>C1
VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
VARDGRGSTLNEALHTNooo
>C2
VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
VARDGRGSTLNEALHTNooo
>C3
VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
VARDGRGSTLNEALHTNooo
>C4
VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
VARDGRGSTLNEALHTNooo
>C5
LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C6
LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=323
C1 ---VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
C2 ---VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
C3 ---VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
C4 ---VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
C5 LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
C6 LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
***********************************************
C1 PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
C2 PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
C3 PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
C4 PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
C5 PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
C6 PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
**************************************************
C1 APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
C2 APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
C3 APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
C4 APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
C5 APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
C6 APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
**************************************************
C1 FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
C2 FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
C3 FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
C4 FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
C5 FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
C6 FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
**************************************************
C1 VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
C2 VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
C3 VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
C4 VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
C5 VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
C6 VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
**************************************************
C1 ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
C2 ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
C3 ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
C4 ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
C5 ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
C6 ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
**************************************************
C1 VEVVARDGRGSTLNEALHTNooo
C2 VEVVARDGRGSTLNEALHTNooo
C3 VEVVARDGRGSTLNEALHTNooo
C4 VEVVARDGRGSTLNEALHTNooo
C5 VEVVARDGRGSTLNEALHTN---
C6 VEVVARDGRGSTLNEALHTN---
********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 320 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 320 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9664]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [9664]--->[9656]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.513 Mb, Max= 30.887 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
C2 VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
C3 VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
C4 VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
C5 VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
C6 VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
**************************************************
C1 LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
C2 LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
C3 LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
C4 LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
C5 LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
C6 LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
**************************************************
C1 GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
C2 GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
C3 GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
C4 GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
C5 GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
C6 GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
**************************************************
C1 MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
C2 MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
C3 MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
C4 MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
C5 MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
C6 MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
**************************************************
C1 RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
C2 RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
C3 RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
C4 RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
C5 RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
C6 RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
**************************************************
C1 GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
C2 GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
C3 GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
C4 GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
C5 GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
C6 GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
**************************************************
C1 VARDGRGSTLNEALHTN
C2 VARDGRGSTLNEALHTN
C3 VARDGRGSTLNEALHTN
C4 VARDGRGSTLNEALHTN
C5 VARDGRGSTLNEALHTN
C6 VARDGRGSTLNEALHTN
*****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
C2 ---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
C3 ---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
C4 ---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
C5 CTGACCGCCGTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
C6 CTGACCGCCGTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
*****************************************
C1 GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
C2 GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
C3 GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
C4 GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
C5 GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
C6 GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
**************************************************
C1 TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
C2 TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
C3 TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
C4 TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
C5 TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
C6 TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
**************************************************
C1 CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
C2 CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
C3 CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
C4 CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
C5 CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
C6 CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
**************************************************
C1 GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
C2 GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
C3 GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
C4 GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
C5 GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
C6 GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
**************************************************
C1 ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
C2 ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
C3 ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
C4 ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
C5 ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
C6 ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
**************************************************
C1 GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
C2 GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
C3 GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
C4 GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
C5 GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
C6 GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
**************************************************
C1 GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
C2 GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
C3 GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
C4 GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
C5 GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
C6 GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
**************************************************
C1 GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
C2 GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
C3 GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
C4 GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
C5 GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
C6 GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
**************************************************
C1 TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
C2 TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
C3 TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
C4 TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
C5 TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
C6 TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
**************************************************
C1 CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
C2 CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
C3 CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
C4 CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
C5 CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
C6 CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
**************************************************
C1 TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
C2 TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
C3 TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
C4 TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
C5 TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
C6 TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
**************************************************
C1 GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
C2 GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
C3 GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
C4 GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
C5 GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
C6 GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
**************************************************
C1 CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
C2 CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
C3 CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
C4 CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
C5 CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
C6 CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
**************************************************
C1 TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
C2 TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
C3 TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
C4 TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
C5 TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
C6 TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
**************************************************
C1 ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
C2 ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
C3 ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
C4 ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
C5 ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
C6 ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
**************************************************
C1 CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
C2 CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
C3 CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
C4 CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
C5 CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
C6 CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
**************************************************
C1 TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
C2 TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
C3 TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
C4 TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
C5 TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
