00:08
870000 -- (-901.964) (-902.151) (-902.481) [-904.619] * (-905.839) (-904.219) (-902.200) [-903.336] -- 0:00:08
Average standard deviation of split frequencies: 0.008567
870500 -- (-906.469) (-904.718) [-901.654] (-906.927) * (-903.445) (-905.416) (-905.172) [-907.100] -- 0:00:08
871000 -- (-904.012) (-903.922) (-901.913) [-905.225] * [-904.176] (-904.211) (-904.385) (-905.201) -- 0:00:07
871500 -- (-902.813) (-902.408) (-902.508) [-903.441] * [-904.212] (-905.479) (-902.572) (-903.729) -- 0:00:07
872000 -- (-904.030) (-903.358) [-902.952] (-902.989) * [-906.609] (-903.130) (-903.946) (-903.714) -- 0:00:07
872500 -- (-903.095) (-902.758) [-903.534] (-903.507) * (-904.817) (-903.345) [-905.163] (-910.313) -- 0:00:08
873000 -- (-902.371) (-903.472) (-908.091) [-902.524] * (-905.752) (-903.349) [-907.156] (-908.310) -- 0:00:08
873500 -- (-902.926) [-903.484] (-904.633) (-903.311) * [-901.988] (-902.206) (-907.687) (-902.938) -- 0:00:07
874000 -- [-903.718] (-904.260) (-904.410) (-902.788) * (-901.673) (-903.109) (-905.885) [-904.565] -- 0:00:07
874500 -- [-903.918] (-901.952) (-902.212) (-901.445) * (-902.983) (-904.496) (-911.412) [-903.531] -- 0:00:07
875000 -- (-901.861) (-902.149) (-904.021) [-901.351] * [-901.854] (-902.792) (-906.022) (-904.913) -- 0:00:07
Average standard deviation of split frequencies: 0.008642
875500 -- (-901.344) [-903.316] (-902.669) (-904.227) * [-904.348] (-901.850) (-910.418) (-902.515) -- 0:00:07
876000 -- [-901.392] (-904.619) (-904.328) (-902.279) * (-904.598) (-904.228) [-903.481] (-901.763) -- 0:00:07
876500 -- (-903.124) (-903.569) [-904.769] (-905.063) * (-904.747) [-902.559] (-902.726) (-903.938) -- 0:00:07
877000 -- (-904.505) [-904.029] (-904.240) (-904.657) * [-906.638] (-901.842) (-905.270) (-901.899) -- 0:00:07
877500 -- [-901.908] (-902.519) (-902.572) (-907.461) * [-903.249] (-901.826) (-903.070) (-905.070) -- 0:00:07
878000 -- (-901.406) (-904.291) [-902.344] (-904.379) * [-904.962] (-904.287) (-902.244) (-904.060) -- 0:00:07
878500 -- (-905.453) [-905.556] (-903.377) (-904.571) * (-905.289) (-902.372) (-904.373) [-901.907] -- 0:00:07
879000 -- [-903.406] (-902.577) (-903.907) (-901.471) * [-902.941] (-901.504) (-903.069) (-905.584) -- 0:00:07
879500 -- (-903.350) [-903.020] (-904.220) (-901.830) * (-901.649) (-905.637) [-903.463] (-906.037) -- 0:00:07
880000 -- (-903.531) (-906.040) (-902.466) [-902.253] * (-901.775) (-906.966) (-904.169) [-902.350] -- 0:00:07
Average standard deviation of split frequencies: 0.008753
880500 -- [-904.252] (-904.287) (-902.420) (-906.028) * (-902.186) (-903.819) [-902.454] (-903.064) -- 0:00:07
881000 -- (-904.989) [-903.868] (-904.121) (-904.284) * (-905.110) [-903.263] (-903.744) (-903.926) -- 0:00:07
881500 -- (-902.993) (-903.798) [-903.020] (-907.555) * [-902.544] (-908.144) (-901.406) (-903.881) -- 0:00:07
882000 -- [-902.937] (-905.953) (-903.706) (-904.023) * (-903.987) (-905.962) (-903.412) [-902.236] -- 0:00:07
882500 -- [-907.347] (-901.697) (-904.323) (-901.747) * [-903.626] (-901.444) (-906.294) (-901.706) -- 0:00:07
883000 -- [-905.088] (-905.402) (-903.841) (-904.225) * (-901.817) (-906.994) [-903.496] (-904.246) -- 0:00:07
883500 -- (-906.460) (-903.550) (-901.213) [-903.365] * (-903.420) (-902.604) [-903.335] (-907.153) -- 0:00:07
884000 -- (-910.001) [-901.780] (-903.374) (-902.617) * [-903.094] (-903.462) (-903.391) (-905.295) -- 0:00:07
884500 -- (-903.809) [-902.778] (-904.308) (-907.659) * (-902.587) (-905.394) (-903.091) [-901.842] -- 0:00:07
885000 -- (-903.492) (-905.896) [-904.419] (-906.101) * (-902.201) (-903.980) (-901.923) [-903.365] -- 0:00:07
Average standard deviation of split frequencies: 0.008607
885500 -- (-902.037) (-902.502) (-905.455) [-902.496] * (-904.969) [-904.315] (-902.750) (-908.787) -- 0:00:07
886000 -- [-901.667] (-903.399) (-903.023) (-906.879) * (-903.707) (-901.981) [-906.238] (-908.277) -- 0:00:07
886500 -- (-902.295) (-903.015) [-903.323] (-904.880) * (-904.716) [-905.312] (-904.975) (-907.386) -- 0:00:07
887000 -- [-901.479] (-912.559) (-905.282) (-904.597) * (-903.652) (-905.528) [-904.254] (-905.226) -- 0:00:07
887500 -- [-901.989] (-907.183) (-903.101) (-905.319) * (-903.515) [-903.349] (-904.443) (-901.754) -- 0:00:06
888000 -- (-903.839) [-902.211] (-901.927) (-905.706) * (-902.033) (-903.725) [-907.172] (-903.260) -- 0:00:06
888500 -- (-901.924) (-902.956) [-903.725] (-906.700) * (-905.462) (-905.618) (-904.262) [-905.225] -- 0:00:06
889000 -- (-902.602) (-902.717) [-901.854] (-902.852) * (-904.794) (-906.138) (-907.320) [-905.437] -- 0:00:06
889500 -- [-904.544] (-904.655) (-902.025) (-901.797) * [-903.678] (-903.558) (-914.115) (-904.558) -- 0:00:06
890000 -- (-901.824) [-903.702] (-902.153) (-903.212) * (-902.883) [-904.045] (-905.855) (-903.232) -- 0:00:06
Average standard deviation of split frequencies: 0.008531
890500 -- (-902.241) (-905.451) [-903.212] (-903.775) * [-903.417] (-905.305) (-904.896) (-902.851) -- 0:00:06
891000 -- (-903.783) [-902.926] (-903.572) (-905.394) * [-904.167] (-906.839) (-901.878) (-903.868) -- 0:00:06
891500 -- [-903.383] (-904.901) (-902.829) (-901.764) * (-904.385) (-901.866) (-901.694) [-906.793] -- 0:00:06
892000 -- (-904.086) (-905.289) (-903.779) [-902.948] * (-903.174) (-904.066) [-903.430] (-906.175) -- 0:00:06
892500 -- (-906.494) (-905.736) (-904.595) [-902.487] * (-903.007) (-902.894) (-906.684) [-905.821] -- 0:00:06
893000 -- [-903.765] (-901.795) (-904.594) (-906.381) * (-903.622) [-902.810] (-905.320) (-903.995) -- 0:00:06
893500 -- (-905.093) [-901.520] (-905.843) (-902.809) * [-903.156] (-902.120) (-903.682) (-904.484) -- 0:00:06
894000 -- [-906.231] (-903.277) (-906.631) (-904.060) * [-902.763] (-904.605) (-902.623) (-904.977) -- 0:00:06
894500 -- [-906.794] (-905.038) (-904.257) (-902.807) * (-903.758) [-902.472] (-903.201) (-904.699) -- 0:00:06
895000 -- (-911.690) (-906.215) (-902.265) [-904.204] * (-903.819) [-902.421] (-903.509) (-904.920) -- 0:00:06
Average standard deviation of split frequencies: 0.008696
895500 -- (-902.813) (-904.240) (-902.611) [-902.176] * [-901.651] (-905.305) (-909.573) (-902.914) -- 0:00:06
896000 -- (-904.288) [-903.291] (-903.045) (-903.320) * (-901.871) [-905.527] (-905.643) (-902.284) -- 0:00:06
896500 -- (-901.953) (-902.265) [-902.746] (-902.966) * (-903.225) (-904.498) [-905.829] (-901.875) -- 0:00:06
897000 -- (-901.760) (-902.069) [-905.449] (-902.202) * (-903.902) [-903.378] (-907.696) (-903.357) -- 0:00:06
897500 -- (-901.742) [-902.987] (-903.564) (-902.422) * (-905.310) (-903.506) [-906.762] (-907.164) -- 0:00:06
898000 -- (-904.158) (-903.340) (-902.557) [-902.263] * (-903.506) [-906.211] (-904.380) (-902.744) -- 0:00:06
898500 -- (-901.584) (-901.982) (-903.344) [-903.369] * (-906.334) (-903.805) [-905.759] (-905.252) -- 0:00:06
899000 -- (-904.299) [-902.917] (-903.962) (-904.909) * (-907.207) [-903.344] (-905.559) (-902.046) -- 0:00:06
899500 -- (-903.344) [-902.902] (-905.854) (-902.745) * (-903.269) [-902.800] (-902.815) (-903.861) -- 0:00:06
900000 -- (-903.306) (-905.140) [-901.922] (-901.960) * (-902.564) (-902.015) (-902.055) [-903.647] -- 0:00:06
Average standard deviation of split frequencies: 0.009175
900500 -- [-902.323] (-903.204) (-906.495) (-904.519) * (-906.282) (-905.272) [-903.448] (-902.841) -- 0:00:06
901000 -- [-903.156] (-905.249) (-902.883) (-902.896) * [-905.765] (-902.624) (-902.661) (-906.063) -- 0:00:06
901500 -- (-903.149) (-904.768) [-905.916] (-901.994) * (-902.234) [-904.242] (-905.180) (-902.541) -- 0:00:06
902000 -- (-902.158) [-902.382] (-912.553) (-901.545) * [-901.946] (-904.952) (-902.615) (-902.288) -- 0:00:06
902500 -- (-903.870) (-905.053) (-903.368) [-902.007] * (-901.768) (-903.340) [-903.084] (-902.238) -- 0:00:06