C6 TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
**************************************************
C1 GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
C2 GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
C3 GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
C4 GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
C5 GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
C6 GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
**************************************************
C1 GCACACTAAC---------
C2 GCACACTAAC---------
C3 GCACACTAAC---------
C4 GCACACTAAC---------
C5 GCACACTAAC---------
C6 GCACACTAAC---------
**********
>C1
---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C2
---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C3
---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C4
---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C5
CTGACCGCCGTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C6
CTGACCGCCGTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C1
oooVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C2
oooVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C3
oooVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C4
oooVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C5
LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C6
LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 969 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855112
Setting output file names to "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1260811340
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5095584338
Seed = 854024468
Swapseed = 1579855112
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 8 unique site patterns
Division 2 has 7 unique site patterns
Division 3 has 7 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2143.376146 -- -24.965149
Chain 2 -- -2144.131849 -- -24.965149
Chain 3 -- -2144.131728 -- -24.965149
Chain 4 -- -2143.376269 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2142.578565 -- -24.965149
Chain 2 -- -2144.845443 -- -24.965149
Chain 3 -- -2143.376269 -- -24.965149
Chain 4 -- -2144.845443 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2143.376] (-2144.132) (-2144.132) (-2143.376) * [-2142.579] (-2144.845) (-2143.376) (-2144.845)
500 -- (-1335.516) (-1312.212) (-1313.558) [-1326.867] * (-1346.036) (-1329.783) (-1313.549) [-1309.603] -- 0:00:00
1000 -- (-1311.763) [-1309.948] (-1307.031) (-1322.090) * (-1317.229) (-1331.141) (-1313.781) [-1308.669] -- 0:16:39
1500 -- (-1305.596) (-1314.941) (-1306.442) [-1308.465] * [-1307.394] (-1310.824) (-1310.649) (-1313.627) -- 0:11:05
2000 -- (-1307.724) (-1316.723) (-1306.937) [-1312.163] * (-1305.285) [-1309.466] (-1307.984) (-1311.995) -- 0:08:19
2500 -- (-1305.561) [-1308.938] (-1312.894) (-1305.076) * [-1311.443] (-1308.528) (-1310.618) (-1313.830) -- 0:06:39
3000 -- (-1310.926) [-1314.097] (-1318.387) (-1313.590) * (-1319.687) [-1305.857] (-1314.635) (-1311.325) -- 0:05:32
3500 -- [-1305.906] (-1309.653) (-1308.920) (-1313.433) * (-1307.740) (-1311.647) [-1312.778] (-1316.275) -- 0:04:44
4000 -- (-1307.272) [-1309.471] (-1310.720) (-1311.480) * [-1307.999] (-1316.167) (-1309.163) (-1306.573) -- 0:04:09
4500 -- (-1313.319) (-1309.234) (-1318.915) [-1309.134] * [-1307.617] (-1308.136) (-1320.747) (-1305.302) -- 0:03:41
5000 -- (-1310.421) [-1311.945] (-1315.591) (-1312.390) * (-1310.147) (-1313.806) (-1311.188) [-1307.829] -- 0:03:19
Average standard deviation of split frequencies: 0.097274
5500 -- (-1309.463) [-1314.624] (-1309.470) (-1310.237) * (-1309.647) [-1306.718] (-1317.291) (-1306.502) -- 0:03:00
6000 -- (-1313.656) (-1309.784) (-1314.155) [-1307.423] * (-1310.785) (-1320.363) [-1303.209] (-1307.562) -- 0:02:45
6500 -- (-1306.387) (-1313.188) (-1312.470) [-1301.000] * [-1303.511] (-1309.745) (-1313.242) (-1309.583) -- 0:02:32
7000 -- (-1317.468) (-1314.653) [-1312.480] (-1300.962) * (-1301.644) [-1312.021] (-1311.411) (-1306.788) -- 0:02:21
7500 -- [-1310.048] (-1316.493) (-1311.551) (-1300.907) * (-1301.010) (-1317.310) [-1313.266] (-1307.238) -- 0:02:12
8000 -- (-1308.715) (-1311.842) [-1310.296] (-1301.097) * (-1302.491) (-1305.541) (-1310.431) [-1308.590] -- 0:02:04
8500 -- (-1309.498) (-1310.124) [-1309.606] (-1299.631) * [-1299.912] (-1310.981) (-1306.797) (-1313.451) -- 0:01:56
9000 -- (-1310.790) [-1313.854] (-1315.939) (-1300.079) * (-1301.850) [-1309.728] (-1307.187) (-1310.408) -- 0:01:50
9500 -- (-1311.929) (-1313.955) [-1308.109] (-1303.617) * (-1302.755) [-1309.114] (-1314.089) (-1311.036) -- 0:01:44
10000 -- (-1313.336) (-1317.165) (-1312.656) [-1304.130] * (-1303.399) [-1309.882] (-1310.463) (-1308.159) -- 0:01:39
Average standard deviation of split frequencies: 0.090598
10500 -- (-1311.635) (-1316.162) [-1314.486] (-1304.307) * (-1303.594) (-1310.133) [-1305.709] (-1310.301) -- 0:01:34
11000 -- (-1309.077) (-1312.242) [-1315.647] (-1306.004) * (-1306.896) (-1315.809) (-1318.304) [-1310.334] -- 0:01:29
11500 -- (-1309.634) (-1314.566) [-1311.724] (-1302.472) * (-1304.533) (-1313.527) (-1308.450) [-1316.463] -- 0:01:25
12000 -- (-1309.865) (-1314.034) [-1307.696] (-1306.968) * (-1300.998) (-1306.624) [-1313.762] (-1317.485) -- 0:02:44
12500 -- (-1318.857) (-1306.746) (-1317.336) [-1300.386] * (-1300.887) [-1308.691] (-1312.540) (-1309.251) -- 0:02:38
13000 -- (-1311.061) (-1317.721) [-1309.736] (-1300.583) * [-1301.323] (-1321.615) (-1307.921) (-1308.084) -- 0:02:31
13500 -- (-1321.822) (-1308.206) (-1305.617) [-1301.169] * [-1304.047] (-1316.541) (-1316.608) (-1314.558) -- 0:02:26
14000 -- (-1311.443) (-1309.234) [-1314.948] (-1300.664) * [-1301.724] (-1308.422) (-1312.671) (-1312.234) -- 0:02:20
14500 -- (-1310.830) (-1311.768) (-1308.155) [-1302.262] * (-1300.361) [-1311.329] (-1318.939) (-1305.862) -- 0:02:15
15000 -- (-1320.221) [-1306.613] (-1311.799) (-1300.928) * (-1299.730) [-1307.536] (-1310.313) (-1312.673) -- 0:02:11
Average standard deviation of split frequencies: 0.049105
15500 -- (-1312.006) (-1305.555) [-1311.995] (-1301.646) * (-1300.392) [-1309.944] (-1312.889) (-1310.540) -- 0:02:07
16000 -- (-1307.937) [-1310.520] (-1308.607) (-1300.976) * (-1299.556) [-1311.589] (-1308.340) (-1307.028) -- 0:02:03
16500 -- [-1309.090] (-1310.830) (-1309.733) (-1306.635) * [-1300.121] (-1308.913) (-1318.164) (-1308.530) -- 0:01:59
17000 -- [-1310.450] (-1313.380) (-1312.605) (-1301.751) * (-1302.138) (-1311.099) (-1313.593) [-1308.762] -- 0:01:55
17500 -- (-1313.083) [-1309.213] (-1321.746) (-1301.590) * (-1306.415) [-1313.886] (-1314.084) (-1306.644) -- 0:01:52
18000 -- (-1311.507) (-1309.490) [-1313.387] (-1300.328) * (-1303.250) [-1311.803] (-1305.160) (-1318.659) -- 0:01:49
18500 -- [-1307.099] (-1309.334) (-1309.983) (-1301.017) * (-1301.636) [-1305.592] (-1311.393) (-1307.403) -- 0:01:46
19000 -- [-1311.962] (-1309.634) (-1321.316) (-1300.184) * (-1304.344) [-1308.525] (-1314.224) (-1310.615) -- 0:01:43
19500 -- [-1311.111] (-1311.015) (-1315.099) (-1300.188) * (-1304.476) (-1314.729) (-1314.135) [-1312.819] -- 0:01:40
20000 -- [-1306.863] (-1309.081) (-1323.219) (-1303.107) * (-1301.834) (-1308.269) [-1306.346] (-1305.862) -- 0:01:38
Average standard deviation of split frequencies: 0.050689
20500 -- [-1308.343] (-1320.797) (-1308.263) (-1302.670) * (-1300.832) (-1319.763) (-1307.655) [-1314.408] -- 0:01:35
21000 -- (-1306.480) [-1311.489] (-1302.610) (-1302.783) * (-1301.296) [-1309.139] (-1310.109) (-1311.638) -- 0:01:33
21500 -- (-1317.956) [-1305.406] (-1302.840) (-1301.349) * (-1304.857) [-1316.079] (-1314.129) (-1308.782) -- 0:01:31
22000 -- [-1308.473] (-1311.498) (-1307.000) (-1301.480) * (-1302.768) (-1309.770) (-1303.631) [-1312.044] -- 0:01:28
22500 -- [-1310.835] (-1307.075) (-1304.003) (-1301.277) * (-1302.032) (-1308.379) (-1304.724) [-1312.591] -- 0:01:26
23000 -- (-1312.592) [-1310.136] (-1301.185) (-1305.586) * (-1301.230) [-1312.571] (-1300.801) (-1312.249) -- 0:01:24
23500 -- (-1312.189) [-1304.323] (-1306.062) (-1304.009) * (-1300.182) (-1315.088) (-1301.405) [-1309.790] -- 0:01:23
24000 -- (-1311.406) [-1308.295] (-1300.986) (-1308.002) * (-1301.497) (-1322.251) [-1303.417] (-1317.171) -- 0:01:21
24500 -- (-1309.204) [-1313.038] (-1303.048) (-1307.901) * (-1300.725) (-1310.370) [-1303.148] (-1308.839) -- 0:01:59
25000 -- (-1310.026) [-1311.816] (-1306.741) (-1304.790) * [-1301.880] (-1310.117) (-1299.766) (-1312.681) -- 0:01:57
Average standard deviation of split frequencies: 0.039558
25500 -- (-1312.654) [-1315.126] (-1303.848) (-1304.408) * (-1300.774) (-1305.861) [-1301.001] (-1313.290) -- 0:01:54
26000 -- [-1313.274] (-1309.903) (-1300.935) (-1304.582) * [-1300.618] (-1309.357) (-1304.848) (-1313.650) -- 0:01:52
26500 -- (-1314.445) (-1312.568) (-1301.124) [-1305.108] * (-1301.198) (-1302.930) [-1300.020] (-1312.068) -- 0:01:50
27000 -- [-1308.433] (-1313.801) (-1301.981) (-1302.131) * (-1300.684) [-1302.333] (-1301.814) (-1310.805) -- 0:01:48
27500 -- (-1302.783) [-1316.475] (-1300.925) (-1302.873) * (-1301.438) (-1304.369) (-1301.813) [-1315.625] -- 0:01:46
28000 -- (-1306.163) [-1308.535] (-1300.597) (-1300.864) * (-1300.315) (-1303.295) (-1302.713) [-1308.155] -- 0:01:44
28500 -- (-1305.060) [-1306.577] (-1301.767) (-1300.755) * (-1300.580) (-1301.225) [-1302.744] (-1315.178) -- 0:01:42
29000 -- (-1304.803) (-1307.976) [-1301.932] (-1300.910) * [-1300.687] (-1300.529) (-1301.438) (-1315.333) -- 0:01:40
29500 -- (-1306.095) [-1309.964] (-1301.517) (-1303.677) * [-1301.228] (-1302.635) (-1301.265) (-1311.268) -- 0:01:38
30000 -- (-1302.587) (-1310.601) [-1301.907] (-1305.666) * [-1299.751] (-1302.440) (-1301.265) (-1310.309) -- 0:01:37
Average standard deviation of split frequencies: 0.053802
30500 -- (-1304.556) (-1323.322) (-1303.465) [-1301.441] * (-1300.352) (-1300.125) (-1310.450) [-1316.121] -- 0:01:35
31000 -- (-1304.171) [-1307.423] (-1301.354) (-1301.277) * (-1299.922) [-1300.435] (-1303.593) (-1314.205) -- 0:01:33
31500 -- (-1305.721) (-1318.782) (-1301.248) [-1300.607] * [-1300.196] (-1300.030) (-1300.371) (-1303.809) -- 0:01:32
32000 -- (-1304.849) [-1302.511] (-1303.727) (-1302.583) * [-1300.587] (-1300.053) (-1303.284) (-1312.583) -- 0:01:30
32500 -- (-1308.183) [-1299.704] (-1303.714) (-1303.547) * (-1300.767) (-1301.248) (-1301.765) [-1306.854] -- 0:01:29
33000 -- (-1303.767) [-1300.650] (-1302.519) (-1303.176) * (-1306.297) [-1302.632] (-1301.798) (-1310.533) -- 0:01:27
33500 -- (-1303.254) (-1300.918) (-1304.722) [-1299.994] * [-1299.761] (-1301.401) (-1300.855) (-1310.677) -- 0:01:26
34000 -- (-1303.906) [-1302.394] (-1304.735) (-1300.100) * (-1301.121) [-1300.382] (-1301.767) (-1310.106) -- 0:01:25
34500 -- (-1304.534) [-1301.540] (-1304.006) (-1305.071) * (-1300.670) (-1303.249) [-1301.321] (-1314.782) -- 0:01:23
35000 -- (-1306.304) [-1301.056] (-1303.651) (-1300.848) * (-1300.769) (-1306.828) (-1303.122) [-1305.161] -- 0:01:22
Average standard deviation of split frequencies: 0.054249
35500 -- (-1303.372) [-1302.914] (-1303.908) (-1300.143) * (-1304.518) (-1302.116) [-1302.744] (-1318.829) -- 0:01:21
36000 -- [-1304.271] (-1303.982) (-1300.743) (-1301.850) * [-1299.856] (-1301.396) (-1302.544) (-1314.385) -- 0:01:20
36500 -- [-1302.306] (-1303.979) (-1300.961) (-1305.238) * (-1303.250) (-1301.719) [-1307.127] (-1312.180) -- 0:01:45
37000 -- (-1301.222) [-1300.420] (-1300.038) (-1300.196) * (-1303.028) (-1302.745) [-1305.020] (-1309.891) -- 0:01:44
37500 -- (-1302.187) (-1300.824) [-1302.766] (-1299.869) * [-1302.201] (-1304.124) (-1300.839) (-1306.884) -- 0:01:42
38000 -- (-1301.380) (-1302.965) (-1305.608) [-1301.961] * [-1301.382] (-1303.576) (-1303.650) (-1306.329) -- 0:01:41
38500 -- (-1302.551) (-1300.906) (-1302.958) [-1300.577] * (-1302.690) [-1303.170] (-1301.284) (-1302.210) -- 0:01:39
39000 -- (-1302.074) [-1303.279] (-1301.617) (-1304.584) * (-1302.259) [-1302.341] (-1302.604) (-1303.051) -- 0:01:38
39500 -- [-1302.644] (-1301.095) (-1299.987) (-1302.807) * (-1301.503) [-1300.984] (-1301.953) (-1310.675) -- 0:01:37
40000 -- (-1300.285) [-1301.459] (-1301.083) (-1305.710) * (-1300.798) (-1305.181) [-1300.427] (-1314.916) -- 0:01:36
Average standard deviation of split frequencies: 0.043608
40500 -- (-1300.707) [-1303.025] (-1302.091) (-1300.293) * (-1301.243) (-1306.714) [-1302.406] (-1310.847) -- 0:01:34
41000 -- [-1302.564] (-1300.753) (-1300.288) (-1300.734) * (-1300.544) (-1305.279) (-1300.785) [-1305.994] -- 0:01:33
41500 -- (-1301.717) (-1301.609) [-1299.792] (-1300.368) * (-1300.634) (-1304.350) [-1300.959] (-1308.490) -- 0:01:32
42000 -- (-1306.551) (-1301.648) [-1301.434] (-1299.565) * [-1299.681] (-1310.155) (-1300.260) (-1313.577) -- 0:01:31
42500 -- (-1300.300) (-1300.967) (-1299.876) [-1299.980] * [-1299.540] (-1306.141) (-1302.319) (-1314.053) -- 0:01:30
43000 -- (-1303.922) (-1301.793) [-1300.310] (-1299.631) * (-1300.202) [-1306.071] (-1303.079) (-1311.340) -- 0:01:29
43500 -- (-1301.300) [-1301.069] (-1299.657) (-1301.808) * [-1301.801] (-1303.146) (-1302.905) (-1313.266) -- 0:01:27
44000 -- (-1301.399) (-1300.398) (-1300.623) [-1299.692] * (-1303.421) (-1300.655) (-1301.338) [-1312.098] -- 0:01:26
44500 -- [-1301.311] (-1302.971) (-1300.670) (-1299.791) * (-1301.686) [-1301.969] (-1301.266) (-1318.936) -- 0:01:25
45000 -- (-1300.720) (-1303.148) [-1300.449] (-1301.851) * (-1302.803) (-1300.120) (-1299.686) [-1316.927] -- 0:01:24
Average standard deviation of split frequencies: 0.038197
45500 -- (-1300.200) [-1304.684] (-1301.841) (-1300.069) * (-1302.083) [-1299.942] (-1302.304) (-1310.503) -- 0:01:23
46000 -- (-1301.029) (-1303.056) (-1301.387) [-1299.612] * (-1302.372) [-1300.082] (-1301.689) (-1309.956) -- 0:01:22
46500 -- [-1300.959] (-1302.635) (-1302.984) (-1299.763) * [-1301.903] (-1303.915) (-1301.152) (-1315.307) -- 0:01:22
47000 -- [-1301.253] (-1305.162) (-1306.011) (-1300.333) * (-1303.640) [-1300.995] (-1305.021) (-1312.474) -- 0:01:21
47500 -- (-1304.017) (-1304.732) (-1305.606) [-1300.561] * (-1304.181) [-1300.609] (-1303.957) (-1314.079) -- 0:01:20
48000 -- (-1303.566) [-1302.380] (-1306.223) (-1303.695) * (-1302.971) (-1300.195) (-1301.008) [-1308.407] -- 0:01:19
48500 -- (-1301.456) [-1302.835] (-1307.437) (-1301.317) * (-1303.424) (-1303.308) [-1304.902] (-1314.122) -- 0:01:18
49000 -- (-1303.048) (-1304.148) [-1300.559] (-1300.709) * (-1300.656) (-1301.963) [-1303.016] (-1313.164) -- 0:01:37
49500 -- (-1302.291) [-1302.437] (-1302.648) (-1303.149) * (-1303.256) (-1302.725) [-1302.489] (-1309.423) -- 0:01:36
50000 -- (-1301.859) [-1301.968] (-1302.598) (-1302.430) * [-1301.721] (-1300.661) (-1302.690) (-1325.144) -- 0:01:35
Average standard deviation of split frequencies: 0.042976
50500 -- (-1304.699) [-1300.865] (-1301.562) (-1304.085) * (-1304.022) (-1300.420) [-1302.336] (-1308.767) -- 0:01:34
51000 -- (-1302.921) (-1300.884) [-1300.730] (-1302.679) * (-1303.501) [-1300.464] (-1306.273) (-1310.716) -- 0:01:33
51500 -- (-1301.703) (-1306.321) [-1301.701] (-1301.438) * [-1300.397] (-1300.160) (-1305.183) (-1309.954) -- 0:01:32
52000 -- (-1301.494) [-1308.187] (-1301.740) (-1302.420) * [-1302.711] (-1301.003) (-1303.144) (-1311.705) -- 0:01:31
52500 -- (-1303.691) (-1302.350) (-1301.844) [-1303.936] * [-1302.665] (-1300.131) (-1300.609) (-1308.880) -- 0:01:30
53000 -- (-1303.854) (-1305.181) [-1301.391] (-1303.777) * (-1302.566) (-1301.549) [-1300.934] (-1309.291) -- 0:01:29
53500 -- (-1302.956) (-1303.933) [-1302.185] (-1304.161) * (-1304.773) (-1301.870) (-1302.276) [-1312.574] -- 0:01:28
54000 -- [-1301.743] (-1299.825) (-1300.511) (-1302.105) * (-1300.984) (-1301.982) [-1303.367] (-1303.069) -- 0:01:27
54500 -- [-1302.894] (-1300.665) (-1301.900) (-1303.116) * (-1302.615) (-1307.061) [-1302.100] (-1302.589) -- 0:01:26
55000 -- (-1299.859) [-1299.952] (-1300.066) (-1303.233) * (-1302.017) (-1306.073) [-1302.365] (-1303.686) -- 0:01:25
Average standard deviation of split frequencies: 0.041669
55500 -- (-1300.452) (-1299.847) (-1300.054) [-1302.130] * [-1299.795] (-1301.301) (-1301.581) (-1305.777) -- 0:01:25
56000 -- (-1300.449) (-1300.663) [-1302.384] (-1300.779) * (-1300.014) [-1300.830] (-1301.587) (-1306.734) -- 0:01:24
56500 -- (-1300.589) (-1302.234) [-1301.268] (-1299.496) * (-1301.154) [-1300.807] (-1301.477) (-1305.233) -- 0:01:23
57000 -- (-1300.082) [-1301.765] (-1303.404) (-1299.601) * (-1303.648) [-1300.992] (-1301.790) (-1302.887) -- 0:01:22
57500 -- (-1302.436) (-1301.770) (-1303.374) [-1300.247] * [-1303.958] (-1300.225) (-1301.147) (-1302.598) -- 0:01:21
58000 -- (-1302.911) (-1301.825) (-1303.238) [-1300.424] * (-1307.927) [-1300.707] (-1301.052) (-1304.696) -- 0:01:21
58500 -- (-1301.901) [-1300.200] (-1303.122) (-1301.604) * (-1305.908) (-1299.706) (-1302.209) [-1302.076] -- 0:01:20
59000 -- (-1300.028) [-1300.408] (-1300.054) (-1303.525) * (-1301.399) [-1300.020] (-1302.944) (-1305.298) -- 0:01:19
59500 -- (-1302.829) (-1301.796) (-1302.102) [-1301.136] * (-1301.269) (-1299.999) [-1302.680] (-1306.173) -- 0:01:19
60000 -- (-1301.228) (-1300.265) [-1302.835] (-1301.588) * [-1301.223] (-1303.355) (-1303.348) (-1308.465) -- 0:01:18
Average standard deviation of split frequencies: 0.029446
60500 -- (-1302.213) (-1304.570) [-1300.941] (-1304.688) * (-1303.338) (-1302.999) (-1301.528) [-1300.368] -- 0:01:17
61000 -- (-1302.580) [-1303.516] (-1304.636) (-1305.961) * (-1306.353) (-1301.130) (-1302.150) [-1300.974] -- 0:01:16
61500 -- (-1300.568) (-1300.999) (-1300.984) [-1302.835] * (-1306.756) (-1301.418) [-1299.997] (-1300.777) -- 0:01:31
62000 -- (-1300.878) (-1301.966) (-1302.878) [-1301.306] * [-1304.063] (-1302.478) (-1300.290) (-1300.604) -- 0:01:30
62500 -- (-1303.700) [-1305.051] (-1302.589) (-1303.835) * (-1305.016) (-1301.900) [-1304.266] (-1306.431) -- 0:01:30
63000 -- (-1300.806) [-1302.763] (-1300.856) (-1301.430) * [-1303.484] (-1301.891) (-1304.097) (-1302.402) -- 0:01:29
63500 -- (-1301.529) (-1300.835) (-1299.912) [-1301.097] * (-1302.499) (-1303.034) (-1304.554) [-1302.684] -- 0:01:28
64000 -- [-1303.357] (-1302.481) (-1300.195) (-1300.732) * (-1303.291) [-1302.745] (-1301.409) (-1303.286) -- 0:01:27
64500 -- (-1300.822) (-1302.158) (-1300.236) [-1301.625] * (-1301.985) (-1302.040) [-1301.471] (-1303.081) -- 0:01:27
65000 -- [-1300.493] (-1303.332) (-1301.450) (-1301.543) * (-1301.901) (-1301.532) [-1304.878] (-1300.866) -- 0:01:26
Average standard deviation of split frequencies: 0.031070
65500 -- (-1299.744) [-1301.455] (-1300.119) (-1301.329) * (-1300.401) (-1302.064) (-1303.590) [-1303.412] -- 0:01:25
66000 -- (-1302.469) (-1303.175) [-1300.497] (-1303.539) * (-1301.615) [-1302.586] (-1303.699) (-1300.526) -- 0:01:24
66500 -- [-1303.985] (-1301.965) (-1301.925) (-1302.132) * (-1302.676) (-1300.929) (-1301.343) [-1302.115] -- 0:01:24
67000 -- (-1302.744) [-1302.799] (-1300.234) (-1302.803) * (-1302.639) [-1299.968] (-1301.191) (-1300.727) -- 0:01:23
67500 -- (-1300.986) [-1302.981] (-1301.326) (-1303.219) * [-1301.462] (-1302.595) (-1300.539) (-1301.465) -- 0:01:22
68000 -- (-1300.237) (-1301.781) [-1302.077] (-1302.073) * (-1305.554) (-1301.659) (-1300.434) [-1299.708] -- 0:01:22
68500 -- [-1299.744] (-1300.143) (-1302.391) (-1306.581) * [-1301.104] (-1300.681) (-1301.318) (-1299.997) -- 0:01:21
69000 -- [-1299.462] (-1303.992) (-1306.882) (-1305.312) * (-1302.801) (-1301.142) (-1299.725) [-1301.090] -- 0:01:20
69500 -- (-1300.591) (-1302.135) [-1301.313] (-1305.708) * (-1305.834) (-1300.842) (-1300.834) [-1300.379] -- 0:01:20
70000 -- (-1300.064) [-1301.645] (-1300.971) (-1306.993) * (-1304.827) [-1304.183] (-1303.947) (-1300.748) -- 0:01:19
Average standard deviation of split frequencies: 0.030352
70500 -- (-1306.318) (-1300.300) [-1300.223] (-1300.737) * (-1304.540) (-1308.098) (-1304.894) [-1300.583] -- 0:01:19
71000 -- (-1302.281) [-1301.243] (-1302.759) (-1300.776) * (-1303.712) (-1302.967) [-1304.059] (-1300.143) -- 0:01:18
71500 -- (-1300.306) [-1301.597] (-1301.191) (-1303.625) * (-1303.593) [-1300.043] (-1302.902) (-1301.367) -- 0:01:17
72000 -- [-1300.624] (-1302.257) (-1302.027) (-1303.499) * [-1301.566] (-1299.782) (-1301.747) (-1300.299) -- 0:01:17
72500 -- (-1302.052) (-1301.868) (-1302.235) [-1304.612] * (-1304.941) [-1301.271] (-1305.785) (-1301.272) -- 0:01:16
73000 -- [-1299.960] (-1300.754) (-1302.252) (-1304.950) * [-1303.437] (-1302.206) (-1299.976) (-1301.629) -- 0:01:16
73500 -- (-1300.741) [-1301.510] (-1302.117) (-1302.056) * (-1301.345) [-1300.327] (-1299.604) (-1303.544) -- 0:01:15
74000 -- [-1300.581] (-1300.545) (-1299.860) (-1302.015) * [-1302.030] (-1303.213) (-1302.666) (-1301.868) -- 0:01:27
74500 -- (-1301.158) (-1301.664) [-1300.264] (-1301.521) * [-1300.818] (-1304.203) (-1300.256) (-1302.074) -- 0:01:26
75000 -- [-1300.018] (-1301.887) (-1300.377) (-1299.948) * (-1302.165) (-1301.818) [-1302.473] (-1302.330) -- 0:01:26
Average standard deviation of split frequencies: 0.031666
75500 -- (-1304.049) [-1301.656] (-1305.679) (-1300.925) * (-1305.662) [-1300.010] (-1299.882) (-1300.187) -- 0:01:25
76000 -- (-1304.701) (-1300.136) (-1308.083) [-1300.449] * (-1301.430) [-1300.915] (-1299.987) (-1301.828) -- 0:01:25
76500 -- (-1300.997) [-1300.265] (-1301.153) (-1300.207) * (-1301.566) (-1302.145) (-1300.453) [-1301.385] -- 0:01:24
77000 -- (-1301.088) [-1300.845] (-1304.066) (-1300.149) * (-1301.997) (-1306.465) (-1301.183) [-1300.428] -- 0:01:23
77500 -- (-1301.031) (-1300.375) [-1302.052] (-1301.883) * (-1303.310) [-1302.927] (-1301.833) (-1303.339) -- 0:01:23
78000 -- [-1303.007] (-1302.962) (-1300.850) (-1301.386) * (-1302.400) [-1307.462] (-1300.752) (-1301.771) -- 0:01:22
78500 -- (-1304.903) (-1302.225) (-1300.698) [-1302.568] * [-1303.846] (-1307.957) (-1299.575) (-1301.371) -- 0:01:22
79000 -- [-1303.410] (-1306.540) (-1300.424) (-1302.231) * (-1303.146) (-1302.863) (-1303.194) [-1300.024] -- 0:01:21
79500 -- (-1302.566) (-1306.448) (-1301.306) [-1302.028] * (-1303.838) (-1303.514) (-1304.056) [-1300.241] -- 0:01:21
80000 -- (-1302.055) [-1301.832] (-1300.615) (-1302.465) * (-1303.431) [-1301.488] (-1304.151) (-1299.868) -- 0:01:20
Average standard deviation of split frequencies: 0.031849
80500 -- (-1300.712) [-1301.688] (-1300.611) (-1302.924) * (-1300.041) (-1301.576) [-1301.562] (-1300.608) -- 0:01:19
81000 -- (-1303.364) [-1302.241] (-1300.556) (-1300.983) * (-1300.045) (-1301.149) (-1302.551) [-1301.887] -- 0:01:19
81500 -- (-1301.723) (-1301.430) (-1303.755) [-1302.102] * (-1299.998) (-1302.726) [-1301.955] (-1302.582) -- 0:01:18
82000 -- (-1300.200) (-1303.436) (-1305.770) [-1302.722] * (-1300.302) (-1302.635) [-1299.628] (-1303.972) -- 0:01:18
82500 -- [-1303.792] (-1302.284) (-1301.711) (-1300.318) * (-1300.146) (-1302.964) [-1302.202] (-1300.881) -- 0:01:17
83000 -- (-1307.093) (-1301.977) (-1302.994) [-1300.128] * (-1301.964) (-1301.176) [-1302.344] (-1300.133) -- 0:01:17
83500 -- (-1303.482) [-1301.188] (-1303.824) (-1302.024) * (-1301.656) (-1301.735) (-1302.019) [-1301.784] -- 0:01:16
84000 -- (-1301.056) (-1301.249) (-1304.759) [-1299.833] * [-1300.091] (-1305.350) (-1300.695) (-1302.520) -- 0:01:16
84500 -- [-1300.892] (-1300.554) (-1305.693) (-1302.580) * (-1300.094) (-1300.617) [-1300.451] (-1300.156) -- 0:01:15
85000 -- (-1302.220) (-1300.750) [-1301.613] (-1302.167) * (-1304.403) [-1300.554] (-1304.676) (-1300.691) -- 0:01:15
Average standard deviation of split frequencies: 0.030422
85500 -- (-1302.513) (-1301.980) (-1301.162) [-1303.642] * [-1304.204] (-1300.347) (-1300.369) (-1300.633) -- 0:01:14
86000 -- (-1301.853) (-1302.579) [-1301.561] (-1303.637) * (-1301.667) [-1300.168] (-1301.173) (-1302.029) -- 0:01:14
86500 -- (-1302.261) [-1300.214] (-1303.311) (-1301.912) * (-1300.622) (-1300.235) [-1301.989] (-1301.564) -- 0:01:13
87000 -- [-1306.849] (-1300.629) (-1301.600) (-1303.135) * (-1300.749) (-1300.061) (-1302.956) [-1300.128] -- 0:01:13
87500 -- (-1310.685) (-1301.235) (-1301.614) [-1301.841] * [-1300.506] (-1302.485) (-1302.575) (-1300.363) -- 0:01:23
88000 -- (-1307.521) (-1301.037) (-1304.863) [-1300.905] * (-1302.620) (-1308.899) (-1302.487) [-1301.611] -- 0:01:22
88500 -- [-1304.007] (-1301.014) (-1303.695) (-1305.031) * (-1300.038) (-1303.100) (-1302.296) [-1304.021] -- 0:01:22
89000 -- [-1305.131] (-1301.663) (-1301.788) (-1303.722) * (-1301.027) (-1301.500) (-1301.134) [-1303.860] -- 0:01:21
89500 -- (-1304.225) (-1305.657) (-1306.179) [-1300.620] * (-1300.701) (-1302.779) [-1300.593] (-1301.923) -- 0:01:21
90000 -- (-1302.266) (-1302.161) (-1302.539) [-1301.556] * (-1300.536) (-1302.121) (-1300.757) [-1302.848] -- 0:01:20
Average standard deviation of split frequencies: 0.032017
90500 -- (-1301.728) [-1303.231] (-1302.795) (-1302.110) * (-1300.606) (-1307.625) [-1300.726] (-1302.390) -- 0:01:20
91000 -- [-1300.663] (-1301.201) (-1300.002) (-1302.214) * (-1302.022) (-1302.555) [-1300.923] (-1300.997) -- 0:01:19
91500 -- [-1301.360] (-1301.529) (-1301.296) (-1301.717) * [-1302.481] (-1304.501) (-1300.822) (-1301.930) -- 0:01:19
92000 -- (-1304.170) (-1301.464) (-1301.496) [-1306.272] * (-1302.292) (-1307.525) [-1301.309] (-1301.636) -- 0:01:18
92500 -- (-1302.648) (-1303.832) [-1304.623] (-1307.664) * (-1300.775) (-1301.084) [-1303.817] (-1300.849) -- 0:01:18
93000 -- (-1300.567) (-1304.928) (-1300.583) [-1307.340] * (-1304.752) (-1304.449) (-1301.506) [-1300.980] -- 0:01:18
93500 -- (-1305.003) (-1302.813) (-1303.136) [-1301.397] * [-1302.809] (-1305.048) (-1304.797) (-1302.005) -- 0:01:17
94000 -- (-1303.952) (-1302.160) [-1303.743] (-1302.046) * [-1301.563] (-1302.041) (-1300.440) (-1302.001) -- 0:01:17
94500 -- (-1303.033) (-1303.106) [-1301.247] (-1301.201) * [-1300.403] (-1301.252) (-1300.139) (-1303.162) -- 0:01:16
95000 -- (-1301.746) [-1305.245] (-1301.607) (-1300.008) * (-1304.165) [-1300.227] (-1300.221) (-1304.286) -- 0:01:16
Average standard deviation of split frequencies: 0.026103