903000 -- (-901.452) [-902.366] (-904.160) (-901.946) * (-903.909) (-907.536) [-902.039] (-901.809) -- 0:00:06
903500 -- (-904.361) (-908.066) (-904.458) [-902.131] * (-905.633) (-905.146) (-902.415) [-905.919] -- 0:00:05
904000 -- (-904.528) (-905.140) (-902.764) [-904.884] * (-903.368) (-901.662) [-902.236] (-902.471) -- 0:00:05
904500 -- (-902.961) (-903.319) [-902.764] (-906.322) * [-906.047] (-901.629) (-905.909) (-905.523) -- 0:00:05
905000 -- (-901.706) [-903.070] (-903.931) (-905.188) * (-904.599) (-903.153) [-903.438] (-904.965) -- 0:00:05
Average standard deviation of split frequencies: 0.009741
905500 -- (-903.097) (-902.993) [-902.833] (-903.470) * [-903.442] (-905.304) (-907.458) (-902.625) -- 0:00:05
906000 -- (-904.983) (-903.887) (-903.125) [-902.179] * [-905.707] (-904.557) (-902.798) (-908.149) -- 0:00:05
906500 -- (-906.543) (-906.045) [-903.366] (-904.551) * (-904.953) [-903.785] (-903.494) (-901.740) -- 0:00:05
907000 -- (-904.073) (-908.161) [-902.768] (-901.904) * (-904.981) [-904.647] (-903.804) (-902.002) -- 0:00:05
907500 -- (-903.100) [-903.890] (-902.528) (-902.997) * (-903.551) [-907.053] (-914.612) (-904.209) -- 0:00:05
908000 -- (-903.752) (-906.902) [-903.636] (-903.315) * [-901.575] (-901.862) (-906.219) (-903.977) -- 0:00:05
908500 -- (-902.159) (-901.823) (-904.374) [-903.220] * (-902.081) (-904.879) (-902.368) [-904.711] -- 0:00:05
909000 -- (-903.615) [-904.304] (-903.072) (-901.784) * [-902.121] (-903.768) (-903.809) (-901.621) -- 0:00:05
909500 -- [-902.041] (-907.349) (-904.833) (-903.448) * (-904.834) (-902.520) (-904.161) [-901.577] -- 0:00:05
910000 -- (-902.097) (-903.520) [-903.464] (-905.160) * (-904.617) [-902.176] (-901.961) (-902.990) -- 0:00:05
Average standard deviation of split frequencies: 0.009231
910500 -- (-903.698) (-903.342) [-902.956] (-903.092) * [-902.584] (-908.313) (-915.060) (-903.222) -- 0:00:05
911000 -- (-902.270) (-904.794) [-902.625] (-902.760) * (-904.139) [-905.691] (-913.209) (-902.099) -- 0:00:05
911500 -- [-906.191] (-907.577) (-907.601) (-905.555) * (-904.103) [-901.804] (-910.949) (-902.616) -- 0:00:05
912000 -- [-904.304] (-904.318) (-907.004) (-909.862) * [-903.959] (-903.271) (-905.091) (-905.522) -- 0:00:05
912500 -- [-902.517] (-904.176) (-904.469) (-902.158) * (-902.834) (-904.821) [-901.893] (-904.947) -- 0:00:05
913000 -- (-904.818) (-904.950) [-906.245] (-902.483) * (-904.331) (-901.698) [-902.086] (-903.922) -- 0:00:05
913500 -- (-909.497) [-902.972] (-904.484) (-901.813) * (-904.950) (-902.620) (-905.378) [-904.744] -- 0:00:05
914000 -- (-901.785) [-903.376] (-903.062) (-909.828) * (-901.717) (-903.613) (-903.772) [-904.753] -- 0:00:05
914500 -- (-906.250) [-904.962] (-904.453) (-903.890) * (-902.639) (-902.399) [-901.273] (-907.758) -- 0:00:05
915000 -- [-906.440] (-902.890) (-902.969) (-903.556) * (-903.609) [-902.266] (-902.016) (-903.320) -- 0:00:05
Average standard deviation of split frequencies: 0.009149
915500 -- (-911.229) (-905.283) [-903.651] (-906.567) * (-902.578) (-907.875) (-901.321) [-903.318] -- 0:00:05
916000 -- (-908.078) (-903.747) [-903.399] (-902.082) * (-903.749) (-904.658) (-901.387) [-902.196] -- 0:00:05
916500 -- (-902.625) (-904.383) (-902.100) [-902.083] * (-906.997) (-903.959) (-901.886) [-902.207] -- 0:00:05
917000 -- [-901.953] (-902.486) (-904.474) (-903.926) * (-905.967) (-905.407) [-903.856] (-903.327) -- 0:00:05
917500 -- (-904.293) [-904.352] (-905.601) (-902.345) * (-904.156) (-903.524) (-903.744) [-902.496] -- 0:00:05
918000 -- (-904.055) [-905.321] (-901.957) (-902.875) * (-902.362) [-902.334] (-905.256) (-905.324) -- 0:00:05
918500 -- (-907.949) [-905.485] (-902.069) (-903.032) * [-902.959] (-904.435) (-903.096) (-902.328) -- 0:00:05
919000 -- (-905.023) [-902.518] (-903.285) (-903.987) * (-905.115) (-904.206) [-903.161] (-905.539) -- 0:00:05
919500 -- (-903.834) (-904.013) [-902.259] (-904.352) * (-904.051) [-903.079] (-908.473) (-904.165) -- 0:00:04
920000 -- (-903.246) (-902.719) [-902.975] (-903.302) * [-904.305] (-903.183) (-904.335) (-905.199) -- 0:00:04
Average standard deviation of split frequencies: 0.009586
920500 -- (-904.219) (-903.260) [-906.338] (-902.103) * (-904.499) (-907.942) (-903.046) [-904.219] -- 0:00:04
921000 -- (-904.242) (-903.782) (-905.945) [-906.298] * (-901.567) (-902.296) [-902.494] (-902.669) -- 0:00:04
921500 -- (-902.890) (-905.202) (-908.395) [-905.096] * [-903.944] (-902.900) (-905.367) (-902.441) -- 0:00:04
922000 -- (-901.881) (-905.191) [-902.761] (-908.710) * (-906.081) [-901.797] (-902.050) (-902.433) -- 0:00:04
922500 -- (-908.151) (-904.977) [-902.145] (-902.300) * (-904.990) (-903.204) [-902.281] (-903.456) -- 0:00:04
923000 -- (-904.750) [-905.477] (-903.075) (-904.040) * [-903.414] (-901.695) (-901.876) (-903.338) -- 0:00:04
923500 -- (-902.287) (-903.796) (-904.447) [-904.641] * (-903.712) (-904.490) (-906.316) [-903.357] -- 0:00:04
924000 -- (-902.474) (-906.065) [-903.628] (-903.171) * (-904.506) (-902.544) [-903.758] (-902.548) -- 0:00:04
924500 -- (-904.826) (-901.430) (-903.171) [-902.103] * (-909.078) [-905.491] (-901.362) (-904.248) -- 0:00:04
925000 -- (-902.689) (-902.054) [-904.726] (-904.723) * (-907.909) [-904.310] (-902.105) (-902.333) -- 0:00:04
Average standard deviation of split frequencies: 0.009616
925500 -- (-902.575) (-902.634) (-902.844) [-903.338] * (-904.589) (-901.668) (-903.901) [-906.561] -- 0:00:04
926000 -- (-902.667) [-904.026] (-902.600) (-903.126) * (-910.582) (-902.470) (-902.507) [-902.304] -- 0:00:04
926500 -- (-903.581) (-907.295) (-901.724) [-902.955] * [-903.411] (-902.364) (-902.738) (-903.442) -- 0:00:04
927000 -- (-904.409) [-906.038] (-902.256) (-902.139) * (-903.542) [-903.068] (-902.427) (-903.410) -- 0:00:04
927500 -- (-908.410) [-906.863] (-903.080) (-904.107) * (-905.265) (-904.461) (-903.104) [-902.863] -- 0:00:04
928000 -- [-901.947] (-905.772) (-903.316) (-905.413) * [-902.410] (-905.987) (-902.678) (-905.335) -- 0:00:04
928500 -- (-904.308) (-903.924) [-901.603] (-902.634) * (-902.336) (-903.179) [-902.954] (-903.038) -- 0:00:04
929000 -- [-905.630] (-903.544) (-901.719) (-903.096) * (-905.276) [-903.404] (-906.700) (-903.034) -- 0:00:04
929500 -- (-904.406) [-904.052] (-902.194) (-905.317) * (-903.720) (-904.808) (-904.160) [-904.152] -- 0:00:04
930000 -- [-906.731] (-905.917) (-903.922) (-904.787) * (-903.714) (-907.329) (-902.611) [-903.333] -- 0:00:04
Average standard deviation of split frequencies: 0.009708
930500 -- (-905.077) (-905.445) (-904.061) [-903.478] * (-904.093) (-907.497) [-905.338] (-902.993) -- 0:00:04
931000 -- (-907.909) [-903.823] (-901.842) (-907.579) * [-902.821] (-904.231) (-901.834) (-905.664) -- 0:00:04
931500 -- (-902.082) (-902.291) [-902.889] (-903.560) * (-905.603) (-902.107) [-905.102] (-905.787) -- 0:00:04
932000 -- [-911.038] (-903.029) (-905.134) (-901.889) * (-903.400) (-902.871) [-903.882] (-904.847) -- 0:00:04
932500 -- (-905.416) (-903.119) [-902.651] (-904.188) * (-907.322) [-905.669] (-902.583) (-904.751) -- 0:00:04
933000 -- (-902.749) (-901.900) (-904.657) [-903.880] * (-904.053) (-903.942) (-902.180) [-906.805] -- 0:00:04
933500 -- (-903.580) (-904.626) [-906.303] (-902.646) * (-903.854) (-905.957) [-903.092] (-902.893) -- 0:00:04
934000 -- (-904.716) [-902.407] (-906.935) (-902.652) * (-904.053) (-906.580) [-902.349] (-903.120) -- 0:00:04
934500 -- [-904.463] (-902.867) (-901.942) (-902.447) * (-905.595) [-903.649] (-904.655) (-906.243) -- 0:00:04
935000 -- (-903.243) [-903.374] (-901.864) (-902.961) * (-903.206) (-902.503) [-904.205] (-906.009) -- 0:00:04
Average standard deviation of split frequencies: 0.009737
935500 -- [-901.521] (-901.807) (-906.443) (-904.109) * (-903.238) (-903.721) (-907.370) [-902.973] -- 0:00:03