95500 -- (-1300.471) (-1301.944) (-1302.052) [-1306.628] * [-1302.864] (-1302.422) (-1300.651) (-1303.034) -- 0:01:15
96000 -- (-1299.905) (-1301.653) [-1301.760] (-1303.470) * [-1300.518] (-1303.960) (-1300.653) (-1304.024) -- 0:01:15
96500 -- (-1300.929) [-1301.577] (-1303.486) (-1299.508) * (-1300.703) (-1307.585) (-1301.143) [-1302.448] -- 0:01:14
97000 -- [-1301.606] (-1302.299) (-1306.644) (-1302.905) * [-1300.752] (-1303.890) (-1302.998) (-1301.728) -- 0:01:14
97500 -- (-1300.199) (-1302.729) [-1302.880] (-1304.300) * (-1300.693) (-1300.631) (-1300.505) [-1300.653] -- 0:01:14
98000 -- (-1304.579) (-1301.046) (-1303.779) [-1304.341] * (-1304.197) (-1301.478) [-1299.801] (-1303.104) -- 0:01:13
98500 -- (-1300.769) (-1301.898) (-1308.188) [-1301.967] * (-1300.599) [-1300.286] (-1299.692) (-1302.845) -- 0:01:13
99000 -- [-1299.767] (-1302.284) (-1307.143) (-1303.690) * [-1301.933] (-1302.929) (-1301.646) (-1302.083) -- 0:01:12
99500 -- (-1300.401) (-1301.793) (-1303.692) [-1306.337] * [-1300.608] (-1303.309) (-1301.277) (-1301.642) -- 0:01:21
100000 -- (-1303.344) [-1300.862] (-1304.907) (-1304.555) * (-1305.620) (-1302.361) (-1299.918) [-1300.215] -- 0:01:21
Average standard deviation of split frequencies: 0.019833
100500 -- (-1301.588) [-1300.722] (-1305.105) (-1305.763) * (-1300.705) [-1303.311] (-1300.208) (-1304.198) -- 0:01:20
101000 -- [-1301.092] (-1301.253) (-1301.911) (-1302.276) * (-1302.431) [-1304.607] (-1306.452) (-1301.777) -- 0:01:20
101500 -- (-1300.019) [-1304.799] (-1302.284) (-1301.021) * [-1301.142] (-1301.710) (-1306.050) (-1301.353) -- 0:01:19
102000 -- (-1301.174) (-1302.260) [-1302.293] (-1300.572) * (-1301.319) [-1301.333] (-1307.789) (-1299.713) -- 0:01:19
102500 -- [-1304.174] (-1300.957) (-1302.221) (-1300.687) * [-1301.055] (-1303.166) (-1306.574) (-1299.711) -- 0:01:18
103000 -- (-1301.980) (-1301.279) (-1305.876) [-1300.628] * (-1300.172) (-1303.060) [-1303.118] (-1300.876) -- 0:01:18
103500 -- (-1302.364) (-1303.631) (-1306.381) [-1303.112] * [-1302.291] (-1302.539) (-1303.197) (-1300.094) -- 0:01:17
104000 -- (-1300.723) [-1302.872] (-1301.119) (-1303.434) * (-1300.424) [-1302.277] (-1303.999) (-1300.542) -- 0:01:17
104500 -- [-1302.736] (-1302.984) (-1301.674) (-1302.401) * (-1303.432) [-1301.481] (-1307.726) (-1301.973) -- 0:01:17
105000 -- (-1302.432) (-1300.684) (-1300.314) [-1303.342] * [-1301.622] (-1300.472) (-1307.426) (-1302.696) -- 0:01:16
Average standard deviation of split frequencies: 0.020364
105500 -- (-1303.072) [-1302.232] (-1301.683) (-1304.043) * (-1299.530) (-1301.926) (-1307.416) [-1301.390] -- 0:01:16
106000 -- (-1303.181) (-1306.749) [-1302.260] (-1308.005) * (-1299.767) (-1301.927) (-1302.008) [-1299.576] -- 0:01:15
106500 -- (-1302.128) (-1305.652) (-1299.790) [-1304.624] * (-1300.014) [-1303.850] (-1301.229) (-1300.588) -- 0:01:15
107000 -- (-1307.094) (-1302.215) [-1300.072] (-1302.086) * (-1301.003) (-1307.051) (-1300.474) [-1300.601] -- 0:01:15
107500 -- (-1301.725) [-1301.697] (-1300.368) (-1301.344) * [-1301.634] (-1301.648) (-1301.316) (-1300.577) -- 0:01:14
108000 -- (-1301.855) (-1301.675) (-1301.028) [-1301.503] * (-1302.688) (-1302.910) [-1300.333] (-1303.250) -- 0:01:14
108500 -- (-1303.180) (-1302.429) [-1300.979] (-1301.954) * [-1301.207] (-1303.973) (-1301.206) (-1301.242) -- 0:01:13
109000 -- (-1304.085) [-1303.249] (-1299.464) (-1302.948) * (-1300.421) (-1301.056) (-1301.744) [-1302.466] -- 0:01:13
109500 -- (-1301.092) [-1302.148] (-1299.464) (-1302.424) * (-1300.032) (-1304.814) [-1302.480] (-1304.486) -- 0:01:13
110000 -- (-1300.893) (-1302.538) [-1300.241] (-1301.004) * [-1300.505] (-1302.229) (-1300.070) (-1304.844) -- 0:01:12
Average standard deviation of split frequencies: 0.019405
110500 -- (-1303.638) (-1302.724) (-1301.755) [-1300.384] * (-1301.464) (-1303.012) (-1299.878) [-1300.669] -- 0:01:12
111000 -- [-1302.560] (-1302.395) (-1302.449) (-1302.414) * (-1301.136) (-1303.284) [-1300.294] (-1301.179) -- 0:01:12
111500 -- (-1308.007) (-1299.916) (-1306.587) [-1300.321] * (-1300.891) (-1302.755) (-1299.576) [-1300.876] -- 0:01:11
112000 -- (-1301.860) (-1301.423) (-1305.433) [-1303.227] * (-1300.410) (-1303.537) (-1299.643) [-1300.341] -- 0:01:11
112500 -- (-1300.251) (-1305.045) (-1302.792) [-1300.895] * (-1301.037) [-1300.501] (-1302.882) (-1300.358) -- 0:01:18
113000 -- (-1302.194) (-1304.159) [-1302.270] (-1301.762) * (-1301.283) [-1300.442] (-1302.773) (-1300.624) -- 0:01:18
113500 -- [-1302.920] (-1303.412) (-1305.100) (-1301.468) * (-1300.831) [-1300.654] (-1300.409) (-1302.722) -- 0:01:18
114000 -- (-1306.957) (-1303.935) (-1308.284) [-1299.671] * (-1301.348) [-1303.292] (-1301.962) (-1301.828) -- 0:01:17
114500 -- [-1303.848] (-1301.058) (-1300.478) (-1299.662) * (-1301.488) (-1301.133) (-1300.064) [-1303.286] -- 0:01:17
115000 -- (-1303.936) [-1300.501] (-1300.791) (-1299.806) * (-1301.080) (-1301.777) (-1300.323) [-1302.827] -- 0:01:16
Average standard deviation of split frequencies: 0.022125
115500 -- (-1301.869) [-1300.882] (-1301.549) (-1299.720) * (-1302.125) (-1300.594) [-1301.512] (-1300.610) -- 0:01:16
116000 -- (-1304.744) [-1300.783] (-1303.409) (-1299.691) * (-1301.148) (-1300.409) (-1304.128) [-1301.251] -- 0:01:16
116500 -- [-1301.350] (-1301.613) (-1303.218) (-1300.609) * (-1307.053) (-1300.256) (-1302.814) [-1300.200] -- 0:01:15
117000 -- (-1301.702) (-1301.964) [-1301.093] (-1301.832) * (-1300.166) (-1302.075) (-1302.554) [-1300.910] -- 0:01:15
117500 -- (-1301.724) (-1301.444) (-1299.961) [-1303.759] * (-1300.111) (-1301.224) (-1301.505) [-1300.325] -- 0:01:15
118000 -- [-1302.111] (-1300.574) (-1300.395) (-1302.171) * (-1299.773) (-1300.190) (-1301.756) [-1299.944] -- 0:01:14
118500 -- (-1301.220) (-1300.718) (-1303.604) [-1304.572] * (-1305.053) (-1301.473) [-1301.818] (-1302.094) -- 0:01:14
119000 -- (-1302.975) [-1301.101] (-1301.688) (-1302.554) * (-1300.733) [-1301.869] (-1304.176) (-1302.723) -- 0:01:14
119500 -- (-1301.758) (-1300.169) (-1306.061) [-1301.080] * (-1300.350) [-1304.182] (-1302.689) (-1301.747) -- 0:01:13
120000 -- (-1299.555) (-1302.475) [-1302.868] (-1303.607) * (-1301.192) (-1301.449) (-1302.897) [-1305.760] -- 0:01:13
Average standard deviation of split frequencies: 0.023851
120500 -- (-1299.999) (-1302.175) (-1301.066) [-1303.306] * (-1300.724) [-1301.088] (-1302.565) (-1302.573) -- 0:01:12
121000 -- (-1303.920) (-1301.437) (-1300.059) [-1300.977] * (-1303.182) (-1303.406) (-1304.696) [-1301.126] -- 0:01:12
121500 -- (-1301.434) (-1302.745) (-1301.490) [-1303.386] * (-1303.366) (-1306.061) (-1304.145) [-1300.187] -- 0:01:12
122000 -- [-1301.810] (-1303.596) (-1302.016) (-1304.988) * (-1303.663) [-1301.258] (-1302.051) (-1300.271) -- 0:01:11
122500 -- (-1301.326) (-1302.239) [-1304.412] (-1302.919) * (-1303.060) (-1301.147) [-1301.058] (-1305.444) -- 0:01:11
123000 -- (-1300.239) (-1304.593) (-1300.901) [-1301.958] * [-1307.449] (-1301.253) (-1301.497) (-1305.752) -- 0:01:11
123500 -- (-1300.090) (-1304.006) (-1303.180) [-1300.650] * (-1306.836) (-1300.759) [-1300.158] (-1307.052) -- 0:01:10
124000 -- (-1299.869) (-1306.613) [-1302.235] (-1302.350) * (-1305.526) (-1300.993) (-1300.191) [-1304.320] -- 0:01:10
124500 -- (-1307.179) (-1306.968) [-1300.528] (-1300.230) * (-1301.211) [-1301.736] (-1300.468) (-1305.622) -- 0:01:10
125000 -- (-1305.858) (-1304.050) [-1300.114] (-1302.495) * (-1301.464) [-1300.015] (-1300.560) (-1304.337) -- 0:01:17
Average standard deviation of split frequencies: 0.022054
125500 -- [-1303.916] (-1304.243) (-1302.587) (-1301.403) * (-1302.121) (-1302.297) [-1300.541] (-1310.048) -- 0:01:16
126000 -- (-1305.299) (-1302.399) (-1303.321) [-1301.962] * (-1300.631) (-1302.392) [-1300.221] (-1307.973) -- 0:01:16
126500 -- (-1302.490) (-1305.868) (-1300.070) [-1300.238] * (-1303.307) (-1303.400) [-1300.060] (-1302.340) -- 0:01:15
127000 -- (-1305.533) (-1304.342) [-1302.872] (-1303.497) * [-1304.299] (-1302.587) (-1303.459) (-1299.905) -- 0:01:15
127500 -- (-1300.515) (-1301.922) (-1302.996) [-1303.238] * [-1301.972] (-1300.286) (-1301.010) (-1300.062) -- 0:01:15
128000 -- (-1300.516) (-1306.718) (-1302.098) [-1302.664] * [-1301.348] (-1302.583) (-1303.745) (-1300.633) -- 0:01:14
128500 -- (-1300.817) (-1307.312) [-1301.092] (-1301.154) * (-1301.102) (-1303.859) (-1300.374) [-1301.164] -- 0:01:14
129000 -- (-1299.915) (-1303.470) [-1299.956] (-1302.922) * (-1300.486) [-1300.196] (-1306.240) (-1302.618) -- 0:01:14
129500 -- [-1302.941] (-1302.948) (-1302.651) (-1301.502) * (-1307.984) [-1302.126] (-1304.161) (-1305.859) -- 0:01:13
130000 -- (-1300.810) (-1302.151) (-1303.194) [-1302.166] * (-1301.712) (-1300.556) (-1304.428) [-1305.674] -- 0:01:13
Average standard deviation of split frequencies: 0.023450
130500 -- [-1301.511] (-1301.249) (-1301.136) (-1302.979) * (-1304.971) (-1302.100) [-1303.410] (-1302.674) -- 0:01:13
131000 -- [-1302.350] (-1300.600) (-1309.909) (-1302.984) * (-1303.703) (-1303.845) [-1304.079] (-1303.548) -- 0:01:12
131500 -- [-1303.061] (-1300.580) (-1308.617) (-1300.292) * (-1302.017) (-1300.628) (-1303.181) [-1306.827] -- 0:01:12
132000 -- (-1303.614) [-1300.224] (-1305.811) (-1300.242) * [-1300.960] (-1301.187) (-1302.262) (-1307.300) -- 0:01:12
132500 -- (-1302.388) [-1301.143] (-1302.576) (-1300.054) * (-1301.348) [-1299.513] (-1303.453) (-1306.446) -- 0:01:12
133000 -- (-1304.486) [-1300.332] (-1304.435) (-1300.057) * [-1304.248] (-1304.704) (-1301.162) (-1300.361) -- 0:01:11
133500 -- (-1300.594) (-1301.039) (-1302.769) [-1300.817] * (-1301.676) (-1303.018) [-1301.609] (-1300.560) -- 0:01:11
134000 -- (-1301.100) (-1300.381) (-1303.096) [-1301.012] * (-1300.448) (-1301.255) (-1301.713) [-1300.152] -- 0:01:11
134500 -- [-1302.696] (-1302.416) (-1303.162) (-1301.311) * [-1300.222] (-1300.178) (-1303.683) (-1302.130) -- 0:01:10
135000 -- (-1304.329) (-1303.804) (-1303.874) [-1300.008] * (-1301.737) (-1302.120) [-1302.117] (-1302.128) -- 0:01:10
Average standard deviation of split frequencies: 0.020980
135500 -- [-1302.041] (-1304.158) (-1301.952) (-1300.040) * (-1301.159) (-1302.310) (-1302.496) [-1304.398] -- 0:01:10
136000 -- (-1301.850) (-1301.097) [-1301.384] (-1299.849) * (-1303.427) (-1301.975) (-1307.119) [-1301.304] -- 0:01:09
136500 -- (-1301.573) (-1302.056) [-1304.681] (-1300.736) * (-1303.524) [-1302.594] (-1307.941) (-1303.952) -- 0:01:09
137000 -- (-1301.998) [-1300.742] (-1301.127) (-1301.035) * (-1302.873) (-1303.303) (-1302.803) [-1303.373] -- 0:01:09
137500 -- (-1305.126) (-1302.255) (-1302.427) [-1301.035] * (-1302.455) [-1304.572] (-1301.816) (-1301.896) -- 0:01:09
138000 -- (-1304.985) [-1302.621] (-1302.711) (-1300.570) * (-1301.708) (-1305.047) (-1300.373) [-1300.473] -- 0:01:08
138500 -- (-1303.346) [-1301.978] (-1301.616) (-1302.324) * [-1304.184] (-1304.780) (-1302.576) (-1302.206) -- 0:01:14
139000 -- (-1301.994) (-1303.039) [-1300.419] (-1300.526) * (-1301.896) (-1305.460) [-1301.592] (-1299.653) -- 0:01:14
139500 -- [-1302.921] (-1300.957) (-1302.762) (-1303.146) * (-1303.630) [-1301.667] (-1301.850) (-1300.373) -- 0:01:14
140000 -- [-1301.645] (-1300.015) (-1303.012) (-1303.060) * [-1302.567] (-1302.439) (-1301.057) (-1300.579) -- 0:01:13
Average standard deviation of split frequencies: 0.019578
140500 -- (-1303.607) (-1302.199) (-1303.448) [-1300.217] * (-1303.254) (-1301.436) [-1303.794] (-1301.265) -- 0:01:13
141000 -- (-1301.055) [-1301.128] (-1302.436) (-1300.511) * (-1305.830) [-1301.490] (-1302.657) (-1302.746) -- 0:01:13
141500 -- (-1300.193) [-1299.711] (-1300.658) (-1302.537) * [-1304.924] (-1301.630) (-1309.001) (-1304.773) -- 0:01:12
142000 -- (-1301.464) (-1301.826) [-1302.124] (-1303.066) * (-1303.021) (-1301.547) [-1301.581] (-1300.323) -- 0:01:12
142500 -- (-1300.992) (-1300.544) [-1299.746] (-1301.073) * (-1304.166) (-1301.480) (-1302.422) [-1300.319] -- 0:01:12
143000 -- (-1301.467) [-1303.216] (-1303.541) (-1300.927) * (-1300.858) (-1303.299) [-1303.232] (-1300.725) -- 0:01:11
143500 -- (-1300.819) (-1300.442) [-1303.114] (-1302.958) * (-1300.880) (-1302.071) [-1302.217] (-1300.128) -- 0:01:11
144000 -- (-1302.757) (-1303.000) (-1300.160) [-1303.523] * (-1306.279) (-1304.313) (-1301.411) [-1301.548] -- 0:01:11
144500 -- [-1301.498] (-1304.556) (-1301.449) (-1303.127) * (-1304.894) (-1301.777) (-1303.754) [-1302.003] -- 0:01:11
145000 -- (-1305.069) (-1304.678) [-1301.204] (-1301.764) * (-1302.052) [-1303.431] (-1301.258) (-1301.812) -- 0:01:10
Average standard deviation of split frequencies: 0.020053
145500 -- (-1306.078) (-1303.924) (-1300.697) [-1301.930] * [-1301.222] (-1304.207) (-1303.372) (-1303.258) -- 0:01:10
146000 -- (-1302.983) [-1300.853] (-1301.805) (-1303.600) * (-1303.201) (-1302.928) (-1302.700) [-1301.493] -- 0:01:10
146500 -- (-1301.876) (-1303.245) (-1305.010) [-1302.311] * (-1303.330) (-1301.226) [-1300.078] (-1304.328) -- 0:01:09
147000 -- (-1304.559) (-1303.266) [-1300.566] (-1303.943) * (-1303.013) (-1305.177) (-1300.268) [-1303.872] -- 0:01:09
147500 -- (-1304.321) (-1302.560) [-1302.119] (-1302.023) * [-1303.102] (-1303.018) (-1299.653) (-1301.254) -- 0:01:09
148000 -- (-1303.667) (-1306.626) (-1302.652) [-1301.071] * (-1304.192) (-1304.998) [-1299.557] (-1299.687) -- 0:01:09
148500 -- (-1302.452) (-1305.673) [-1304.840] (-1303.102) * (-1303.706) [-1303.302] (-1300.092) (-1299.687) -- 0:01:08
149000 -- (-1300.674) (-1302.664) [-1301.149] (-1300.894) * (-1303.651) (-1302.854) [-1304.102] (-1303.417) -- 0:01:08
149500 -- (-1303.871) [-1302.525] (-1304.022) (-1302.124) * (-1303.370) (-1301.454) (-1307.119) [-1301.758] -- 0:01:08
150000 -- (-1300.983) (-1303.184) [-1307.858] (-1301.059) * (-1301.874) (-1300.668) (-1303.435) [-1301.624] -- 0:01:08
Average standard deviation of split frequencies: 0.018303
150500 -- (-1302.010) (-1306.477) (-1303.623) [-1299.853] * [-1300.398] (-1303.038) (-1303.439) (-1300.555) -- 0:01:07
151000 -- [-1302.166] (-1309.466) (-1301.201) (-1302.939) * (-1301.064) (-1306.376) (-1303.764) [-1300.839] -- 0:01:07
151500 -- [-1300.842] (-1305.308) (-1300.074) (-1300.881) * [-1309.745] (-1306.518) (-1301.669) (-1302.139) -- 0:01:07
152000 -- [-1300.485] (-1302.286) (-1300.643) (-1303.794) * [-1301.167] (-1301.778) (-1303.496) (-1302.146) -- 0:01:12
152500 -- (-1302.051) [-1300.205] (-1300.357) (-1302.186) * (-1301.821) (-1304.095) (-1301.505) [-1300.601] -- 0:01:12
153000 -- (-1299.453) (-1307.419) (-1300.923) [-1303.712] * (-1301.061) (-1302.070) (-1301.921) [-1300.604] -- 0:01:11
153500 -- [-1300.536] (-1302.625) (-1300.254) (-1300.288) * (-1301.419) (-1304.084) [-1300.659] (-1300.989) -- 0:01:11
154000 -- (-1301.572) [-1301.859] (-1300.480) (-1302.553) * (-1301.540) (-1306.392) (-1300.257) [-1300.053] -- 0:01:11
154500 -- [-1299.517] (-1301.399) (-1301.818) (-1304.560) * (-1303.896) (-1303.116) (-1305.326) [-1302.439] -- 0:01:11
155000 -- (-1300.167) [-1299.637] (-1301.290) (-1309.887) * (-1303.069) (-1300.592) [-1302.393] (-1303.055) -- 0:01:10
Average standard deviation of split frequencies: 0.018282
155500 -- (-1299.632) [-1303.831] (-1301.477) (-1306.966) * (-1300.055) (-1301.476) (-1301.244) [-1302.185] -- 0:01:10
156000 -- (-1300.638) [-1302.504] (-1301.578) (-1303.204) * [-1299.743] (-1301.073) (-1299.982) (-1300.769) -- 0:01:10
156500 -- (-1300.876) (-1301.092) [-1301.959] (-1301.683) * [-1301.649] (-1300.546) (-1300.325) (-1303.034) -- 0:01:10
157000 -- (-1300.668) (-1303.072) [-1303.016] (-1302.023) * (-1301.760) (-1300.251) [-1301.232] (-1307.075) -- 0:01:09
157500 -- (-1301.122) (-1304.467) [-1303.777] (-1302.802) * (-1299.950) (-1303.306) (-1301.624) [-1302.375] -- 0:01:09
158000 -- (-1301.223) (-1302.759) [-1303.347] (-1302.225) * (-1301.530) [-1300.455] (-1303.680) (-1302.464) -- 0:01:09
158500 -- (-1301.709) (-1301.933) (-1302.208) [-1303.528] * [-1300.895] (-1300.819) (-1302.659) (-1302.650) -- 0:01:09
159000 -- (-1301.538) (-1306.619) (-1302.122) [-1300.183] * (-1300.895) [-1302.461] (-1302.004) (-1301.027) -- 0:01:08
159500 -- (-1300.821) [-1303.172] (-1301.994) (-1300.201) * (-1301.843) (-1302.243) (-1305.226) [-1302.405] -- 0:01:08
160000 -- (-1301.542) [-1302.367] (-1301.284) (-1304.493) * (-1301.333) (-1303.612) [-1304.775] (-1303.007) -- 0:01:08
Average standard deviation of split frequencies: 0.017458
160500 -- (-1301.182) (-1302.034) (-1300.325) [-1305.396] * (-1301.523) (-1303.426) [-1300.573] (-1300.390) -- 0:01:07
161000 -- [-1301.556] (-1305.188) (-1302.409) (-1302.886) * (-1299.361) (-1302.114) [-1300.545] (-1301.891) -- 0:01:07
161500 -- [-1301.248] (-1304.199) (-1301.805) (-1309.035) * (-1300.757) [-1301.951] (-1300.602) (-1301.638) -- 0:01:07
162000 -- (-1302.326) [-1300.653] (-1300.517) (-1309.992) * (-1300.609) (-1301.941) [-1300.886] (-1301.309) -- 0:01:07
162500 -- (-1300.436) (-1301.277) (-1302.337) [-1304.579] * (-1299.731) [-1299.991] (-1305.453) (-1299.895) -- 0:01:07
163000 -- (-1301.255) (-1302.568) [-1301.563] (-1303.186) * (-1303.323) (-1303.514) [-1301.155] (-1300.214) -- 0:01:06
163500 -- (-1301.232) (-1303.988) [-1301.251] (-1300.758) * [-1302.500] (-1301.245) (-1300.253) (-1300.006) -- 0:01:06
164000 -- [-1300.721] (-1301.852) (-1304.320) (-1301.036) * (-1300.726) (-1301.842) [-1303.018] (-1303.487) -- 0:01:06
164500 -- (-1304.988) (-1300.001) (-1305.121) [-1301.569] * (-1301.795) (-1300.668) (-1302.813) [-1305.101] -- 0:01:06
165000 -- (-1303.070) [-1300.869] (-1306.094) (-1303.784) * (-1301.453) [-1301.827] (-1302.399) (-1304.324) -- 0:01:05
Average standard deviation of split frequencies: 0.016471
165500 -- (-1302.993) [-1300.987] (-1302.572) (-1305.270) * [-1301.578] (-1301.309) (-1302.558) (-1300.136) -- 0:01:10
166000 -- [-1301.250] (-1301.336) (-1301.653) (-1305.445) * (-1300.450) [-1301.221] (-1302.080) (-1299.567) -- 0:01:10
166500 -- [-1300.104] (-1304.239) (-1303.883) (-1300.887) * (-1300.933) (-1302.481) (-1301.118) [-1300.137] -- 0:01:10
167000 -- (-1304.556) [-1304.239] (-1301.659) (-1300.062) * (-1301.320) (-1301.532) [-1304.602] (-1301.586) -- 0:01:09
167500 -- (-1301.331) (-1311.559) (-1303.857) [-1299.947] * (-1301.763) (-1308.888) [-1304.920] (-1301.398) -- 0:01:09
168000 -- (-1301.638) (-1309.032) (-1301.910) [-1299.960] * [-1302.040] (-1305.486) (-1303.329) (-1304.436) -- 0:01:09
168500 -- (-1301.464) (-1300.184) (-1302.186) [-1300.606] * (-1300.556) [-1300.242] (-1300.985) (-1302.729) -- 0:01:09
169000 -- (-1302.133) [-1301.393] (-1301.319) (-1300.894) * (-1300.737) [-1299.885] (-1302.534) (-1303.195) -- 0:01:08
169500 -- (-1303.748) (-1300.903) (-1301.566) [-1302.562] * (-1303.579) (-1301.845) (-1301.991) [-1303.199] -- 0:01:08
170000 -- [-1300.752] (-1301.657) (-1300.999) (-1302.968) * (-1302.516) (-1301.916) [-1302.711] (-1302.215) -- 0:01:08
Average standard deviation of split frequencies: 0.016711
170500 -- (-1303.803) (-1302.533) (-1301.198) [-1303.044] * [-1302.883] (-1303.420) (-1302.358) (-1303.170) -- 0:01:08
171000 -- (-1301.398) (-1300.818) (-1301.197) [-1305.351] * [-1301.702] (-1299.892) (-1301.477) (-1305.501) -- 0:01:07
171500 -- (-1300.396) (-1302.561) [-1301.532] (-1307.554) * [-1304.681] (-1301.559) (-1300.706) (-1303.517) -- 0:01:07
172000 -- (-1301.618) (-1303.105) [-1299.731] (-1299.895) * [-1300.719] (-1301.655) (-1300.614) (-1302.783) -- 0:01:07
172500 -- [-1299.794] (-1306.617) (-1300.393) (-1302.263) * (-1301.778) (-1305.642) [-1301.483] (-1306.423) -- 0:01:07
173000 -- (-1300.541) [-1304.539] (-1301.454) (-1301.445) * [-1299.563] (-1302.678) (-1301.475) (-1304.939) -- 0:01:06
173500 -- (-1300.801) (-1301.986) [-1301.481] (-1300.649) * (-1299.948) (-1305.623) (-1301.220) [-1302.040] -- 0:01:06
174000 -- (-1300.575) (-1302.567) (-1300.345) [-1302.521] * (-1300.304) (-1301.521) [-1302.207] (-1301.750) -- 0:01:06
174500 -- (-1300.574) [-1300.220] (-1302.345) (-1301.570) * [-1300.687] (-1300.777) (-1304.378) (-1302.267) -- 0:01:06
175000 -- (-1303.739) (-1301.280) [-1302.712] (-1301.362) * (-1301.167) [-1303.887] (-1302.079) (-1301.165) -- 0:01:06
Average standard deviation of split frequencies: 0.015225
175500 -- [-1303.230] (-1300.255) (-1300.921) (-1301.658) * (-1301.102) [-1301.295] (-1302.049) (-1300.592) -- 0:01:05
176000 -- (-1301.375) [-1300.795] (-1300.361) (-1300.708) * [-1300.145] (-1300.203) (-1307.322) (-1301.464) -- 0:01:05
176500 -- (-1303.405) (-1300.795) [-1300.852] (-1300.708) * (-1300.085) (-1300.925) [-1303.193] (-1300.636) -- 0:01:05
177000 -- (-1302.015) [-1303.693] (-1301.441) (-1302.644) * (-1300.770) (-1301.356) [-1301.246] (-1301.247) -- 0:01:05
177500 -- [-1301.930] (-1303.742) (-1301.378) (-1302.558) * (-1300.911) (-1300.667) [-1301.238] (-1300.585) -- 0:01:04
178000 -- (-1302.626) (-1303.544) (-1303.777) [-1303.911] * [-1300.522] (-1301.808) (-1300.733) (-1302.289) -- 0:01:04
178500 -- (-1300.989) (-1301.415) (-1303.021) [-1300.867] * (-1300.673) (-1300.534) (-1300.850) [-1304.018] -- 0:01:04
179000 -- (-1303.376) [-1301.255] (-1300.462) (-1303.137) * (-1301.918) [-1302.264] (-1300.759) (-1303.425) -- 0:01:08
179500 -- (-1305.853) (-1299.990) [-1300.964] (-1302.610) * [-1301.211] (-1302.537) (-1300.182) (-1301.190) -- 0:01:08
180000 -- [-1302.209] (-1301.065) (-1303.160) (-1302.380) * (-1301.212) (-1301.818) [-1299.509] (-1302.399) -- 0:01:08
Average standard deviation of split frequencies: 0.016830
180500 -- (-1302.890) (-1300.853) (-1306.752) [-1301.973] * (-1300.584) (-1305.772) (-1299.968) [-1301.663] -- 0:01:08
181000 -- (-1302.796) [-1302.701] (-1299.929) (-1307.322) * (-1300.294) (-1309.314) (-1301.763) [-1302.446] -- 0:01:07
181500 -- [-1301.169] (-1303.221) (-1304.016) (-1300.063) * (-1299.752) [-1305.708] (-1302.481) (-1301.416) -- 0:01:07
182000 -- (-1300.951) (-1301.482) (-1303.115) [-1300.261] * [-1299.644] (-1304.650) (-1301.844) (-1302.667) -- 0:01:07
182500 -- (-1300.433) (-1300.249) (-1301.971) [-1303.412] * (-1300.581) (-1302.500) (-1303.963) [-1301.063] -- 0:01:07
183000 -- (-1300.181) (-1300.599) [-1301.321] (-1303.150) * [-1300.000] (-1303.346) (-1301.102) (-1300.680) -- 0:01:06
183500 -- (-1302.803) [-1302.290] (-1301.942) (-1301.883) * (-1302.471) (-1305.551) (-1302.298) [-1299.745] -- 0:01:06
184000 -- [-1301.014] (-1304.050) (-1301.054) (-1303.135) * (-1306.142) (-1306.104) [-1301.237] (-1299.940) -- 0:01:06
184500 -- [-1302.498] (-1302.392) (-1301.964) (-1301.792) * [-1301.235] (-1305.349) (-1302.341) (-1301.081) -- 0:01:06
185000 -- (-1301.689) (-1303.695) [-1300.463] (-1302.405) * (-1300.004) (-1302.734) (-1305.133) [-1302.217] -- 0:01:06
Average standard deviation of split frequencies: 0.016776
185500 -- (-1303.947) (-1300.392) [-1303.414] (-1300.448) * (-1300.762) (-1310.975) [-1300.699] (-1300.354) -- 0:01:05
186000 -- (-1302.637) [-1301.849] (-1304.652) (-1303.766) * (-1303.932) [-1300.478] (-1300.923) (-1305.372) -- 0:01:05
186500 -- (-1302.163) (-1300.780) [-1299.859] (-1300.519) * (-1303.089) (-1302.871) [-1300.516] (-1308.096) -- 0:01:05
187000 -- (-1302.281) [-1302.909] (-1300.752) (-1302.789) * (-1305.675) (-1301.390) (-1302.974) [-1302.303] -- 0:01:05
187500 -- (-1300.978) (-1303.317) [-1300.577] (-1302.637) * (-1302.214) [-1303.467] (-1302.411) (-1304.315) -- 0:01:05
188000 -- (-1301.116) (-1302.320) (-1302.015) [-1300.507] * (-1302.970) [-1304.550] (-1306.518) (-1304.320) -- 0:01:04
188500 -- (-1301.100) (-1300.507) (-1301.732) [-1300.500] * (-1303.394) (-1302.181) [-1301.895] (-1303.277) -- 0:01:04
189000 -- (-1300.580) (-1300.373) [-1301.654] (-1302.153) * [-1304.608] (-1300.939) (-1300.133) (-1302.851) -- 0:01:04
189500 -- (-1304.186) [-1300.315] (-1300.867) (-1301.866) * (-1302.991) (-1300.895) (-1300.060) [-1304.264] -- 0:01:04
190000 -- [-1305.105] (-1302.984) (-1301.793) (-1301.766) * (-1302.997) [-1301.434] (-1299.831) (-1303.674) -- 0:01:03
Average standard deviation of split frequencies: 0.017827
190500 -- (-1300.201) (-1303.212) [-1300.678] (-1302.596) * (-1307.252) [-1302.888] (-1301.738) (-1301.114) -- 0:01:03
191000 -- [-1299.530] (-1303.733) (-1302.861) (-1300.231) * (-1305.079) (-1302.430) (-1306.643) [-1302.491] -- 0:01:03
191500 -- (-1302.587) (-1302.566) [-1305.338] (-1301.044) * (-1300.569) [-1302.249] (-1300.286) (-1301.042) -- 0:01:03
192000 -- [-1305.282] (-1302.453) (-1305.500) (-1301.696) * (-1300.205) [-1301.637] (-1301.189) (-1301.589) -- 0:01:07
192500 -- (-1307.965) [-1299.958] (-1307.415) (-1304.967) * (-1301.807) (-1302.818) (-1299.919) [-1302.779] -- 0:01:07
193000 -- (-1303.138) (-1307.365) (-1303.469) [-1306.715] * (-1300.558) (-1299.955) (-1301.457) [-1304.326] -- 0:01:06
193500 -- (-1301.527) (-1302.778) [-1305.117] (-1300.516) * (-1300.578) (-1301.223) (-1303.381) [-1302.741] -- 0:01:06
194000 -- (-1300.949) [-1301.100] (-1303.357) (-1300.542) * (-1302.382) (-1301.519) (-1306.516) [-1303.861] -- 0:01:06
194500 -- (-1300.559) (-1305.692) (-1306.366) [-1300.855] * (-1303.540) [-1307.969] (-1303.271) (-1301.602) -- 0:01:06
195000 -- (-1306.338) (-1303.175) (-1300.828) [-1300.834] * (-1301.378) [-1304.581] (-1301.962) (-1303.328) -- 0:01:06
Average standard deviation of split frequencies: 0.014965
195500 -- (-1300.584) (-1304.583) (-1301.179) [-1300.419] * (-1302.503) (-1303.194) [-1301.057] (-1302.094) -- 0:01:05
196000 -- (-1302.250) (-1305.094) (-1300.662) [-1300.075] * (-1303.286) (-1304.550) (-1300.559) [-1301.498] -- 0:01:05
196500 -- (-1300.031) [-1302.509] (-1301.156) (-1301.322) * (-1305.511) (-1301.448) (-1300.207) [-1302.227] -- 0:01:05
197000 -- (-1302.732) [-1300.913] (-1300.449) (-1299.983) * (-1303.438) (-1299.877) [-1304.111] (-1301.213) -- 0:01:05
197500 -- (-1301.384) (-1300.803) [-1300.694] (-1302.088) * (-1304.526) (-1299.531) (-1301.380) [-1302.224] -- 0:01:05
198000 -- (-1302.412) [-1300.709] (-1300.696) (-1303.649) * (-1305.484) (-1301.285) (-1300.379) [-1300.092] -- 0:01:04
198500 -- (-1303.674) [-1300.746] (-1300.971) (-1301.377) * (-1304.839) (-1302.859) [-1304.486] (-1300.003) -- 0:01:04