936000 -- (-903.265) (-902.229) [-904.061] (-903.605) * [-902.389] (-902.143) (-902.920) (-905.913) -- 0:00:03
936500 -- (-902.480) [-901.818] (-907.021) (-902.520) * [-902.865] (-902.612) (-902.817) (-904.587) -- 0:00:03
937000 -- [-902.496] (-905.219) (-906.300) (-902.150) * (-903.666) (-903.647) (-903.764) [-903.054] -- 0:00:03
937500 -- (-903.416) (-903.991) [-902.267] (-902.949) * (-903.102) (-902.313) (-903.611) [-904.401] -- 0:00:03
938000 -- (-902.274) (-903.859) (-902.026) [-907.751] * [-902.677] (-901.523) (-904.282) (-904.636) -- 0:00:03
938500 -- (-905.152) (-903.778) (-904.048) [-903.130] * (-902.852) [-904.549] (-903.953) (-902.882) -- 0:00:03
939000 -- [-905.895] (-902.302) (-905.346) (-903.564) * (-902.816) (-904.719) [-903.404] (-902.177) -- 0:00:03
939500 -- (-904.974) (-903.027) (-906.206) [-902.595] * [-903.590] (-904.912) (-909.582) (-905.292) -- 0:00:03
940000 -- (-903.694) (-903.033) (-903.197) [-904.798] * (-905.595) [-905.165] (-903.297) (-902.285) -- 0:00:03
Average standard deviation of split frequencies: 0.010273
940500 -- (-902.389) (-901.458) [-905.888] (-901.492) * (-902.630) (-902.292) (-901.932) [-904.779] -- 0:00:03
941000 -- [-903.230] (-905.223) (-906.846) (-903.925) * (-903.572) (-903.825) [-901.575] (-901.883) -- 0:00:03
941500 -- [-903.176] (-903.858) (-901.609) (-905.138) * (-905.641) (-906.215) [-904.749] (-903.545) -- 0:00:03
942000 -- (-903.381) (-902.593) (-904.674) [-904.595] * (-904.512) (-903.766) [-904.793] (-905.678) -- 0:00:03
942500 -- (-901.501) (-906.150) (-906.841) [-903.195] * [-902.085] (-909.202) (-903.085) (-907.579) -- 0:00:03
943000 -- (-902.107) (-907.445) [-906.765] (-902.281) * (-901.579) (-903.940) (-903.546) [-903.889] -- 0:00:03
943500 -- [-903.295] (-903.316) (-904.057) (-901.698) * (-902.560) (-905.242) [-902.553] (-908.336) -- 0:00:03
944000 -- (-902.882) (-909.405) [-907.385] (-902.912) * (-908.322) (-902.073) (-902.160) [-905.140] -- 0:00:03
944500 -- (-906.012) [-902.189] (-907.484) (-902.877) * (-904.235) (-902.572) (-901.796) [-902.186] -- 0:00:03
945000 -- (-904.179) [-902.996] (-910.129) (-902.757) * [-902.739] (-901.930) (-909.391) (-902.260) -- 0:00:03
Average standard deviation of split frequencies: 0.009994
945500 -- (-903.060) (-902.732) (-903.766) [-904.817] * (-903.001) (-902.692) (-905.085) [-901.658] -- 0:00:03
946000 -- (-902.957) [-902.103] (-902.388) (-905.493) * (-901.906) (-906.491) [-908.099] (-906.204) -- 0:00:03
946500 -- (-902.988) [-902.540] (-903.273) (-904.378) * (-901.618) (-906.358) (-903.591) [-902.550] -- 0:00:03
947000 -- [-903.434] (-902.182) (-902.355) (-904.549) * [-901.848] (-903.699) (-902.684) (-906.334) -- 0:00:03
947500 -- (-906.574) [-902.648] (-902.598) (-901.967) * (-902.986) [-903.374] (-902.419) (-908.678) -- 0:00:03
948000 -- (-905.677) (-902.249) [-901.814] (-903.436) * [-903.474] (-901.497) (-903.086) (-904.789) -- 0:00:03
948500 -- (-902.290) (-902.873) [-903.831] (-903.180) * [-903.187] (-903.296) (-903.365) (-905.373) -- 0:00:03
949000 -- [-901.757] (-903.538) (-908.691) (-903.548) * (-907.178) (-909.338) (-904.014) [-902.975] -- 0:00:03
949500 -- [-902.524] (-906.230) (-909.406) (-903.717) * (-907.393) (-905.042) (-906.921) [-903.578] -- 0:00:03
950000 -- (-903.516) (-902.414) (-906.647) [-902.596] * [-902.854] (-904.216) (-905.640) (-903.548) -- 0:00:03
Average standard deviation of split frequencies: 0.010028
950500 -- [-903.538] (-906.686) (-905.105) (-903.729) * [-904.939] (-904.990) (-904.517) (-907.464) -- 0:00:03
951000 -- (-902.901) (-910.164) [-903.663] (-903.041) * [-906.650] (-904.946) (-906.267) (-907.543) -- 0:00:03
951500 -- (-902.346) (-903.231) [-901.891] (-902.978) * (-903.898) (-904.402) [-904.310] (-908.243) -- 0:00:03
952000 -- (-904.339) (-904.591) [-901.572] (-902.515) * (-902.413) (-904.154) (-906.616) [-902.638] -- 0:00:02
952500 -- (-903.526) (-903.104) [-901.572] (-903.799) * (-902.149) [-903.864] (-906.842) (-904.411) -- 0:00:02
953000 -- [-903.637] (-904.446) (-902.708) (-902.542) * (-902.311) (-908.239) [-903.910] (-905.093) -- 0:00:02
953500 -- (-904.230) [-907.286] (-903.820) (-905.893) * (-906.651) [-904.742] (-906.939) (-903.686) -- 0:00:02
954000 -- (-902.582) [-904.698] (-902.437) (-906.264) * (-902.915) (-903.817) (-906.863) [-902.191] -- 0:00:02
954500 -- (-903.424) [-902.181] (-902.586) (-902.792) * (-903.579) [-904.206] (-905.502) (-903.122) -- 0:00:02
955000 -- [-901.909] (-902.156) (-907.226) (-903.789) * (-905.566) (-903.887) [-903.988] (-906.579) -- 0:00:02
Average standard deviation of split frequencies: 0.010026
955500 -- (-902.389) (-902.001) [-904.065] (-903.174) * (-905.626) (-902.015) (-904.128) [-904.639] -- 0:00:02
956000 -- [-904.542] (-903.879) (-903.267) (-905.271) * (-907.654) (-901.708) [-902.425] (-903.833) -- 0:00:02
956500 -- (-901.647) (-902.935) [-906.225] (-906.253) * [-904.492] (-903.273) (-902.545) (-904.413) -- 0:00:02
957000 -- (-903.437) [-902.252] (-906.364) (-905.327) * (-904.020) [-901.726] (-902.576) (-907.867) -- 0:00:02
957500 -- (-902.484) (-904.167) [-904.094] (-905.941) * (-903.692) (-902.531) [-903.813] (-901.840) -- 0:00:02
958000 -- (-912.335) (-904.327) (-903.582) [-901.727] * (-903.491) [-903.231] (-902.088) (-908.144) -- 0:00:02
958500 -- [-907.170] (-903.606) (-905.593) (-901.733) * (-902.120) (-905.246) (-904.793) [-902.445] -- 0:00:02
959000 -- (-902.751) [-903.907] (-906.090) (-904.259) * (-901.428) (-903.747) [-901.795] (-903.793) -- 0:00:02
959500 -- (-903.475) (-907.972) (-903.171) [-905.303] * [-902.598] (-902.947) (-903.521) (-904.187) -- 0:00:02
960000 -- (-905.085) [-901.644] (-904.083) (-903.439) * (-901.734) (-902.835) [-904.194] (-903.026) -- 0:00:02
Average standard deviation of split frequencies: 0.010087
960500 -- (-907.276) (-902.347) (-904.032) [-902.082] * (-904.553) (-903.105) (-903.825) [-908.146] -- 0:00:02
961000 -- (-905.371) (-904.600) [-903.088] (-903.438) * (-906.216) (-903.549) (-902.940) [-904.070] -- 0:00:02
961500 -- (-903.256) (-903.244) [-902.497] (-906.498) * (-903.559) (-903.461) (-902.850) [-905.318] -- 0:00:02
962000 -- (-902.950) [-904.340] (-901.869) (-902.283) * [-905.576] (-903.030) (-906.152) (-907.077) -- 0:00:02
962500 -- (-903.698) [-901.833] (-903.640) (-902.684) * [-901.613] (-903.185) (-904.719) (-904.217) -- 0:00:02
963000 -- (-903.293) (-903.830) [-903.260] (-904.975) * (-901.859) (-907.152) [-903.978] (-906.328) -- 0:00:02
963500 -- (-904.494) [-906.370] (-903.874) (-907.864) * (-903.748) (-903.646) (-903.871) [-905.385] -- 0:00:02
964000 -- (-905.260) [-905.193] (-903.374) (-902.511) * [-901.340] (-903.657) (-905.407) (-905.738) -- 0:00:02
964500 -- (-903.788) (-905.258) (-905.240) [-904.089] * [-901.728] (-902.296) (-905.201) (-906.085) -- 0:00:02
965000 -- (-905.002) (-902.754) [-904.995] (-905.147) * (-904.318) [-903.032] (-901.534) (-904.040) -- 0:00:02
Average standard deviation of split frequencies: 0.010085
965500 -- (-904.438) (-905.105) (-903.679) [-909.451] * (-905.772) [-902.407] (-903.043) (-902.547) -- 0:00:02
966000 -- (-904.494) (-903.357) (-905.810) [-904.591] * (-905.195) (-902.942) (-904.966) [-902.024] -- 0:00:02
966500 -- (-901.973) (-903.723) (-904.009) [-904.084] * (-903.305) (-902.700) (-903.158) [-903.158] -- 0:00:02
967000 -- [-904.484] (-904.771) (-904.305) (-903.550) * (-906.841) (-904.332) [-901.567] (-902.920) -- 0:00:02
967500 -- (-904.187) (-903.439) (-908.658) [-904.087] * (-904.027) (-903.725) (-904.094) [-903.004] -- 0:00:02
968000 -- (-907.057) [-902.122] (-904.430) (-902.381) * (-902.908) (-903.252) (-904.071) [-901.326] -- 0:00:01
968500 -- (-902.193) (-903.391) (-901.736) [-904.020] * (-904.327) (-904.435) [-903.040] (-901.938) -- 0:00:01