199000 -- (-1301.674) [-1302.486] (-1301.497) (-1300.467) * [-1300.300] (-1304.254) (-1300.946) (-1300.916) -- 0:01:04
199500 -- [-1300.597] (-1301.492) (-1300.169) (-1303.048) * [-1300.675] (-1303.106) (-1300.412) (-1301.491) -- 0:01:04
200000 -- [-1302.090] (-1302.736) (-1303.660) (-1302.357) * [-1299.834] (-1304.086) (-1300.910) (-1305.660) -- 0:01:04
Average standard deviation of split frequencies: 0.014878
200500 -- (-1301.748) (-1301.448) [-1306.155] (-1305.441) * (-1300.960) (-1301.183) (-1302.206) [-1301.582] -- 0:01:03
201000 -- (-1306.112) (-1301.860) (-1306.413) [-1301.812] * (-1302.343) [-1300.823] (-1302.702) (-1302.214) -- 0:01:03
201500 -- [-1303.615] (-1301.808) (-1302.519) (-1304.166) * [-1303.220] (-1302.821) (-1302.884) (-1303.872) -- 0:01:03
202000 -- (-1304.596) [-1301.133] (-1306.887) (-1303.130) * (-1302.357) (-1302.942) [-1304.610] (-1300.956) -- 0:01:03
202500 -- [-1305.336] (-1305.732) (-1305.128) (-1306.445) * (-1300.117) (-1300.333) (-1304.593) [-1299.853] -- 0:01:03
203000 -- [-1304.848] (-1301.790) (-1307.198) (-1301.346) * (-1307.331) [-1300.283] (-1301.525) (-1300.311) -- 0:01:02
203500 -- (-1302.082) (-1301.135) (-1303.285) [-1300.765] * (-1302.030) [-1300.150] (-1301.127) (-1302.830) -- 0:01:02
204000 -- (-1301.053) (-1301.928) [-1305.043] (-1301.765) * (-1302.084) (-1302.578) [-1300.348] (-1301.826) -- 0:01:02
204500 -- (-1301.257) (-1300.743) (-1301.772) [-1300.759] * [-1300.297] (-1301.777) (-1301.792) (-1301.188) -- 0:01:02
205000 -- (-1302.723) (-1302.116) [-1300.421] (-1300.869) * (-1301.893) (-1303.531) [-1300.175] (-1300.954) -- 0:01:02
Average standard deviation of split frequencies: 0.014573
205500 -- (-1300.755) (-1302.993) [-1301.180] (-1302.199) * (-1301.222) (-1301.342) [-1300.018] (-1300.743) -- 0:01:05
206000 -- (-1301.011) (-1301.823) (-1301.202) [-1302.198] * (-1301.456) (-1301.648) [-1301.999] (-1302.545) -- 0:01:05
206500 -- (-1301.394) (-1303.138) [-1301.296] (-1302.775) * [-1302.483] (-1305.924) (-1301.701) (-1304.220) -- 0:01:05
207000 -- (-1300.908) (-1302.787) [-1302.007] (-1304.897) * (-1304.124) (-1303.461) [-1300.960] (-1302.565) -- 0:01:05
207500 -- (-1302.109) (-1304.631) (-1306.184) [-1300.453] * (-1303.487) [-1305.760] (-1302.031) (-1303.627) -- 0:01:04
208000 -- (-1302.916) [-1300.486] (-1306.416) (-1301.469) * (-1302.059) [-1300.011] (-1303.201) (-1303.035) -- 0:01:04
208500 -- (-1300.907) (-1300.379) (-1302.999) [-1301.369] * (-1301.116) [-1300.825] (-1301.389) (-1303.466) -- 0:01:04
209000 -- (-1304.867) [-1300.660] (-1302.951) (-1301.059) * (-1300.025) (-1310.333) [-1301.652] (-1306.725) -- 0:01:04
209500 -- (-1305.586) (-1302.212) [-1302.051] (-1301.333) * [-1299.974] (-1309.802) (-1300.820) (-1303.494) -- 0:01:04
210000 -- (-1302.879) (-1303.974) (-1300.745) [-1301.346] * (-1301.330) [-1303.212] (-1305.015) (-1305.698) -- 0:01:03
Average standard deviation of split frequencies: 0.014839
210500 -- (-1304.942) [-1299.945] (-1302.600) (-1300.990) * [-1301.350] (-1300.930) (-1301.974) (-1306.338) -- 0:01:03
211000 -- (-1302.253) (-1299.887) [-1303.753] (-1302.748) * (-1302.533) (-1303.459) [-1300.512] (-1302.940) -- 0:01:03
211500 -- [-1302.515] (-1299.876) (-1301.225) (-1301.127) * (-1302.668) (-1302.288) [-1304.358] (-1300.023) -- 0:01:03
212000 -- [-1300.081] (-1305.394) (-1301.251) (-1300.319) * (-1304.800) (-1302.677) (-1304.455) [-1301.014] -- 0:01:03
212500 -- [-1300.286] (-1301.320) (-1300.603) (-1302.383) * [-1302.134] (-1304.832) (-1304.841) (-1300.412) -- 0:01:03
213000 -- (-1303.318) (-1300.485) (-1300.809) [-1301.021] * [-1307.410] (-1302.266) (-1301.530) (-1301.885) -- 0:01:02
213500 -- (-1303.217) [-1302.583] (-1300.969) (-1300.820) * [-1303.240] (-1304.006) (-1303.211) (-1300.702) -- 0:01:02
214000 -- (-1300.351) (-1302.414) (-1301.556) [-1306.765] * (-1301.287) [-1303.483] (-1304.178) (-1301.808) -- 0:01:02
214500 -- (-1300.579) (-1301.003) (-1301.191) [-1305.340] * [-1299.736] (-1302.029) (-1305.270) (-1301.801) -- 0:01:02
215000 -- [-1301.496] (-1301.123) (-1302.941) (-1301.529) * [-1299.724] (-1302.082) (-1303.276) (-1300.901) -- 0:01:02
Average standard deviation of split frequencies: 0.015507
215500 -- (-1302.189) [-1303.190] (-1303.382) (-1301.372) * [-1302.936] (-1301.932) (-1303.322) (-1301.856) -- 0:01:01
216000 -- (-1302.055) [-1300.503] (-1305.370) (-1302.169) * (-1300.739) [-1300.912] (-1312.031) (-1301.020) -- 0:01:01
216500 -- [-1303.222] (-1306.920) (-1305.277) (-1300.964) * (-1300.285) [-1300.888] (-1303.341) (-1301.731) -- 0:01:01
217000 -- (-1301.826) (-1303.757) (-1300.588) [-1300.241] * [-1300.373] (-1301.112) (-1300.903) (-1302.639) -- 0:01:01
217500 -- (-1301.879) (-1303.932) (-1301.458) [-1300.212] * [-1302.227] (-1302.273) (-1300.395) (-1302.091) -- 0:01:01
218000 -- (-1299.807) (-1300.908) (-1303.182) [-1300.556] * (-1308.680) (-1300.439) [-1299.726] (-1304.512) -- 0:01:00
218500 -- (-1303.669) (-1302.348) [-1301.269] (-1300.870) * (-1300.378) (-1300.421) [-1301.383] (-1302.885) -- 0:01:04
219000 -- (-1302.961) [-1300.399] (-1302.029) (-1300.184) * (-1303.272) (-1301.375) [-1302.909] (-1308.551) -- 0:01:04
219500 -- (-1299.613) (-1300.474) [-1304.549] (-1306.823) * (-1308.202) (-1304.106) (-1301.082) [-1305.882] -- 0:01:04
220000 -- (-1302.063) [-1300.041] (-1303.354) (-1303.475) * (-1305.616) (-1301.412) (-1302.795) [-1306.400] -- 0:01:03
Average standard deviation of split frequencies: 0.014954
220500 -- (-1300.019) [-1300.947] (-1302.530) (-1302.390) * (-1300.253) (-1302.745) [-1302.858] (-1303.156) -- 0:01:03
221000 -- (-1299.899) (-1301.188) (-1307.930) [-1299.517] * (-1301.397) [-1300.759] (-1305.418) (-1304.591) -- 0:01:03
221500 -- (-1300.427) [-1303.249] (-1303.476) (-1304.778) * (-1300.675) (-1299.724) [-1300.308] (-1300.424) -- 0:01:03
222000 -- [-1301.082] (-1302.014) (-1305.012) (-1301.393) * (-1303.345) [-1299.743] (-1299.809) (-1301.193) -- 0:01:03
222500 -- (-1301.371) (-1301.944) [-1301.975] (-1302.134) * [-1300.331] (-1302.234) (-1299.856) (-1305.245) -- 0:01:02
223000 -- (-1300.528) (-1300.824) [-1302.510] (-1301.171) * [-1300.095] (-1303.897) (-1300.836) (-1301.970) -- 0:01:02
223500 -- (-1305.737) [-1300.955] (-1302.002) (-1303.493) * [-1300.554] (-1304.260) (-1301.858) (-1303.058) -- 0:01:02
224000 -- (-1303.363) (-1301.938) (-1303.161) [-1301.168] * [-1300.040] (-1303.988) (-1301.624) (-1304.290) -- 0:01:02
224500 -- (-1303.592) (-1302.470) (-1299.592) [-1303.773] * (-1300.288) [-1303.940] (-1302.950) (-1303.718) -- 0:01:02
225000 -- (-1300.909) [-1301.199] (-1300.795) (-1302.247) * [-1300.892] (-1302.238) (-1303.570) (-1303.209) -- 0:01:02
Average standard deviation of split frequencies: 0.015699
225500 -- (-1302.121) (-1302.026) [-1300.371] (-1301.743) * (-1300.262) (-1302.787) [-1305.115] (-1301.363) -- 0:01:01
226000 -- [-1300.075] (-1302.898) (-1300.009) (-1301.792) * (-1300.172) (-1308.313) (-1302.203) [-1300.039] -- 0:01:01
226500 -- (-1300.184) [-1301.296] (-1300.821) (-1303.824) * [-1303.331] (-1303.711) (-1300.401) (-1300.124) -- 0:01:01
227000 -- (-1301.989) (-1303.029) [-1299.641] (-1301.140) * (-1300.681) (-1303.459) [-1300.446] (-1300.588) -- 0:01:01
227500 -- (-1301.819) (-1301.819) (-1302.410) [-1301.033] * (-1301.287) (-1303.249) [-1300.392] (-1300.627) -- 0:01:01
228000 -- [-1301.589] (-1300.312) (-1300.853) (-1299.828) * [-1300.195] (-1304.838) (-1300.867) (-1300.463) -- 0:01:00
228500 -- [-1300.569] (-1300.069) (-1308.701) (-1303.962) * (-1300.238) (-1307.892) [-1300.864] (-1304.956) -- 0:01:00
229000 -- (-1302.082) (-1304.967) [-1302.895] (-1301.818) * [-1300.228] (-1302.798) (-1302.863) (-1300.496) -- 0:01:00
229500 -- (-1302.445) (-1307.080) [-1302.631] (-1301.986) * (-1300.340) (-1303.851) (-1302.234) [-1300.589] -- 0:01:00
230000 -- (-1302.141) (-1304.394) [-1300.009] (-1304.747) * (-1301.320) [-1303.991] (-1302.456) (-1302.698) -- 0:01:00
Average standard deviation of split frequencies: 0.016962
230500 -- (-1304.895) (-1303.043) (-1300.177) [-1301.572] * (-1302.016) (-1300.687) (-1301.997) [-1300.870] -- 0:01:00
231000 -- (-1302.856) (-1301.028) [-1301.317] (-1300.563) * [-1307.781] (-1304.437) (-1301.856) (-1302.188) -- 0:00:59
231500 -- [-1301.259] (-1300.075) (-1302.294) (-1300.085) * (-1302.427) [-1299.718] (-1303.193) (-1301.671) -- 0:00:59
232000 -- (-1300.454) (-1300.985) (-1301.239) [-1300.127] * (-1302.964) (-1299.876) [-1302.866] (-1301.871) -- 0:01:02
232500 -- (-1302.160) [-1301.500] (-1305.130) (-1305.588) * [-1302.454] (-1300.054) (-1301.771) (-1300.775) -- 0:01:02
233000 -- [-1301.737] (-1301.631) (-1304.511) (-1302.942) * [-1304.870] (-1299.693) (-1300.826) (-1300.777) -- 0:01:02
233500 -- (-1302.010) [-1304.457] (-1303.754) (-1301.894) * (-1300.872) [-1300.686] (-1302.237) (-1300.510) -- 0:01:02
234000 -- (-1301.885) [-1301.586] (-1306.459) (-1303.900) * [-1302.984] (-1300.501) (-1300.741) (-1301.754) -- 0:01:02
234500 -- (-1302.553) (-1304.345) [-1301.851] (-1301.945) * [-1303.060] (-1300.502) (-1304.949) (-1300.550) -- 0:01:02
235000 -- (-1300.672) (-1300.953) [-1300.394] (-1301.785) * (-1304.082) (-1301.854) [-1304.744] (-1300.275) -- 0:01:01
Average standard deviation of split frequencies: 0.015664
235500 -- (-1302.661) (-1301.842) [-1302.125] (-1300.130) * [-1304.490] (-1304.289) (-1301.204) (-1300.635) -- 0:01:01
236000 -- [-1301.893] (-1305.432) (-1299.601) (-1300.324) * (-1302.050) (-1301.269) [-1299.946] (-1301.899) -- 0:01:01
236500 -- (-1301.924) (-1302.942) (-1301.157) [-1300.091] * [-1302.277] (-1304.744) (-1299.518) (-1309.706) -- 0:01:01
237000 -- [-1303.614] (-1302.579) (-1299.645) (-1300.042) * (-1302.813) (-1305.607) (-1302.153) [-1303.192] -- 0:01:01
237500 -- [-1302.527] (-1304.868) (-1300.109) (-1301.264) * (-1302.495) (-1301.550) (-1302.539) [-1303.190] -- 0:01:01
238000 -- (-1304.311) (-1302.424) (-1300.594) [-1299.864] * (-1303.588) (-1301.185) [-1300.814] (-1304.910) -- 0:01:00
238500 -- (-1301.941) (-1303.052) (-1301.169) [-1299.612] * (-1304.238) [-1301.241] (-1301.797) (-1304.882) -- 0:01:00
239000 -- [-1302.041] (-1301.455) (-1302.516) (-1303.270) * (-1305.160) (-1301.093) (-1304.630) [-1304.165] -- 0:01:00
239500 -- [-1302.470] (-1302.215) (-1305.916) (-1304.053) * [-1299.892] (-1302.101) (-1303.070) (-1304.202) -- 0:01:00
240000 -- (-1304.459) (-1302.718) [-1300.598] (-1303.720) * (-1300.977) [-1302.013] (-1303.367) (-1303.896) -- 0:01:00
Average standard deviation of split frequencies: 0.012841
240500 -- (-1304.555) (-1303.556) [-1299.711] (-1303.358) * (-1305.436) (-1305.094) (-1301.252) [-1300.275] -- 0:01:00
241000 -- (-1302.076) (-1303.338) [-1299.990] (-1301.990) * (-1301.521) (-1302.269) [-1301.351] (-1301.532) -- 0:00:59
241500 -- (-1301.603) [-1302.070] (-1301.721) (-1305.507) * (-1302.450) [-1304.827] (-1302.749) (-1300.367) -- 0:00:59
242000 -- [-1301.935] (-1303.210) (-1304.648) (-1302.231) * [-1301.777] (-1301.661) (-1301.522) (-1300.201) -- 0:00:59
242500 -- (-1300.942) (-1302.690) [-1303.781] (-1299.760) * [-1301.824] (-1302.678) (-1302.873) (-1300.611) -- 0:00:59
243000 -- (-1300.637) (-1301.603) [-1303.233] (-1302.867) * (-1301.695) (-1301.609) (-1302.790) [-1300.371] -- 0:00:59
243500 -- (-1300.019) (-1300.520) [-1301.338] (-1301.733) * [-1301.386] (-1303.434) (-1305.216) (-1303.041) -- 0:00:59
244000 -- (-1300.581) [-1301.711] (-1303.065) (-1301.193) * (-1302.676) [-1301.352] (-1300.582) (-1302.642) -- 0:00:58
244500 -- (-1303.064) [-1300.584] (-1302.628) (-1303.199) * [-1302.871] (-1306.517) (-1302.369) (-1303.836) -- 0:00:58
245000 -- [-1301.451] (-1300.527) (-1301.632) (-1302.075) * [-1301.563] (-1301.903) (-1302.572) (-1303.638) -- 0:00:58
Average standard deviation of split frequencies: 0.013095
245500 -- (-1305.115) [-1300.195] (-1302.429) (-1301.651) * [-1300.388] (-1299.879) (-1302.750) (-1303.026) -- 0:01:01
246000 -- [-1300.739] (-1303.407) (-1300.124) (-1301.586) * (-1301.317) [-1301.776] (-1301.419) (-1303.097) -- 0:01:01
246500 -- [-1301.127] (-1301.200) (-1300.893) (-1302.481) * (-1301.003) [-1300.379] (-1301.112) (-1302.886) -- 0:01:01
247000 -- (-1301.099) (-1300.336) [-1301.324] (-1301.159) * [-1299.886] (-1302.965) (-1300.390) (-1301.573) -- 0:01:00
247500 -- (-1303.725) [-1300.450] (-1300.890) (-1302.973) * [-1300.662] (-1306.024) (-1303.378) (-1300.932) -- 0:01:00
248000 -- (-1302.548) (-1300.389) (-1301.685) [-1302.722] * (-1301.410) (-1304.217) (-1304.551) [-1300.941] -- 0:01:00
248500 -- (-1301.473) (-1300.370) [-1304.201] (-1302.259) * (-1300.627) (-1301.731) [-1300.193] (-1301.752) -- 0:01:00
249000 -- (-1300.838) (-1302.050) (-1302.474) [-1300.990] * (-1302.807) [-1301.602] (-1301.800) (-1302.593) -- 0:01:00
249500 -- (-1304.765) [-1302.775] (-1302.406) (-1300.200) * (-1300.158) [-1303.956] (-1302.729) (-1302.133) -- 0:01:00
250000 -- (-1307.326) [-1301.916] (-1303.186) (-1299.522) * (-1299.661) (-1302.042) [-1301.892] (-1305.742) -- 0:01:00
Average standard deviation of split frequencies: 0.014160