969000 -- [-902.410] (-901.755) (-904.476) (-903.723) * (-902.320) (-904.745) [-902.704] (-903.991) -- 0:00:01
969500 -- (-907.903) (-902.926) [-905.589] (-904.914) * [-904.216] (-904.592) (-904.244) (-902.591) -- 0:00:01
970000 -- (-905.240) [-903.238] (-903.469) (-905.770) * (-904.347) (-904.528) [-902.920] (-904.046) -- 0:00:01
Average standard deviation of split frequencies: 0.009983
970500 -- (-902.728) (-902.536) [-904.435] (-905.293) * (-906.364) (-904.234) (-906.762) [-903.217] -- 0:00:01
971000 -- (-902.264) (-909.527) [-903.853] (-904.915) * (-909.080) (-904.968) [-902.420] (-902.758) -- 0:00:01
971500 -- (-902.604) [-905.160] (-902.154) (-904.181) * [-902.973] (-904.725) (-905.440) (-905.591) -- 0:00:01
972000 -- (-903.607) (-904.538) [-903.771] (-903.417) * (-904.404) (-903.243) [-904.098] (-905.319) -- 0:00:01
972500 -- (-903.360) (-910.610) [-904.370] (-904.341) * (-904.269) (-904.459) [-902.617] (-903.432) -- 0:00:01
973000 -- (-902.619) (-908.239) (-905.000) [-902.268] * (-903.918) (-906.167) (-902.146) [-903.875] -- 0:00:01
973500 -- [-902.261] (-907.381) (-905.354) (-903.283) * (-905.651) (-905.354) (-902.131) [-902.152] -- 0:00:01
974000 -- (-904.992) (-908.949) [-905.113] (-904.125) * (-903.636) (-909.331) [-902.406] (-903.671) -- 0:00:01
974500 -- (-903.684) (-902.729) [-902.737] (-903.176) * [-909.792] (-904.042) (-904.059) (-901.350) -- 0:00:01
975000 -- (-903.722) (-902.571) (-906.291) [-903.491] * (-902.532) (-903.592) (-902.422) [-902.940] -- 0:00:01
Average standard deviation of split frequencies: 0.010062
975500 -- (-903.746) [-902.543] (-902.893) (-903.135) * (-905.248) (-903.740) (-902.206) [-902.747] -- 0:00:01
976000 -- (-903.133) (-902.655) (-903.502) [-903.988] * (-903.698) (-903.710) (-901.949) [-902.541] -- 0:00:01
976500 -- [-903.423] (-904.317) (-902.730) (-905.901) * (-906.769) (-904.049) (-904.552) [-903.248] -- 0:00:01
977000 -- (-902.993) (-902.032) (-902.178) [-902.749] * (-902.642) [-906.855] (-906.172) (-905.138) -- 0:00:01
977500 -- [-903.034] (-904.929) (-902.175) (-903.820) * (-903.913) (-906.972) (-905.333) [-903.984] -- 0:00:01
978000 -- (-902.983) [-904.726] (-902.498) (-903.470) * [-902.494] (-905.716) (-907.025) (-902.480) -- 0:00:01
978500 -- [-904.191] (-906.638) (-903.808) (-901.537) * (-905.392) (-905.018) (-904.272) [-902.548] -- 0:00:01
979000 -- (-904.928) (-903.213) [-906.971] (-902.155) * [-904.975] (-903.613) (-904.645) (-903.127) -- 0:00:01
979500 -- (-908.614) (-903.140) [-905.768] (-904.543) * [-901.813] (-902.228) (-906.268) (-903.318) -- 0:00:01
980000 -- (-903.456) [-902.467] (-904.067) (-904.762) * (-901.492) (-902.774) (-905.043) [-903.246] -- 0:00:01
Average standard deviation of split frequencies: 0.009416
980500 -- (-902.121) [-903.551] (-904.380) (-904.823) * (-904.188) (-903.303) (-901.807) [-906.271] -- 0:00:01
981000 -- (-904.938) [-905.697] (-905.890) (-911.853) * (-904.151) (-904.169) (-903.990) [-901.623] -- 0:00:01
981500 -- [-903.917] (-906.282) (-903.514) (-903.478) * (-906.943) [-902.383] (-903.078) (-902.535) -- 0:00:01
982000 -- (-904.940) (-903.637) (-902.422) [-902.454] * (-904.935) [-902.129] (-901.676) (-903.380) -- 0:00:01
982500 -- (-905.326) (-903.543) [-901.875] (-904.123) * (-903.125) (-902.361) (-903.942) [-902.408] -- 0:00:01
983000 -- (-905.337) (-906.105) (-902.449) [-902.202] * [-904.017] (-902.549) (-902.729) (-902.324) -- 0:00:01
983500 -- (-903.697) (-902.425) [-903.143] (-901.504) * (-904.653) [-901.351] (-905.571) (-905.182) -- 0:00:01
984000 -- [-904.352] (-901.691) (-903.662) (-902.381) * (-902.853) (-904.024) [-902.360] (-905.218) -- 0:00:00
984500 -- (-906.118) (-906.664) (-902.806) [-903.430] * (-905.629) (-902.384) [-902.596] (-903.279) -- 0:00:00
985000 -- (-903.290) (-906.383) [-903.328] (-905.438) * (-905.493) [-905.512] (-903.320) (-906.469) -- 0:00:00
Average standard deviation of split frequencies: 0.009224
985500 -- (-903.039) (-904.680) [-903.398] (-906.819) * [-906.040] (-902.853) (-902.572) (-906.101) -- 0:00:00
986000 -- (-903.782) (-905.061) (-902.423) [-906.226] * [-904.235] (-904.586) (-907.996) (-907.315) -- 0:00:00
986500 -- [-901.878] (-905.183) (-903.855) (-905.778) * (-902.238) (-903.816) [-902.577] (-904.745) -- 0:00:00
987000 -- (-902.862) (-903.140) (-903.241) [-904.938] * (-902.575) (-904.701) (-901.723) [-903.124] -- 0:00:00
987500 -- (-904.241) [-902.787] (-901.801) (-904.325) * (-902.885) (-903.253) (-902.204) [-902.130] -- 0:00:00
988000 -- [-902.460] (-903.627) (-903.210) (-903.886) * (-904.755) (-904.097) [-901.862] (-903.504) -- 0:00:00
988500 -- (-902.798) (-903.907) (-908.467) [-910.830] * [-904.223] (-908.871) (-903.269) (-902.476) -- 0:00:00
989000 -- (-905.461) (-901.605) [-904.075] (-905.378) * (-902.362) [-903.657] (-903.493) (-901.736) -- 0:00:00
989500 -- (-905.073) (-905.446) [-904.805] (-906.629) * [-903.431] (-903.958) (-902.526) (-903.352) -- 0:00:00
990000 -- (-905.181) [-901.600] (-906.122) (-907.634) * (-902.019) [-903.273] (-907.082) (-905.739) -- 0:00:00
Average standard deviation of split frequencies: 0.009265
990500 -- [-902.788] (-901.307) (-904.358) (-903.122) * (-902.735) (-902.762) [-902.856] (-903.317) -- 0:00:00
991000 -- [-901.415] (-902.645) (-905.057) (-903.263) * (-903.280) (-904.199) (-906.867) [-901.689] -- 0:00:00
991500 -- (-903.673) (-902.667) (-905.263) [-902.627] * (-903.231) (-901.980) [-904.210] (-904.219) -- 0:00:00
992000 -- [-904.064] (-902.766) (-903.808) (-906.521) * [-902.099] (-907.576) (-906.402) (-904.069) -- 0:00:00
992500 -- (-907.965) [-901.901] (-907.048) (-904.894) * (-907.526) [-905.244] (-905.147) (-904.639) -- 0:00:00
993000 -- (-904.655) [-905.575] (-909.828) (-902.971) * (-907.598) (-902.296) (-906.343) [-903.811] -- 0:00:00
993500 -- (-902.447) (-903.527) (-907.873) [-904.095] * (-902.536) (-903.027) (-910.696) [-902.728] -- 0:00:00
994000 -- (-905.179) [-905.495] (-907.374) (-903.255) * [-902.119] (-903.375) (-905.722) (-901.734) -- 0:00:00
994500 -- (-903.312) [-902.611] (-903.448) (-903.755) * (-903.447) (-903.030) (-909.110) [-906.718] -- 0:00:00
995000 -- (-903.089) [-903.180] (-905.034) (-903.368) * (-902.596) (-902.799) [-903.020] (-903.419) -- 0:00:00
Average standard deviation of split frequencies: 0.009650
995500 -- (-904.123) (-903.994) [-907.419] (-903.720) * (-901.933) [-905.522] (-903.957) (-903.659) -- 0:00:00
996000 -- (-904.574) (-907.212) [-904.701] (-901.947) * (-904.242) [-902.252] (-904.959) (-911.526) -- 0:00:00
996500 -- (-902.121) (-902.629) (-907.944) [-903.562] * [-902.850] (-902.669) (-901.283) (-905.003) -- 0:00:00
997000 -- (-904.292) (-901.562) [-903.343] (-902.576) * (-903.385) (-902.420) [-902.734] (-904.604) -- 0:00:00
997500 -- [-903.320] (-904.425) (-902.020) (-905.236) * [-902.645] (-902.651) (-903.561) (-903.993) -- 0:00:00
998000 -- (-903.140) (-902.652) (-902.865) [-901.283] * (-901.806) (-902.166) [-902.441] (-903.838) -- 0:00:00
998500 -- (-902.686) [-905.438] (-902.549) (-903.739) * [-902.473] (-903.111) (-904.390) (-902.159) -- 0:00:00
999000 -- (-907.198) (-903.404) [-902.153] (-904.718) * (-904.744) (-904.235) [-901.767] (-903.134) -- 0:00:00
999500 -- [-904.858] (-903.464) (-903.288) (-904.080) * (-905.568) [-904.539] (-903.248) (-903.228) -- 0:00:00
1000000 -- [-902.766] (-902.130) (-903.089) (-905.391) * (-906.851) (-902.396) (-904.813) [-904.187] -- 0:00:00
Average standard deviation of split frequencies: 0.009422
Analysis completed in 1 mins 2 seconds
Analysis used 60.91 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -901.18
Likelihood of best state for "cold" chain of run 2 was -901.15
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 67 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.5 % ( 26 %) Dirichlet(Pi{all})
30.2 % ( 21 %) Slider(Pi{all})
78.8 % ( 51 %) Multiplier(Alpha{1,2})
77.7 % ( 54 %) Multiplier(Alpha{3})
21.1 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.3 % ( 95 %) Nodeslider(V{all})
30.6 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 57 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.1 % ( 25 %) Dirichlet(Pi{all})
29.4 % ( 25 %) Slider(Pi{all})
78.6 % ( 57 %) Multiplier(Alpha{1,2})
77.8 % ( 58 %) Multiplier(Alpha{3})
20.7 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.0 % ( 23 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166385 0.82 0.66
3 | 166981 166035 0.83
4 | 166797 166930 166872
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167314 0.82 0.67
3 | 166014 166645 0.84
4 | 166786 166878 166363
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -902.99
| 2 |
| 1 2 2 2 |
|1 2 2 1 1 1 1 1 2|
| 2 2 2 2 2 2 22 11 1 1 |
| 11 1 2 2 * 1 2 2 |
| 1 2 2 1112 2 1 1 2 2 2 1 |
| 2 11 1 11 2 2 * 1 1 2 |
| 2 2 2 1 1 2 1 1 1 2 1 2 12 2 |
|2 1 1 1 21 2 21 1 |
| 12 11 121 2 2 1 1|
| 2 2 2 1 1 2 |
| 1 2 1 2 1 22 |
| 21 1 1 |
| 2 |
| 1 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -904.33
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.90 -905.92
2 -902.86 -906.73
--------------------------------------
TOTAL -902.88 -906.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900085 0.086810 0.364986 1.485150 0.876266 1470.59 1485.80 1.000
r(A<->C){all} 0.165179 0.019621 0.000206 0.449193 0.127813 242.09 246.20 1.000
r(A<->G){all} 0.161530 0.018828 0.000073 0.446694 0.126348 154.97 224.71 1.000
r(A<->T){all} 0.170599 0.021596 0.000029 0.462935 0.130659 188.84 229.58 1.002
r(C<->G){all} 0.170709 0.020564 0.000078 0.465641 0.137172 119.13 170.27 1.000
r(C<->T){all} 0.178678 0.022792 0.000135 0.474154 0.137515 173.76 205.51 1.000
r(G<->T){all} 0.153305 0.018400 0.000286 0.430436 0.113441 102.56 169.12 1.000
pi(A){all} 0.201013 0.000227 0.173085 0.231266 0.200608 1002.31 1251.66 1.000
pi(C){all} 0.328521 0.000321 0.294139 0.362698 0.328388 1278.18 1389.59 1.000
pi(G){all} 0.295660 0.000304 0.259928 0.327965 0.295468 1295.75 1368.93 1.000
pi(T){all} 0.174806 0.000201 0.148244 0.203000 0.174650 1276.61 1388.81 1.000
alpha{1,2} 0.427412 0.223720 0.000148 1.363470 0.268030 1139.92 1140.19 1.001
alpha{3} 0.470963 0.255221 0.000153 1.451667 0.308488 1018.19 1259.59 1.000
pinvar{all} 0.997697 0.000008 0.992245 0.999998 0.998542 1232.14 1278.08 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- ...*.*
9 -- .**.**
10 -- .***.*
11 -- .**...
12 -- ..****
13 -- ..**..
14 -- ..*.*.
15 -- .****.
16 -- ...**.
17 -- .*.***
18 -- .*...*
19 -- ..*..*
20 -- .*.*..
21 -- ....**
22 -- ...***
23 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.004711 0.149234 0.155896 2
8 451 0.150233 0.020257 0.135909 0.164557 2
9 442 0.147235 0.008480 0.141239 0.153231 2
10 436 0.145237 0.000942 0.144570 0.145903 2
11 436 0.145237 0.003769 0.142572 0.147901 2
12 433 0.144237 0.026852 0.125250 0.163225 2
13 432 0.143904 0.003769 0.141239 0.146569 2
14 430 0.143238 0.002827 0.141239 0.145237 2
15 423 0.140906 0.016488 0.129247 0.152565 2
16 421 0.140240 0.003298 0.137908 0.142572 2
17 418 0.139241 0.000000 0.139241 0.139241 2
18 417 0.138907 0.021199 0.123917 0.153897 2
19 414 0.137908 0.001884 0.136576 0.139241 2
20 414 0.137908 0.002827 0.135909 0.139907 2
21 412 0.137242 0.005653 0.133245 0.141239 2
22 273 0.090939 0.018373 0.077948 0.103931 2
23 268 0.089274 0.018844 0.075949 0.102598 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100033 0.009790 0.000005 0.297228 0.070091 1.001 2
length{all}[2] 0.098306 0.009218 0.000002 0.287514 0.069886 1.000 2
length{all}[3] 0.099076 0.009406 0.000013 0.290695 0.069742 1.000 2
length{all}[4] 0.099445 0.009886 0.000046 0.293615 0.066237 1.002 2
length{all}[5] 0.101036 0.010408 0.000003 0.301298 0.070308 1.000 2
length{all}[6] 0.100438 0.010619 0.000066 0.308506 0.068736 1.002 2
length{all}[7] 0.091721 0.008075 0.000124 0.269066 0.062918 0.998 2
length{all}[8] 0.097432 0.006613 0.000001 0.263776 0.078223 1.000 2
length{all}[9] 0.096917 0.008840 0.000013 0.290642 0.068244 0.998 2
length{all}[10] 0.102925 0.011359 0.000911 0.301564 0.069328 0.998 2
length{all}[11] 0.092063 0.007290 0.000051 0.272925 0.069002 0.998 2
length{all}[12] 0.099040 0.009378 0.000035 0.291436 0.069468 1.009 2
length{all}[13] 0.101667 0.011457 0.000268 0.291688 0.074235 0.998 2
length{all}[14] 0.110469 0.011736 0.000436 0.296479 0.087562 1.001 2
length{all}[15] 0.100446 0.009643 0.000158 0.302063 0.066078 0.999 2
length{all}[16] 0.103855 0.010785 0.001041 0.302700 0.073745 0.998 2
length{all}[17] 0.106010 0.011727 0.000099 0.327492 0.070895 1.002 2
length{all}[18] 0.103637 0.009935 0.000587 0.297347 0.071207 0.998 2
length{all}[19] 0.108429 0.011609 0.000322 0.331869 0.074412 1.000 2
length{all}[20] 0.100910 0.010720 0.000005 0.309991 0.067585 1.001 2
length{all}[21] 0.108378 0.011501 0.000367 0.325028 0.073366 1.012 2
length{all}[22] 0.091597 0.009091 0.000150 0.282734 0.060782 1.035 2
length{all}[23] 0.099395 0.009675 0.000745 0.294845 0.072812 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009422
Maximum standard deviation of split frequencies = 0.026852
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.002
Maximum PSRF for parameter values = 1.035
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 666
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 222 / 222 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 222 / 222 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046417 0.086449 0.046617 0.024717 0.011943 0.100041 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -949.287633
Iterating by ming2
Initial: fx= 949.287633
x= 0.04642 0.08645 0.04662 0.02472 0.01194 0.10004 0.30000 1.30000
1 h-m-p 0.0000 0.0001 533.4108 ++ 933.784270 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0071 45.4706 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 487.2550 ++ 919.910301 m 0.0001 44 | 2/8
4 h-m-p 0.0007 0.0092 35.9536 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 436.0971 ++ 900.944072 m 0.0001 75 | 3/8
6 h-m-p 0.0015 0.0134 25.7008 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 378.5975 ++ 900.812334 m 0.0000 106 | 4/8
8 h-m-p 0.0000 0.0191 18.5767 ---------.. | 4/8
9 h-m-p 0.0000 0.0002 308.2768 +++ 883.261979 m 0.0002 136 | 5/8
10 h-m-p 0.0034 0.0316 11.7049 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 219.2682 ++ 880.231712 m 0.0001 168 | 6/8
12 h-m-p 0.3160 8.0000 0.0000 +++ 880.231712 m 8.0000 180 | 6/8
13 h-m-p 0.2618 8.0000 0.0000 ----C 880.231712 0 0.0003 197
Out..
lnL = -880.231712
198 lfun, 198 eigenQcodon, 1188 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031348 0.079036 0.070913 0.096870 0.016741 0.093912 0.299947 0.521613 0.549748
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.154859
np = 9
lnL0 = -964.405829
Iterating by ming2
Initial: fx= 964.405829
x= 0.03135 0.07904 0.07091 0.09687 0.01674 0.09391 0.29995 0.52161 0.54975
1 h-m-p 0.0000 0.0001 523.1324 ++ 943.068025 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0003 277.9182 ++ 927.243372 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0002 589.4475 ++ 894.459816 m 0.0002 38 | 3/9
4 h-m-p 0.0001 0.0006 159.3576 ++ 886.715280 m 0.0006 50 | 4/9
5 h-m-p 0.0001 0.0003 734.4160 ++ 881.039477 m 0.0003 62 | 5/9
6 h-m-p 0.0000 0.0000 4848.4232 ++ 880.231729 m 0.0000 74 | 6/9
7 h-m-p 0.8274 4.1372 0.0024 -----------Y 880.231729 0 0.0000 97 | 6/9
8 h-m-p 0.0160 8.0000 0.0002 +++++ 880.231729 m 8.0000 115 | 6/9
9 h-m-p 0.0066 3.2806 0.2707 +++++ 880.231713 m 3.2806 133 | 7/9
10 h-m-p 0.3063 1.5317 0.0654 ++ 880.231713 m 1.5317 148 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 N 880.231713 0 1.6000 162
Out..