250500 -- (-1304.283) [-1301.946] (-1303.985) (-1299.652) * (-1299.872) (-1299.892) (-1303.875) [-1303.667] -- 0:00:59
251000 -- (-1302.764) (-1301.447) (-1302.907) [-1301.409] * (-1299.709) (-1301.628) [-1301.897] (-1307.454) -- 0:00:59
251500 -- [-1299.513] (-1301.663) (-1302.830) (-1302.969) * (-1301.018) [-1302.396] (-1303.123) (-1302.263) -- 0:00:59
252000 -- (-1300.058) (-1302.923) [-1303.686] (-1302.258) * [-1305.010] (-1299.940) (-1304.794) (-1301.862) -- 0:00:59
252500 -- [-1301.509] (-1300.517) (-1300.425) (-1300.293) * (-1306.081) (-1300.778) (-1302.720) [-1303.573] -- 0:00:59
253000 -- (-1300.481) (-1301.101) [-1299.925] (-1300.616) * [-1306.373] (-1302.707) (-1304.283) (-1304.546) -- 0:00:59
253500 -- (-1301.881) (-1300.416) [-1300.666] (-1302.381) * (-1302.090) (-1300.354) [-1301.511] (-1300.853) -- 0:00:58
254000 -- (-1300.549) (-1303.790) [-1300.010] (-1299.663) * (-1301.870) [-1300.102] (-1304.810) (-1302.204) -- 0:00:58
254500 -- (-1301.027) [-1304.765] (-1300.512) (-1304.642) * (-1300.856) (-1301.467) [-1300.936] (-1302.658) -- 0:00:58
255000 -- (-1300.899) [-1313.138] (-1301.480) (-1310.137) * (-1304.497) (-1300.947) (-1300.500) [-1302.969] -- 0:00:58
Average standard deviation of split frequencies: 0.014840
255500 -- (-1300.899) (-1304.462) [-1300.653] (-1306.282) * (-1300.687) (-1302.040) (-1302.204) [-1300.954] -- 0:00:58
256000 -- (-1300.730) [-1304.098] (-1300.720) (-1301.768) * (-1299.885) (-1300.812) [-1301.849] (-1303.418) -- 0:00:58
256500 -- (-1301.945) (-1301.963) (-1301.701) [-1300.411] * (-1303.507) [-1301.565] (-1302.673) (-1304.720) -- 0:00:57
257000 -- [-1300.009] (-1302.972) (-1301.379) (-1303.430) * [-1302.863] (-1299.983) (-1301.392) (-1302.588) -- 0:00:57
257500 -- (-1299.860) (-1306.167) (-1301.020) [-1303.410] * (-1304.849) [-1300.617] (-1301.744) (-1305.223) -- 0:00:57
258000 -- [-1299.801] (-1300.803) (-1300.920) (-1301.440) * (-1301.536) [-1300.678] (-1301.127) (-1301.046) -- 0:00:57
258500 -- (-1300.494) [-1301.210] (-1304.790) (-1301.772) * (-1301.845) (-1310.914) [-1300.221] (-1301.173) -- 0:00:57
259000 -- (-1300.193) [-1301.764] (-1303.212) (-1301.802) * (-1301.881) (-1303.145) [-1301.653] (-1303.801) -- 0:01:00
259500 -- (-1303.127) (-1301.291) [-1301.833] (-1302.075) * (-1302.688) (-1302.549) [-1301.455] (-1305.439) -- 0:00:59
260000 -- (-1305.273) (-1302.992) [-1303.559] (-1301.369) * (-1303.666) (-1302.828) [-1302.726] (-1301.803) -- 0:00:59
Average standard deviation of split frequencies: 0.016063
260500 -- (-1300.975) (-1301.332) (-1304.137) [-1302.028] * (-1302.490) (-1300.584) (-1302.673) [-1300.115] -- 0:00:59
261000 -- (-1301.245) (-1300.472) [-1304.614] (-1301.141) * (-1303.425) [-1302.072] (-1303.301) (-1301.139) -- 0:00:59
261500 -- [-1301.642] (-1300.509) (-1306.260) (-1303.484) * (-1299.989) (-1301.030) [-1300.509] (-1306.404) -- 0:00:59
262000 -- (-1303.857) (-1301.450) [-1302.259] (-1302.161) * [-1300.559] (-1299.505) (-1300.929) (-1305.555) -- 0:00:59
262500 -- (-1304.698) (-1301.437) (-1303.322) [-1300.548] * (-1304.029) (-1300.484) [-1301.500] (-1303.540) -- 0:00:59
263000 -- (-1300.171) (-1303.375) [-1303.730] (-1300.501) * (-1302.682) (-1303.537) [-1300.909] (-1299.644) -- 0:00:58
263500 -- [-1300.068] (-1302.145) (-1300.476) (-1301.608) * (-1302.653) (-1301.306) [-1301.373] (-1299.837) -- 0:00:58
264000 -- (-1300.652) (-1301.396) (-1301.201) [-1301.084] * (-1302.335) [-1304.413] (-1300.959) (-1303.006) -- 0:00:58
264500 -- [-1301.756] (-1300.359) (-1306.569) (-1301.595) * [-1301.139] (-1302.686) (-1302.418) (-1302.185) -- 0:00:58
265000 -- [-1301.533] (-1302.431) (-1305.894) (-1300.316) * (-1306.808) (-1306.786) (-1301.271) [-1302.198] -- 0:00:58
Average standard deviation of split frequencies: 0.014907
265500 -- (-1300.975) [-1303.099] (-1304.998) (-1301.957) * (-1301.893) (-1302.224) (-1300.631) [-1303.274] -- 0:00:58
266000 -- (-1301.741) [-1302.490] (-1302.349) (-1304.425) * (-1300.374) [-1299.807] (-1305.960) (-1301.720) -- 0:00:57
266500 -- (-1302.038) (-1303.298) (-1300.148) [-1306.423] * (-1302.737) (-1305.405) [-1301.891] (-1303.564) -- 0:00:57
267000 -- (-1300.248) (-1300.347) (-1302.845) [-1300.883] * (-1302.405) [-1301.942] (-1302.753) (-1302.542) -- 0:00:57
267500 -- [-1300.273] (-1300.983) (-1301.910) (-1303.888) * (-1301.034) (-1305.442) [-1300.143] (-1303.037) -- 0:00:57
268000 -- [-1301.537] (-1303.394) (-1300.491) (-1299.674) * (-1312.527) (-1303.859) [-1303.311] (-1302.078) -- 0:00:57
268500 -- (-1301.340) (-1302.510) [-1301.387] (-1299.755) * (-1301.037) (-1304.279) [-1303.173] (-1300.065) -- 0:00:57
269000 -- (-1301.492) (-1301.682) (-1304.645) [-1303.794] * (-1300.836) (-1302.942) [-1303.488] (-1301.792) -- 0:00:57
269500 -- (-1307.636) (-1303.611) (-1303.954) [-1301.857] * [-1300.912] (-1299.906) (-1307.439) (-1301.733) -- 0:00:56
270000 -- (-1302.427) (-1301.551) (-1303.195) [-1300.862] * (-1300.401) [-1301.719] (-1303.883) (-1303.111) -- 0:00:56
Average standard deviation of split frequencies: 0.015965
270500 -- (-1302.380) (-1300.655) [-1301.817] (-1303.222) * (-1300.224) (-1305.044) [-1301.717] (-1300.998) -- 0:00:56
271000 -- (-1302.037) [-1300.202] (-1300.828) (-1302.751) * (-1305.351) [-1303.996] (-1300.497) (-1315.240) -- 0:00:56
271500 -- (-1301.431) (-1301.032) (-1300.419) [-1301.232] * (-1300.703) (-1302.338) (-1300.306) [-1302.830] -- 0:00:56
272000 -- (-1301.097) (-1299.877) (-1300.983) [-1302.251] * [-1300.586] (-1300.339) (-1300.622) (-1302.523) -- 0:00:56
272500 -- (-1305.086) (-1300.795) [-1301.917] (-1304.691) * (-1299.753) (-1300.731) (-1299.923) [-1301.724] -- 0:00:58
273000 -- (-1308.497) (-1304.276) (-1301.931) [-1303.523] * (-1303.387) (-1304.259) (-1300.610) [-1301.892] -- 0:00:58
273500 -- (-1305.017) [-1301.503] (-1300.966) (-1299.839) * (-1302.640) (-1302.899) (-1300.066) [-1302.475] -- 0:00:58
274000 -- (-1301.438) (-1301.729) [-1300.233] (-1299.971) * (-1300.513) (-1303.932) [-1302.713] (-1300.923) -- 0:00:58
274500 -- (-1300.363) (-1302.720) [-1302.614] (-1304.107) * [-1302.811] (-1300.831) (-1302.465) (-1301.207) -- 0:00:58
275000 -- [-1299.966] (-1305.656) (-1300.703) (-1301.964) * (-1305.845) (-1303.562) (-1302.609) [-1304.151] -- 0:00:58
Average standard deviation of split frequencies: 0.015673
275500 -- (-1300.541) (-1302.815) (-1300.813) [-1302.930] * [-1303.592] (-1307.760) (-1301.992) (-1306.005) -- 0:00:57
276000 -- (-1299.785) (-1302.444) [-1300.849] (-1304.953) * [-1301.199] (-1301.128) (-1305.643) (-1303.411) -- 0:00:57
276500 -- (-1299.721) (-1300.121) [-1300.943] (-1302.762) * (-1301.683) (-1302.094) (-1302.947) [-1300.743] -- 0:00:57
277000 -- (-1299.947) (-1301.499) (-1301.027) [-1302.396] * (-1302.311) (-1302.048) (-1302.637) [-1300.199] -- 0:00:57
277500 -- (-1302.066) (-1301.997) (-1304.480) [-1302.153] * (-1301.919) (-1302.970) [-1302.156] (-1301.250) -- 0:00:57
278000 -- [-1305.047] (-1302.891) (-1302.726) (-1302.367) * (-1302.328) [-1301.353] (-1302.749) (-1303.869) -- 0:00:57
278500 -- (-1299.770) (-1300.826) [-1300.796] (-1303.537) * (-1302.592) (-1300.313) [-1303.829] (-1302.633) -- 0:00:56
279000 -- [-1301.961] (-1300.669) (-1301.905) (-1300.627) * (-1303.712) [-1300.575] (-1305.922) (-1303.946) -- 0:00:56
279500 -- [-1299.508] (-1301.940) (-1302.442) (-1301.577) * [-1300.536] (-1301.297) (-1306.349) (-1304.053) -- 0:00:56
280000 -- (-1301.459) (-1305.026) [-1301.855] (-1302.940) * (-1300.125) (-1302.955) (-1305.151) [-1301.524] -- 0:00:56
Average standard deviation of split frequencies: 0.015808
280500 -- (-1303.654) [-1305.191] (-1299.694) (-1304.204) * (-1302.906) [-1300.428] (-1300.607) (-1302.040) -- 0:00:56
281000 -- (-1302.833) [-1302.192] (-1303.912) (-1302.383) * (-1299.790) (-1300.449) [-1301.749] (-1302.617) -- 0:00:56
281500 -- [-1302.318] (-1301.604) (-1301.884) (-1300.073) * (-1303.413) (-1301.264) [-1301.214] (-1304.123) -- 0:00:56
282000 -- (-1301.768) (-1304.727) (-1301.934) [-1302.887] * (-1301.764) (-1303.092) [-1301.234] (-1303.816) -- 0:00:56
282500 -- [-1301.584] (-1301.723) (-1300.262) (-1301.636) * (-1300.238) (-1303.992) [-1300.396] (-1305.272) -- 0:00:55
283000 -- (-1300.316) [-1300.266] (-1301.415) (-1301.054) * (-1302.067) (-1301.883) [-1300.783] (-1304.198) -- 0:00:55
283500 -- (-1300.202) (-1300.298) (-1300.151) [-1302.273] * [-1302.416] (-1302.986) (-1303.668) (-1300.901) -- 0:00:55
284000 -- [-1301.560] (-1302.213) (-1300.086) (-1302.187) * (-1301.933) (-1301.212) [-1301.634] (-1300.681) -- 0:00:55
284500 -- (-1301.688) [-1304.557] (-1300.958) (-1306.418) * [-1301.349] (-1301.786) (-1303.649) (-1300.273) -- 0:00:55
285000 -- (-1302.544) (-1303.537) [-1299.863] (-1301.225) * [-1301.749] (-1299.940) (-1305.733) (-1302.781) -- 0:00:55
Average standard deviation of split frequencies: 0.016222
285500 -- (-1303.588) [-1302.630] (-1304.975) (-1300.337) * [-1301.562] (-1303.192) (-1302.614) (-1300.492) -- 0:00:57
286000 -- (-1301.253) [-1303.400] (-1300.596) (-1302.609) * (-1300.482) (-1301.094) [-1304.180] (-1303.693) -- 0:00:57
286500 -- (-1302.879) [-1301.279] (-1300.204) (-1300.554) * [-1301.441] (-1299.872) (-1305.511) (-1302.999) -- 0:00:57
287000 -- (-1303.355) (-1302.969) [-1303.008] (-1300.015) * (-1307.866) (-1301.276) [-1301.289] (-1303.353) -- 0:00:57
287500 -- [-1303.422] (-1300.222) (-1302.106) (-1302.704) * (-1302.959) (-1300.231) (-1303.281) [-1302.209] -- 0:00:57
288000 -- [-1301.932] (-1300.261) (-1302.060) (-1302.005) * (-1300.057) [-1300.727] (-1300.260) (-1304.318) -- 0:00:56
288500 -- [-1301.976] (-1301.203) (-1302.070) (-1304.350) * (-1300.617) [-1300.772] (-1301.816) (-1306.646) -- 0:00:56
289000 -- [-1303.628] (-1301.570) (-1302.408) (-1302.422) * (-1300.403) (-1300.048) [-1300.935] (-1305.907) -- 0:00:56
289500 -- (-1302.945) (-1300.253) (-1299.646) [-1303.259] * [-1301.639] (-1303.975) (-1300.221) (-1303.016) -- 0:00:56
290000 -- (-1300.864) [-1299.761] (-1300.083) (-1303.635) * (-1308.578) [-1300.798] (-1300.361) (-1300.926) -- 0:00:56
Average standard deviation of split frequencies: 0.013928
290500 -- [-1301.385] (-1301.172) (-1299.475) (-1302.187) * [-1301.805] (-1301.642) (-1302.152) (-1301.029) -- 0:00:56
291000 -- (-1301.328) [-1300.652] (-1299.475) (-1303.024) * (-1307.397) (-1301.597) (-1305.168) [-1301.814] -- 0:00:56
291500 -- (-1301.340) [-1303.038] (-1299.475) (-1302.050) * (-1304.853) (-1301.097) (-1302.448) [-1301.143] -- 0:00:55
292000 -- (-1302.156) [-1301.521] (-1300.515) (-1302.994) * [-1303.709] (-1301.106) (-1301.661) (-1300.580) -- 0:00:55
292500 -- (-1302.351) (-1301.645) (-1299.543) [-1300.726] * (-1301.433) [-1304.251] (-1301.031) (-1305.347) -- 0:00:55
293000 -- (-1299.908) (-1301.828) [-1299.898] (-1300.856) * (-1301.184) (-1303.649) (-1300.727) [-1306.689] -- 0:00:55
293500 -- [-1301.400] (-1305.113) (-1305.540) (-1300.429) * (-1300.236) (-1305.969) (-1300.262) [-1304.188] -- 0:00:55
294000 -- (-1300.057) (-1302.743) (-1301.561) [-1302.634] * (-1300.081) (-1302.498) (-1300.507) [-1299.952] -- 0:00:55
294500 -- (-1301.374) [-1300.697] (-1302.252) (-1301.363) * [-1301.844] (-1302.015) (-1301.085) (-1301.508) -- 0:00:55
295000 -- (-1302.295) (-1301.418) [-1301.116] (-1303.933) * (-1302.589) [-1301.518] (-1300.054) (-1302.927) -- 0:00:54
Average standard deviation of split frequencies: 0.015041
295500 -- (-1302.054) (-1303.387) [-1302.584] (-1303.021) * [-1301.157] (-1303.283) (-1303.934) (-1306.954) -- 0:00:54
296000 -- [-1300.241] (-1300.995) (-1301.143) (-1304.461) * (-1300.575) (-1304.201) [-1301.670] (-1303.302) -- 0:00:54
296500 -- (-1300.683) [-1301.410] (-1302.075) (-1301.768) * (-1301.890) (-1302.294) (-1300.659) [-1300.111] -- 0:00:54
297000 -- [-1300.382] (-1301.338) (-1301.131) (-1301.751) * (-1303.547) (-1302.379) (-1301.395) [-1302.934] -- 0:00:54
297500 -- (-1301.561) (-1303.609) (-1302.780) [-1300.863] * [-1301.997] (-1303.198) (-1301.395) (-1301.421) -- 0:00:54
298000 -- (-1301.332) [-1300.848] (-1306.919) (-1302.164) * (-1301.079) (-1300.756) (-1302.057) [-1299.852] -- 0:00:54
298500 -- [-1302.098] (-1301.868) (-1301.489) (-1303.403) * (-1301.317) [-1300.723] (-1301.422) (-1301.642) -- 0:00:54
299000 -- (-1301.671) (-1301.615) (-1305.872) [-1301.235] * [-1301.396] (-1300.477) (-1302.305) (-1300.766) -- 0:00:56
299500 -- (-1301.951) (-1300.746) [-1300.585] (-1302.786) * (-1305.517) (-1304.725) [-1300.646] (-1300.613) -- 0:00:56
300000 -- [-1304.252] (-1301.886) (-1300.658) (-1303.956) * (-1302.557) (-1306.825) [-1301.411] (-1299.878) -- 0:00:56
Average standard deviation of split frequencies: 0.013004
300500 -- [-1302.711] (-1299.803) (-1299.528) (-1300.198) * (-1301.304) (-1301.566) [-1301.303] (-1299.891) -- 0:00:55
301000 -- (-1301.520) (-1302.770) [-1304.922] (-1300.243) * [-1301.406] (-1301.396) (-1301.075) (-1301.543) -- 0:00:55
301500 -- (-1301.963) [-1301.930] (-1303.298) (-1303.700) * [-1305.693] (-1301.936) (-1300.981) (-1303.010) -- 0:00:55
302000 -- [-1300.701] (-1303.708) (-1303.517) (-1303.934) * (-1305.336) [-1301.051] (-1302.539) (-1303.175) -- 0:00:55