lnL = -880.231713
163 lfun, 489 eigenQcodon, 1956 P(t)
Time used: 0:00
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.033506 0.072145 0.101993 0.096737 0.066552 0.070638 0.000100 1.717354 0.456576 0.387419 1.392224
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.978971
np = 11
lnL0 = -973.073780
Iterating by ming2
Initial: fx= 973.073780
x= 0.03351 0.07214 0.10199 0.09674 0.06655 0.07064 0.00011 1.71735 0.45658 0.38742 1.39222
1 h-m-p 0.0000 0.0000 494.2984 ++ 972.221836 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 400.2953 +++ 930.684464 m 0.0004 31 | 2/11
3 h-m-p 0.0001 0.0003 329.5322 ++ 898.361691 m 0.0003 45 | 3/11
4 h-m-p 0.0003 0.0016 48.8538 ++ 890.459366 m 0.0016 59 | 4/11
5 h-m-p 0.0000 0.0000 1093.1373 ++ 889.477613 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 44621.0047 ++ 884.527684 m 0.0000 87 | 6/11
7 h-m-p 0.0018 0.0091 7.1181 ------------.. | 6/11
8 h-m-p 0.0000 0.0000 305.8728 ++ 881.062397 m 0.0000 125 | 7/11
9 h-m-p 0.0160 8.0000 1.4609 -------------.. | 7/11
10 h-m-p 0.0000 0.0000 219.4380 ++ 880.231727 m 0.0000 164 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 880.231727 m 8.0000 181 | 7/11
12 h-m-p 0.0390 8.0000 0.0013 -----C 880.231727 0 0.0000 203 | 7/11
13 h-m-p 0.0160 8.0000 0.0037 +++++ 880.231727 m 8.0000 224 | 7/11
14 h-m-p 0.0071 0.1569 4.1738 +++ 880.231723 m 0.1569 243 | 7/11
15 h-m-p -0.0000 -0.0000 2.8643
h-m-p: -0.00000000e+00 -0.00000000e+00 2.86429017e+00 880.231723
.. | 7/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 880.231723 m 8.0000 271 | 7/11
17 h-m-p 0.0205 8.0000 0.0085 +++++ 880.231722 m 8.0000 292 | 7/11
18 h-m-p 0.1401 2.2312 0.4867 ++ 880.231712 m 2.2312 310 | 8/11
19 h-m-p 1.6000 8.0000 0.0464 ++ 880.231712 m 8.0000 328 | 8/11
20 h-m-p 0.1382 8.0000 2.6882 +Y 880.231711 0 0.5528 346 | 8/11
21 h-m-p 1.6000 8.0000 0.2566 ----------Y 880.231711 0 0.0000 370 | 8/11
22 h-m-p 0.0662 8.0000 0.0000 ++++ 880.231711 m 8.0000 389 | 8/11
23 h-m-p 0.0160 8.0000 0.0377 -------Y 880.231711 0 0.0000 413 | 8/11
24 h-m-p 0.0160 8.0000 0.0000 ---N 880.231711 0 0.0001 433 | 8/11
25 h-m-p 0.0160 8.0000 0.0001 +++++ 880.231711 m 8.0000 453 | 8/11
26 h-m-p 0.0024 1.2021 1.1471 ------Y 880.231711 0 0.0000 476 | 8/11
27 h-m-p 0.0160 8.0000 0.0009 +++++ 880.231711 m 8.0000 493 | 8/11
28 h-m-p 0.0039 0.7415 1.8201 ---------Y 880.231711 0 0.0000 519 | 8/11
29 h-m-p 0.0160 8.0000 0.0000 --N 880.231711 0 0.0003 535 | 8/11
30 h-m-p 0.0160 8.0000 0.0002 +++++ 880.231711 m 8.0000 555 | 8/11
31 h-m-p 0.0016 0.7841 1.6630 ---------Y 880.231711 0 0.0000 581 | 8/11
32 h-m-p 0.0315 8.0000 0.0000 N 880.231711 0 0.0079 595 | 8/11
33 h-m-p 0.0303 8.0000 0.0000 N 880.231711 0 0.0303 612
Out..
lnL = -880.231711
613 lfun, 2452 eigenQcodon, 11034 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -880.236775 S = -880.227808 -0.003429
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:04
did 20 / 54 patterns 0:04
did 30 / 54 patterns 0:04
did 40 / 54 patterns 0:04
did 50 / 54 patterns 0:04
did 54 / 54 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.105104 0.042568 0.057538 0.032730 0.049114 0.071794 0.000100 0.838284 1.663365
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.402002
np = 9
lnL0 = -956.258663
Iterating by ming2
Initial: fx= 956.258663
x= 0.10510 0.04257 0.05754 0.03273 0.04911 0.07179 0.00011 0.83828 1.66337
1 h-m-p 0.0000 0.0000 500.3958 ++ 955.345040 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0203 41.5057 +++++ 942.316279 m 0.0203 29 | 2/9
3 h-m-p 0.0001 0.0004 423.9799 ++ 922.762540 m 0.0004 41 | 3/9
4 h-m-p 0.0006 0.0030 254.0604 +
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
+ 895.521542 m 0.0030 53
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223311e-160 2000 rounds
| 4/9
5 h-m-p 0.0012 0.0062 34.8855
QuantileBeta(0.15, 0.00500, 2.14751) = 1.231072e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15558) = 1.225243e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15760) = 1.223794e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15810) = 1.223432e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15823) = 1.223342e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15826) = 1.223320e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223314e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223311e-160 2000 rounds
| 4/9
6 h-m-p 0.0000 0.0000 436.5436
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
+ 888.031187 m 0.0000 86
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223311e-160 2000 rounds
| 5/9
7 h-m-p 0.0160 8.0000 1.8592
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223311e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223311e-160 2000 rounds
| 5/9
8 h-m-p 0.0000 0.0000 380.0395
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
+ 884.194408 m 0.0000 121
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223311e-160 2000 rounds
| 6/9
9 h-m-p 0.0160 8.0000 1.5198
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223311e-160 2000 rounds
| 6/9
10 h-m-p 0.0000 0.0000 311.1164
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
+ 881.998613 m 0.0000 156
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223311e-160 2000 rounds
| 7/9
11 h-m-p 0.0160 8.0000 1.0749
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223311e-160 2000 rounds
| 7/9
12 h-m-p 0.0000 0.0000 220.1921
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
+ 880.231761 m 0.0000 191
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223311e-160 2000 rounds
| 8/9
13 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
Y 880.231761 0 1.6000 203
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.223312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15839) = 1.223225e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15815) = 1.223399e-160 2000 rounds
| 7/9
14 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.15827) = 1.225508e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15827) = 1.232991e-160 2000 rounds
+++++ 880.231761 m 8.0000 219
QuantileBeta(0.15, 0.00496, 2.15827) = 2.062406e-162 2000 rounds
| 7/9
15 h-m-p 1.6000 8.0000 0.0000 ++ 880.231761 m 8.0000 233 | 7/9
16 h-m-p 0.0180 0.0901 0.0006 ---N 880.231761 0 0.0001 250 | 7/9
17 h-m-p 0.0052 2.5865 0.0000 -Y 880.231761 0 0.0003 265
Out..
lnL = -880.231761
266 lfun, 2926 eigenQcodon, 15960 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108794 0.038187 0.091589 0.088291 0.070204 0.055628 0.000100 0.900000 0.341177 1.927937 1.300037
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 19.535049
np = 11
lnL0 = -969.589629
Iterating by ming2
Initial: fx= 969.589629
x= 0.10879 0.03819 0.09159 0.08829 0.07020 0.05563 0.00011 0.90000 0.34118 1.92794 1.30004
1 h-m-p 0.0000 0.0000 440.8265 ++ 969.270912 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 602.3952 +++ 926.680107 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0000 1731.8044 ++ 909.158778 m 0.0000 45 | 3/11
4 h-m-p 0.0007 0.0034 59.5566 ++ 898.737842 m 0.0034 59 | 4/11
5 h-m-p 0.0000 0.0000 5690.8431 ++ 889.210298 m 0.0000 73 | 5/11
6 h-m-p 0.0005 0.0024 16.7908 ++ 889.018370 m 0.0024 87 | 6/11
7 h-m-p 0.0001 0.0003 74.1957 ++ 887.510934 m 0.0003 101 | 7/11
8 h-m-p 0.0003 0.0017 43.5836 ++ 880.231727 m 0.0017 115 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 880.231727 m 8.0000 129 | 8/11
10 h-m-p 0.0160 8.0000 0.0163 +++++ 880.231720 m 8.0000 149 | 8/11
11 h-m-p 0.5746 3.4820 0.2272 ++ 880.231706 m 3.4820 166 | 9/11
12 h-m-p 1.5010 8.0000 0.2774 ++ 880.231702 m 8.0000 183 | 9/11
13 h-m-p 1.0311 5.1556 0.8700 ++ 880.231699 m 5.1556 199 | 9/11
14 h-m-p -0.0000 -0.0000 1.6017
h-m-p: -4.89040701e-17 -2.44520351e-16 1.60170001e+00 880.231699
.. | 9/11
15 h-m-p 0.0160 8.0000 0.0000 Y 880.231699 0 0.0160 226 | 9/11
16 h-m-p 1.6000 8.0000 0.0000 C 880.231699 0 1.6000 242
Out..
lnL = -880.231699
243 lfun, 2916 eigenQcodon, 16038 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -880.228558 S = -880.226659 -0.000831
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:12
did 20 / 54 patterns 0:13
did 30 / 54 patterns 0:13
did 40 / 54 patterns 0:13
did 50 / 54 patterns 0:13
did 54 / 54 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=222
NC_011896_1_WP_010908952_1_2722_MLBR_RS12950 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
NC_002677_1_NP_302633_1_1505_ML2549 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA
**************************************************
NC_011896_1_WP_010908952_1_2722_MLBR_RS12950 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
NC_002677_1_NP_302633_1_1505_ML2549 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355 LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV
**************************************************
NC_011896_1_WP_010908952_1_2722_MLBR_RS12950 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
NC_002677_1_NP_302633_1_1505_ML2549 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355 VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD
**************************************************
NC_011896_1_WP_010908952_1_2722_MLBR_RS12950 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
NC_002677_1_NP_302633_1_1505_ML2549 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355 GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL
**************************************************
NC_011896_1_WP_010908952_1_2722_MLBR_RS12950 WDTNRPNPALLTQGMWVQFRAT
NC_002677_1_NP_302633_1_1505_ML2549 WDTNRPNPALLTQGMWVQFRAT
NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575 WDTNRPNPALLTQGMWVQFRAT
NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020 WDTNRPNPALLTQGMWVQFRAT
NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020 WDTNRPNPALLTQGMWVQFRAT
NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355 WDTNRPNPALLTQGMWVQFRAT
**********************
>NC_011896_1_WP_010908952_1_2722_MLBR_RS12950 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >NC_002677_1_NP_302633_1_1505_ML2549 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG >NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355 ATGGAAACAACAAGCAACCATACGCAAGAGCTATCTAAAAACTTGGTAAG GAACGATACCATTCTCAATTACGGCGATCAAGCGCTGATGCTGCAATGCG GCAGCACCTCTGATGTCCTGGCATGGGCAGATGCGTTACGTGCGGCGGCA CTACCCGGTGTGGTCGACATCGTCCCAGGCGCCCGCACCGTGTTGGTGAA ACTCGGCGGACCCCGCGACCAAAAGGTCACCCTTCAGCGGCTACGCAAGC TGCGGGTCACCCCGGAGGCGACTGCGCCAGCTGACCGCGGCGCCGACGTG GTGATCGACGTCGTCTACGACGGCCCGGACCTCGCCGAGGTTGCCCGCAC TACCGGACTGACGGTAGCGAAGGTCATCACCGCCCATACCGGCACTCCGT GGCGGGTTGGATTCAATGGCTTCGCACCAGGTTTCGCATATCTGGTCGAC GGCGATCCACGACTGCGAGTGCCACGCCGGTGCGATCCGCGGACCTCGGT GCCGCCTGGTTCGGTCGCCCTCGCCGACGAATTCAGCGCGATATATCCGC GCCAATCTCCTGGCGGTTGGCAACTCATCGGCCACACCAACACAGTGCTG TGGGACACCAACCGGCCCAATCCCGCATTGCTGACACAGGGCATGTGGGT GCAGTTCCGTGCCACG
>NC_011896_1_WP_010908952_1_2722_MLBR_RS12950 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >NC_002677_1_NP_302633_1_1505_ML2549 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT >NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355 METTSNHTQELSKNLVRNDTILNYGDQALMLQCGSTSDVLAWADALRAAA LPGVVDIVPGARTVLVKLGGPRDQKVTLQRLRKLRVTPEATAPADRGADV VIDVVYDGPDLAEVARTTGLTVAKVITAHTGTPWRVGFNGFAPGFAYLVD GDPRLRVPRRCDPRTSVPPGSVALADEFSAIYPRQSPGGWQLIGHTNTVL WDTNRPNPALLTQGMWVQFRAT
#NEXUS
[ID: 5413048695]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908952_1_2722_MLBR_RS12950
NC_002677_1_NP_302633_1_1505_ML2549
NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575
NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020
NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020
NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908952_1_2722_MLBR_RS12950,
2 NC_002677_1_NP_302633_1_1505_ML2549,
3 NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575,
4 NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020,
5 NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020,
6 NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07009108,2:0.06988624,3:0.06974157,4:0.06623729,5:0.07030813,6:0.06873609);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07009108,2:0.06988624,3:0.06974157,4:0.06623729,5:0.07030813,6:0.06873609);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.90 -905.92
2 -902.86 -906.73
--------------------------------------
TOTAL -902.88 -906.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2549/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900085 0.086810 0.364986 1.485150 0.876266 1470.59 1485.80 1.000
r(A<->C){all} 0.165179 0.019621 0.000206 0.449193 0.127813 242.09 246.20 1.000
r(A<->G){all} 0.161530 0.018828 0.000073 0.446694 0.126348 154.97 224.71 1.000
r(A<->T){all} 0.170599 0.021596 0.000029 0.462935 0.130659 188.84 229.58 1.002
r(C<->G){all} 0.170709 0.020564 0.000078 0.465641 0.137172 119.13 170.27 1.000
r(C<->T){all} 0.178678 0.022792 0.000135 0.474154 0.137515 173.76 205.51 1.000
r(G<->T){all} 0.153305 0.018400 0.000286 0.430436 0.113441 102.56 169.12 1.000
pi(A){all} 0.201013 0.000227 0.173085 0.231266 0.200608 1002.31 1251.66 1.000
pi(C){all} 0.328521 0.000321 0.294139 0.362698 0.328388 1278.18 1389.59 1.000
pi(G){all} 0.295660 0.000304 0.259928 0.327965 0.295468 1295.75 1368.93 1.000
pi(T){all} 0.174806 0.000201 0.148244 0.203000 0.174650 1276.61 1388.81 1.000
alpha{1,2} 0.427412 0.223720 0.000148 1.363470 0.268030 1139.92 1140.19 1.001
alpha{3} 0.470963 0.255221 0.000153 1.451667 0.308488 1018.19 1259.59 1.000
pinvar{all} 0.997697 0.000008 0.992245 0.999998 0.998542 1232.14 1278.08 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2549/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 222
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 0 0 0 0 0 0 | TAC 2 2 2 2 2 2 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 5 5 5 5 5 5 | CCC 4 4 4 4 4 4 | CAC 1 1 1 1 1 1 | CGC 7 7 7 7 7 7
CTA 3 3 3 3 3 3 | CCA 5 5 5 5 5 5 | Gln CAA 6 6 6 6 6 6 | CGA 2 2 2 2 2 2
CTG 9 9 9 9 9 9 | CCG 6 6 6 6 6 6 | CAG 3 3 3 3 3 3 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 3 3 3 3 3 3 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 11 11 11 11 11 11 | AAC 5 5 5 5 5 5 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 4 4 4 4 4 4 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 3 3 3 3 3 3 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 1 1 1 1 1 1 | Asp GAT 6 6 6 6 6 6 | Gly GGT 4 4 4 4 4 4
GTC 10 10 10 10 10 10 | GCC 8 8 8 8 8 8 | GAC 10 10 10 10 10 10 | GGC 12 12 12 12 12 12
GTA 2 2 2 2 2 2 | GCA 6 6 6 6 6 6 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 9 9 9 9 9 9 | GCG 8 8 8 8 8 8 | GAG 3 3 3 3 3 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908952_1_2722_MLBR_RS12950
position 1: T:0.11261 C:0.28829 A:0.21171 G:0.38739
position 2: T:0.26577 C:0.29730 A:0.22523 G:0.21171
position 3: T:0.14414 C:0.40090 A:0.16667 G:0.28829
Average T:0.17417 C:0.32883 A:0.20120 G:0.29580
#2: NC_002677_1_NP_302633_1_1505_ML2549
position 1: T:0.11261 C:0.28829 A:0.21171 G:0.38739
position 2: T:0.26577 C:0.29730 A:0.22523 G:0.21171
position 3: T:0.14414 C:0.40090 A:0.16667 G:0.28829
Average T:0.17417 C:0.32883 A:0.20120 G:0.29580
#3: NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575
position 1: T:0.11261 C:0.28829 A:0.21171 G:0.38739
position 2: T:0.26577 C:0.29730 A:0.22523 G:0.21171
position 3: T:0.14414 C:0.40090 A:0.16667 G:0.28829
Average T:0.17417 C:0.32883 A:0.20120 G:0.29580
#4: NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020
position 1: T:0.11261 C:0.28829 A:0.21171 G:0.38739
position 2: T:0.26577 C:0.29730 A:0.22523 G:0.21171
position 3: T:0.14414 C:0.40090 A:0.16667 G:0.28829
Average T:0.17417 C:0.32883 A:0.20120 G:0.29580
#5: NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020
position 1: T:0.11261 C:0.28829 A:0.21171 G:0.38739
position 2: T:0.26577 C:0.29730 A:0.22523 G:0.21171
position 3: T:0.14414 C:0.40090 A:0.16667 G:0.28829
Average T:0.17417 C:0.32883 A:0.20120 G:0.29580
#6: NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355
position 1: T:0.11261 C:0.28829 A:0.21171 G:0.38739
position 2: T:0.26577 C:0.29730 A:0.22523 G:0.21171
position 3: T:0.14414 C:0.40090 A:0.16667 G:0.28829
Average T:0.17417 C:0.32883 A:0.20120 G:0.29580
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 18 | Tyr Y TAT 12 | Cys C TGT 0
TTC 30 | TCC 0 | TAC 12 | TGC 12
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 12
CTC 30 | CCC 24 | CAC 6 | CGC 42
CTA 18 | CCA 30 | Gln Q CAA 36 | CGA 12
CTG 54 | CCG 36 | CAG 18 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 18 | Asn N AAT 18 | Ser S AGT 0
ATC 24 | ACC 66 | AAC 30 | AGC 18
ATA 6 | ACA 24 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 18 | ACG 18 | AAG 18 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 6 | Asp D GAT 36 | Gly G GGT 24
GTC 60 | GCC 48 | GAC 60 | GGC 72
GTA 12 | GCA 36 | Glu E GAA 12 | GGA 18
GTG 54 | GCG 48 | GAG 18 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11261 C:0.28829 A:0.21171 G:0.38739
position 2: T:0.26577 C:0.29730 A:0.22523 G:0.21171
position 3: T:0.14414 C:0.40090 A:0.16667 G:0.28829
Average T:0.17417 C:0.32883 A:0.20120 G:0.29580
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -880.231712 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299947 1.300037
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908952_1_2722_MLBR_RS12950: 0.000004, NC_002677_1_NP_302633_1_1505_ML2549: 0.000004, NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575: 0.000004, NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020: 0.000004, NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020: 0.000004, NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29995
omega (dN/dS) = 1.30004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 500.2 165.8 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 500.2 165.8 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 500.2 165.8 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 500.2 165.8 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 500.2 165.8 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 500.2 165.8 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -880.231713 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.709811
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908952_1_2722_MLBR_RS12950: 0.000004, NC_002677_1_NP_302633_1_1505_ML2549: 0.000004, NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575: 0.000004, NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020: 0.000004, NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020: 0.000004, NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.70981 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 504.5 161.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 504.5 161.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 504.5 161.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 504.5 161.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 504.5 161.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 504.5 161.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:00
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -880.231711 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.066815 0.822970 1.000000 2.035474
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908952_1_2722_MLBR_RS12950: 0.000004, NC_002677_1_NP_302633_1_1505_ML2549: 0.000004, NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575: 0.000004, NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020: 0.000004, NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020: 0.000004, NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.06681 0.82297 0.11022
w: 1.00000 1.00000 2.03547
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 504.5 161.5 1.1141 0.0000 0.0000 0.0 0.0
7..2 0.000 504.5 161.5 1.1141 0.0000 0.0000 0.0 0.0
7..3 0.000 504.5 161.5 1.1141 0.0000 0.0000 0.0 0.0
7..4 0.000 504.5 161.5 1.1141 0.0000 0.0000 0.0 0.0
7..5 0.000 504.5 161.5 1.1141 0.0000 0.0000 0.0 0.0
7..6 0.000 504.5 161.5 1.1141 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908952_1_2722_MLBR_RS12950)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908952_1_2722_MLBR_RS12950)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -880.231761 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005058 2.158269
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908952_1_2722_MLBR_RS12950: 0.000004, NC_002677_1_NP_302633_1_1505_ML2549: 0.000004, NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575: 0.000004, NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020: 0.000004, NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020: 0.000004, NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00506 q = 2.15827
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 504.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 504.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 504.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 504.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 504.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 504.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -880.231699 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 8.538088
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908952_1_2722_MLBR_RS12950: 0.000004, NC_002677_1_NP_302633_1_1505_ML2549: 0.000004, NZ_LVXE01000003_1_WP_010908952_1_1383_A3216_RS02575: 0.000004, NZ_LYPH01000044_1_WP_010908952_1_1680_A8144_RS08020: 0.000004, NZ_CP029543_1_WP_010908952_1_2753_DIJ64_RS14020: 0.000004, NZ_AP014567_1_WP_010908952_1_2820_JK2ML_RS14355: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 0.00500
(p1 = 0.99999) w = 8.53809
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000 8.53809
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 504.5 161.5 8.5380 0.0000 0.0000 0.0 0.0
7..2 0.000 504.5 161.5 8.5380 0.0000 0.0000 0.0 0.0
7..3 0.000 504.5 161.5 8.5380 0.0000 0.0000 0.0 0.0
7..4 0.000 504.5 161.5 8.5380 0.0000 0.0000 0.0 0.0
7..5 0.000 504.5 161.5 8.5380 0.0000 0.0000 0.0 0.0
7..6 0.000 504.5 161.5 8.5380 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908952_1_2722_MLBR_RS12950)
Pr(w>1) post mean +- SE for w
1 M 1.000** 8.538
2 E 1.000** 8.538
3 T 1.000** 8.538
4 T 1.000** 8.538
5 S 1.000** 8.538
6 N 1.000** 8.538
7 H 1.000** 8.538
8 T 1.000** 8.538
9 Q 1.000** 8.538
10 E 1.000** 8.538
11 L 1.000** 8.538
12 S 1.000** 8.538
13 K 1.000** 8.538
14 N 1.000** 8.538
15 L 1.000** 8.538
16 V 1.000** 8.538
17 R 1.000** 8.538
18 N 1.000** 8.538
19 D 1.000** 8.538
20 T 1.000** 8.538
21 I 1.000** 8.538
22 L 1.000** 8.538
23 N 1.000** 8.538
24 Y 1.000** 8.538
25 G 1.000** 8.538
26 D 1.000** 8.538
27 Q 1.000** 8.538
28 A 1.000** 8.538
29 L 1.000** 8.538
30 M 1.000** 8.538
31 L 1.000** 8.538
32 Q 1.000** 8.538
33 C 1.000** 8.538
34 G 1.000** 8.538
35 S 1.000** 8.538
36 T 1.000** 8.538
37 S 1.000** 8.538
38 D 1.000** 8.538
39 V 1.000** 8.538
40 L 1.000** 8.538
41 A 1.000** 8.538
42 W 1.000** 8.538
43 A 1.000** 8.538
44 D 1.000** 8.538
45 A 1.000** 8.538
46 L 1.000** 8.538
47 R 1.000** 8.538
48 A 1.000** 8.538
49 A 1.000** 8.538
50 A 1.000** 8.538
51 L 1.000** 8.538
52 P 1.000** 8.538
53 G 1.000** 8.538
54 V 1.000** 8.538
55 V 1.000** 8.538
56 D 1.000** 8.538
57 I 1.000** 8.538
58 V 1.000** 8.538
59 P 1.000** 8.538
60 G 1.000** 8.538
61 A 1.000** 8.538
62 R 1.000** 8.538
63 T 1.000** 8.538
64 V 1.000** 8.538
65 L 1.000** 8.538
66 V 1.000** 8.538
67 K 1.000** 8.538
68 L 1.000** 8.538
69 G 1.000** 8.538
70 G 1.000** 8.538
71 P 1.000** 8.538
72 R 1.000** 8.538
73 D 1.000** 8.538
74 Q 1.000** 8.538
75 K 1.000** 8.538
76 V 1.000** 8.538
77 T 1.000** 8.538
78 L 1.000** 8.538
79 Q 1.000** 8.538
80 R 1.000** 8.538
81 L 1.000** 8.538
82 R 1.000** 8.538
83 K 1.000** 8.538
84 L 1.000** 8.538
85 R 1.000** 8.538
86 V 1.000** 8.538
87 T 1.000** 8.538
88 P 1.000** 8.538
89 E 1.000** 8.538
90 A 1.000** 8.538
91 T 1.000** 8.538
92 A 1.000** 8.538
93 P 1.000** 8.538
94 A 1.000** 8.538
95 D 1.000** 8.538
96 R 1.000** 8.538
97 G 1.000** 8.538
98 A 1.000** 8.538
99 D 1.000** 8.538
100 V 1.000** 8.538
101 V 1.000** 8.538
102 I 1.000** 8.538
103 D 1.000** 8.538
104 V 1.000** 8.538
105 V 1.000** 8.538
106 Y 1.000** 8.538
107 D 1.000** 8.538
108 G 1.000** 8.538
109 P 1.000** 8.538
110 D 1.000** 8.538
111 L 1.000** 8.538
112 A 1.000** 8.538
113 E 1.000** 8.538
114 V 1.000** 8.538
115 A 1.000** 8.538
116 R 1.000** 8.538
117 T 1.000** 8.538
118 T 1.000** 8.538
119 G 1.000** 8.538
120 L 1.000** 8.538
121 T 1.000** 8.538
122 V 1.000** 8.538
123 A 1.000** 8.538
124 K 1.000** 8.538
125 V 1.000** 8.538
126 I 1.000** 8.538
127 T 1.000** 8.538
128 A 1.000** 8.538
129 H 1.000** 8.538
130 T 1.000** 8.538
131 G 1.000** 8.538
132 T 1.000** 8.538
133 P 1.000** 8.538
134 W 1.000** 8.538
135 R 1.000** 8.538
136 V 1.000** 8.538
137 G 1.000** 8.538
138 F 1.000** 8.538
139 N 1.000** 8.538
140 G 1.000** 8.538
141 F 1.000** 8.538
142 A 1.000** 8.538
143 P 1.000** 8.538
144 G 1.000** 8.538
145 F 1.000** 8.538
146 A 1.000** 8.538
147 Y 1.000** 8.538
148 L 1.000** 8.538
149 V 1.000** 8.538
150 D 1.000** 8.538
151 G 1.000** 8.538
152 D 1.000** 8.538
153 P 1.000** 8.538
154 R 1.000** 8.538
155 L 1.000** 8.538
156 R 1.000** 8.538
157 V 1.000** 8.538
158 P 1.000** 8.538
159 R 1.000** 8.538
160 R 1.000** 8.538
161 C 1.000** 8.538
162 D 1.000** 8.538
163 P 1.000** 8.538
164 R 1.000** 8.538
165 T 1.000** 8.538
166 S 1.000** 8.538
167 V 1.000** 8.538
168 P 1.000** 8.538
169 P 1.000** 8.538
170 G 1.000** 8.538
171 S 1.000** 8.538
172 V 1.000** 8.538
173 A 1.000** 8.538
174 L 1.000** 8.538
175 A 1.000** 8.538
176 D 1.000** 8.538
177 E 1.000** 8.538
178 F 1.000** 8.538
179 S 1.000** 8.538
180 A 1.000** 8.538
181 I 1.000** 8.538
182 Y 1.000** 8.538
183 P 1.000** 8.538
184 R 1.000** 8.538
185 Q 1.000** 8.538
186 S 1.000** 8.538
187 P 1.000** 8.538
188 G 1.000** 8.538
189 G 1.000** 8.538
190 W 1.000** 8.538
191 Q 1.000** 8.538
192 L 1.000** 8.538
193 I 1.000** 8.538
194 G 1.000** 8.538
195 H 1.000** 8.538
196 T 1.000** 8.538
197 N 1.000** 8.538
198 T 1.000** 8.538
199 V 1.000** 8.538
200 L 1.000** 8.538
201 W 1.000** 8.538
202 D 1.000** 8.538
203 T 1.000** 8.538
204 N 1.000** 8.538
205 R 1.000** 8.538
206 P 1.000** 8.538
207 N 1.000** 8.538
208 P 1.000** 8.538
209 A 1.000** 8.538
210 L 1.000** 8.538
211 L 1.000** 8.538
212 T 1.000** 8.538
213 Q 1.000** 8.538
214 G 1.000** 8.538
215 M 1.000** 8.538
216 W 1.000** 8.538
217 V 1.000** 8.538
218 Q 1.000** 8.538
219 F 1.000** 8.538
220 R 1.000** 8.538
221 A 1.000** 8.538
222 T 1.000** 8.538
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908952_1_2722_MLBR_RS12950)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -880.231713 Model 2: PositiveSelection -880.231711 Model 0: one-ratio -880.231712 Model 7: beta -880.231761 Model 8: beta&w>1 -880.231699 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 1.2399999991430377E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