302500 -- (-1303.148) (-1302.856) (-1302.762) [-1300.452] * [-1303.185] (-1303.086) (-1301.129) (-1301.619) -- 0:00:55
303000 -- (-1303.342) [-1300.828] (-1302.008) (-1304.805) * (-1302.156) (-1302.830) [-1300.802] (-1301.902) -- 0:00:55
303500 -- [-1303.836] (-1300.336) (-1303.756) (-1300.885) * [-1301.618] (-1301.855) (-1302.833) (-1303.371) -- 0:00:55
304000 -- (-1303.601) (-1300.365) [-1304.114] (-1302.536) * (-1300.731) [-1299.969] (-1302.768) (-1303.252) -- 0:00:54
304500 -- [-1301.265] (-1300.536) (-1301.534) (-1302.489) * (-1304.145) (-1301.169) (-1300.997) [-1301.957] -- 0:00:54
305000 -- (-1300.209) (-1301.942) (-1300.667) [-1302.646] * (-1308.551) [-1301.132] (-1302.327) (-1300.517) -- 0:00:54
Average standard deviation of split frequencies: 0.013608
305500 -- [-1300.084] (-1300.871) (-1302.015) (-1302.112) * [-1312.567] (-1300.822) (-1300.241) (-1300.794) -- 0:00:54
306000 -- [-1301.025] (-1301.044) (-1301.948) (-1301.614) * (-1309.988) (-1300.846) (-1300.201) [-1300.642] -- 0:00:54
306500 -- (-1300.060) (-1300.983) (-1307.403) [-1301.139] * (-1306.164) (-1308.773) [-1303.600] (-1302.955) -- 0:00:54
307000 -- [-1300.346] (-1307.714) (-1308.142) (-1303.990) * (-1306.004) (-1303.149) (-1303.458) [-1299.645] -- 0:00:54
307500 -- (-1302.772) [-1305.332] (-1306.148) (-1303.354) * (-1304.759) (-1302.561) [-1302.459] (-1301.111) -- 0:00:54
308000 -- [-1302.107] (-1302.496) (-1303.791) (-1305.373) * [-1301.909] (-1302.965) (-1307.754) (-1300.330) -- 0:00:53
308500 -- [-1305.067] (-1302.985) (-1301.955) (-1302.722) * (-1299.913) (-1303.155) (-1304.755) [-1300.711] -- 0:00:53
309000 -- (-1306.385) (-1300.244) (-1300.661) [-1299.755] * (-1301.262) [-1301.850] (-1301.374) (-1301.302) -- 0:00:53
309500 -- (-1306.335) (-1302.285) (-1301.237) [-1303.316] * (-1301.275) [-1302.484] (-1301.319) (-1302.673) -- 0:00:53
310000 -- [-1302.427] (-1303.538) (-1300.594) (-1302.975) * (-1300.696) [-1301.873] (-1303.707) (-1301.525) -- 0:00:53
Average standard deviation of split frequencies: 0.012645
310500 -- (-1302.723) (-1300.287) (-1300.948) [-1302.605] * (-1304.597) [-1303.038] (-1304.113) (-1300.891) -- 0:00:53
311000 -- (-1302.377) [-1301.768] (-1302.247) (-1304.191) * (-1304.595) (-1301.130) [-1304.669] (-1303.347) -- 0:00:53
311500 -- (-1302.406) (-1300.546) (-1300.991) [-1301.408] * [-1300.600] (-1300.604) (-1301.344) (-1302.577) -- 0:00:55
312000 -- (-1303.566) (-1302.555) [-1302.811] (-1306.905) * (-1300.348) [-1301.297] (-1300.378) (-1300.912) -- 0:00:55
312500 -- [-1301.018] (-1304.866) (-1301.565) (-1305.163) * [-1301.308] (-1301.894) (-1301.406) (-1303.371) -- 0:00:55
313000 -- (-1300.510) (-1302.414) [-1302.116] (-1304.819) * [-1302.779] (-1300.904) (-1303.119) (-1302.891) -- 0:00:54
313500 -- (-1303.915) [-1300.809] (-1304.474) (-1304.364) * [-1301.740] (-1302.413) (-1302.825) (-1302.272) -- 0:00:54
314000 -- (-1305.161) (-1302.699) [-1304.161] (-1302.572) * [-1300.085] (-1301.446) (-1303.138) (-1301.154) -- 0:00:54
314500 -- (-1301.974) [-1302.619] (-1303.669) (-1306.351) * (-1305.932) (-1304.102) (-1302.228) [-1299.826] -- 0:00:54
315000 -- (-1299.988) (-1302.455) (-1300.697) [-1304.242] * [-1300.973] (-1308.807) (-1301.477) (-1300.643) -- 0:00:54
Average standard deviation of split frequencies: 0.011759
315500 -- (-1305.887) [-1303.084] (-1304.264) (-1302.576) * (-1302.084) (-1304.191) [-1302.707] (-1299.850) -- 0:00:54
316000 -- (-1305.829) (-1302.989) [-1304.571] (-1301.937) * [-1301.170] (-1302.547) (-1304.464) (-1302.108) -- 0:00:54
316500 -- (-1300.837) [-1302.737] (-1300.215) (-1301.335) * (-1300.757) [-1304.203] (-1300.844) (-1302.029) -- 0:00:53
317000 -- (-1301.333) [-1300.933] (-1300.096) (-1300.834) * (-1300.631) (-1304.161) [-1301.553] (-1304.593) -- 0:00:53
317500 -- (-1300.979) [-1301.278] (-1301.636) (-1302.780) * [-1300.147] (-1300.773) (-1300.865) (-1300.325) -- 0:00:53
318000 -- (-1300.668) [-1301.244] (-1300.793) (-1301.846) * (-1300.717) [-1300.403] (-1301.464) (-1301.547) -- 0:00:53
318500 -- [-1300.309] (-1302.208) (-1302.122) (-1303.833) * (-1300.787) (-1301.418) (-1299.765) [-1301.905] -- 0:00:53
319000 -- [-1301.078] (-1304.679) (-1299.978) (-1309.728) * (-1303.026) [-1303.290] (-1299.702) (-1302.839) -- 0:00:53
319500 -- (-1305.224) (-1306.430) [-1300.747] (-1304.904) * (-1305.989) (-1303.954) [-1305.753] (-1305.050) -- 0:00:53
320000 -- (-1300.477) (-1306.190) [-1299.933] (-1300.845) * (-1304.892) (-1301.686) [-1301.082] (-1301.717) -- 0:00:53
Average standard deviation of split frequencies: 0.011516
320500 -- (-1299.696) [-1299.902] (-1303.182) (-1304.815) * (-1308.497) [-1301.839] (-1301.243) (-1300.967) -- 0:00:53
321000 -- (-1300.702) (-1299.902) (-1301.682) [-1301.023] * (-1301.432) (-1301.100) [-1304.358] (-1305.683) -- 0:00:52
321500 -- [-1300.418] (-1300.374) (-1302.008) (-1300.799) * (-1300.868) (-1303.653) [-1301.333] (-1303.577) -- 0:00:52
322000 -- [-1300.290] (-1303.995) (-1299.707) (-1310.165) * [-1301.263] (-1304.553) (-1302.665) (-1306.918) -- 0:00:52
322500 -- (-1301.110) (-1305.997) [-1302.590] (-1312.905) * (-1301.950) [-1304.212] (-1300.996) (-1309.080) -- 0:00:52
323000 -- [-1302.736] (-1307.874) (-1300.145) (-1304.728) * (-1300.685) (-1303.446) (-1309.926) [-1301.332] -- 0:00:52
323500 -- (-1303.867) (-1308.208) [-1301.299] (-1302.820) * (-1300.416) (-1304.631) (-1300.902) [-1301.427] -- 0:00:52
324000 -- (-1301.544) [-1302.195] (-1305.328) (-1303.622) * (-1299.958) (-1301.331) (-1300.913) [-1300.646] -- 0:00:52
324500 -- (-1305.535) (-1300.538) (-1301.152) [-1302.813] * (-1301.481) (-1300.349) [-1301.193] (-1300.819) -- 0:00:54
325000 -- (-1301.020) [-1302.080] (-1302.288) (-1303.097) * [-1301.836] (-1300.550) (-1301.109) (-1304.182) -- 0:00:54
Average standard deviation of split frequencies: 0.012101
325500 -- (-1300.824) (-1304.823) [-1303.068] (-1302.239) * (-1302.150) (-1302.341) (-1306.332) [-1301.644] -- 0:00:53
326000 -- (-1303.951) (-1300.770) [-1301.754] (-1303.351) * [-1304.450] (-1303.924) (-1303.429) (-1308.059) -- 0:00:53
326500 -- (-1302.460) [-1303.906] (-1301.856) (-1306.102) * [-1305.469] (-1303.400) (-1300.181) (-1306.989) -- 0:00:53
327000 -- (-1300.221) [-1303.564] (-1303.152) (-1304.001) * (-1299.863) (-1301.299) [-1300.647] (-1304.333) -- 0:00:53
327500 -- (-1303.152) [-1303.199] (-1303.175) (-1304.572) * (-1299.499) (-1304.206) [-1301.414] (-1302.025) -- 0:00:53
328000 -- [-1300.524] (-1303.414) (-1302.193) (-1300.587) * [-1303.390] (-1303.600) (-1305.906) (-1299.902) -- 0:00:53
328500 -- (-1301.611) (-1300.795) [-1301.886] (-1301.640) * (-1304.939) (-1303.730) (-1308.171) [-1299.777] -- 0:00:53
329000 -- (-1300.107) (-1301.337) (-1303.513) [-1301.517] * (-1309.248) (-1303.639) [-1300.568] (-1299.861) -- 0:00:53
329500 -- (-1299.937) (-1303.623) (-1304.254) [-1300.277] * (-1302.968) [-1302.231] (-1301.704) (-1299.967) -- 0:00:52
330000 -- (-1303.601) [-1299.955] (-1301.392) (-1299.507) * (-1303.344) (-1300.733) [-1300.228] (-1299.967) -- 0:00:52
Average standard deviation of split frequencies: 0.014481
330500 -- (-1306.535) (-1299.949) (-1301.890) [-1303.214] * [-1301.897] (-1301.816) (-1299.804) (-1300.247) -- 0:00:52
331000 -- [-1301.670] (-1304.570) (-1301.516) (-1305.519) * [-1302.596] (-1303.557) (-1300.727) (-1301.088) -- 0:00:52
331500 -- (-1303.826) [-1301.011] (-1301.327) (-1304.695) * (-1301.376) (-1300.826) (-1300.381) [-1301.475] -- 0:00:52
332000 -- (-1301.740) (-1300.905) (-1301.419) [-1300.908] * (-1301.707) [-1299.889] (-1302.393) (-1309.360) -- 0:00:52
332500 -- (-1302.731) [-1302.200] (-1300.835) (-1300.748) * (-1307.460) (-1303.411) [-1301.518] (-1302.181) -- 0:00:52
333000 -- (-1309.012) [-1300.684] (-1303.046) (-1301.164) * (-1311.230) (-1303.298) [-1301.576] (-1303.849) -- 0:00:52
333500 -- (-1299.507) (-1304.152) [-1304.032] (-1301.683) * (-1304.888) (-1302.498) [-1303.823] (-1302.179) -- 0:00:51
334000 -- [-1300.957] (-1300.350) (-1300.607) (-1306.458) * (-1300.617) (-1300.273) [-1308.674] (-1301.323) -- 0:00:51
334500 -- (-1300.910) (-1303.504) (-1300.841) [-1301.232] * [-1303.737] (-1299.919) (-1303.047) (-1307.812) -- 0:00:51
335000 -- [-1301.362] (-1303.405) (-1300.771) (-1303.155) * [-1301.404] (-1301.247) (-1303.021) (-1304.698) -- 0:00:51
Average standard deviation of split frequencies: 0.015138
335500 -- [-1300.348] (-1302.568) (-1301.128) (-1299.802) * (-1300.907) (-1300.255) [-1300.062] (-1300.590) -- 0:00:51
336000 -- (-1301.030) (-1302.093) (-1302.194) [-1302.033] * (-1301.393) (-1300.204) [-1302.562] (-1302.262) -- 0:00:51
336500 -- (-1305.533) (-1302.996) (-1303.188) [-1301.270] * (-1304.496) (-1303.379) (-1301.800) [-1301.999] -- 0:00:51
337000 -- (-1300.963) [-1301.184] (-1301.755) (-1301.847) * (-1302.517) (-1300.835) [-1303.180] (-1304.840) -- 0:00:51
337500 -- (-1303.217) (-1303.694) [-1304.474] (-1301.236) * [-1305.918] (-1301.256) (-1305.183) (-1302.816) -- 0:00:51
338000 -- (-1302.109) [-1303.479] (-1301.546) (-1301.130) * (-1304.148) (-1301.871) (-1303.702) [-1303.894] -- 0:00:52
338500 -- [-1302.355] (-1303.470) (-1300.766) (-1300.911) * (-1301.720) (-1303.685) (-1304.810) [-1305.456] -- 0:00:52
339000 -- (-1301.082) [-1301.462] (-1303.086) (-1301.953) * [-1302.440] (-1299.864) (-1300.241) (-1306.454) -- 0:00:52
339500 -- (-1301.449) (-1301.774) [-1300.202] (-1302.366) * [-1301.592] (-1302.996) (-1300.043) (-1302.462) -- 0:00:52
340000 -- (-1302.770) (-1300.607) [-1300.592] (-1300.864) * (-1300.909) [-1300.898] (-1302.988) (-1303.162) -- 0:00:52
Average standard deviation of split frequencies: 0.013911
340500 -- [-1304.071] (-1305.233) (-1299.646) (-1302.477) * (-1301.176) (-1307.503) (-1300.620) [-1299.848] -- 0:00:52
341000 -- (-1300.383) (-1304.608) (-1299.664) [-1300.388] * (-1301.409) (-1305.328) (-1300.758) [-1300.575] -- 0:00:52
341500 -- [-1300.749] (-1306.763) (-1305.692) (-1301.253) * (-1303.806) (-1300.983) (-1301.413) [-1299.895] -- 0:00:52
342000 -- (-1303.113) (-1303.455) (-1305.253) [-1301.131] * [-1300.563] (-1301.819) (-1300.598) (-1301.708) -- 0:00:51
342500 -- (-1302.136) [-1301.437] (-1304.160) (-1299.997) * [-1301.704] (-1301.235) (-1301.644) (-1301.937) -- 0:00:51
343000 -- (-1300.629) (-1300.379) (-1302.262) [-1299.667] * [-1301.859] (-1301.085) (-1301.182) (-1303.400) -- 0:00:51
343500 -- (-1301.058) [-1302.247] (-1306.367) (-1306.061) * (-1300.949) [-1304.391] (-1301.162) (-1303.508) -- 0:00:51
344000 -- (-1304.621) [-1303.866] (-1303.326) (-1300.191) * (-1305.374) (-1305.619) (-1301.097) [-1300.734] -- 0:00:51
344500 -- (-1300.394) (-1300.739) [-1302.011] (-1300.902) * [-1299.586] (-1304.686) (-1303.373) (-1303.671) -- 0:00:51
345000 -- (-1300.109) [-1300.738] (-1304.180) (-1300.905) * [-1300.784] (-1304.381) (-1306.226) (-1301.161) -- 0:00:51
Average standard deviation of split frequencies: 0.012477
345500 -- (-1301.701) (-1302.983) (-1301.663) [-1302.713] * (-1303.654) (-1302.713) (-1302.359) [-1300.896] -- 0:00:51
346000 -- (-1300.765) (-1300.303) [-1301.734] (-1301.615) * (-1303.075) (-1301.598) [-1300.456] (-1304.355) -- 0:00:51
346500 -- [-1300.470] (-1301.633) (-1305.816) (-1307.905) * [-1301.651] (-1300.844) (-1302.149) (-1304.044) -- 0:00:50
347000 -- (-1301.891) (-1301.411) [-1301.882] (-1302.315) * (-1303.319) (-1300.217) (-1300.934) [-1305.855] -- 0:00:50
347500 -- (-1304.274) [-1300.092] (-1300.776) (-1301.650) * (-1300.247) [-1299.669] (-1303.003) (-1300.381) -- 0:00:50
348000 -- (-1300.583) [-1301.539] (-1299.744) (-1303.257) * [-1300.481] (-1305.631) (-1300.841) (-1300.820) -- 0:00:50
348500 -- (-1300.880) (-1300.532) [-1299.738] (-1302.935) * (-1300.885) [-1302.027] (-1304.836) (-1302.394) -- 0:00:50
349000 -- (-1300.761) (-1302.469) [-1300.233] (-1302.100) * (-1303.100) (-1304.453) [-1301.391] (-1304.213) -- 0:00:50
349500 -- [-1302.067] (-1300.443) (-1300.489) (-1304.932) * (-1303.866) (-1305.094) (-1302.146) [-1304.731] -- 0:00:50
350000 -- (-1307.809) (-1300.206) (-1300.379) [-1301.469] * (-1305.484) (-1305.227) (-1303.927) [-1301.153] -- 0:00:50
Average standard deviation of split frequencies: 0.012890
350500 -- (-1302.247) (-1302.375) (-1306.942) [-1301.191] * [-1301.699] (-1303.743) (-1301.408) (-1301.589) -- 0:00:50
351000 -- [-1305.338] (-1302.661) (-1301.118) (-1300.736) * (-1300.136) (-1300.837) [-1301.431] (-1304.479) -- 0:00:49
351500 -- (-1303.484) (-1302.318) [-1301.082] (-1301.874) * (-1300.744) [-1300.440] (-1302.450) (-1305.548) -- 0:00:51
352000 -- (-1300.355) (-1303.372) (-1299.628) [-1301.791] * (-1300.699) [-1300.403] (-1300.672) (-1301.892) -- 0:00:51
352500 -- (-1299.916) (-1302.523) [-1300.064] (-1302.412) * (-1301.436) (-1300.327) [-1299.753] (-1301.580) -- 0:00:51
353000 -- [-1302.861] (-1303.882) (-1300.435) (-1303.068) * (-1301.577) (-1300.641) (-1305.684) [-1303.497] -- 0:00:51
353500 -- (-1301.043) (-1303.816) (-1300.343) [-1300.745] * [-1300.357] (-1301.227) (-1299.639) (-1301.381) -- 0:00:51
354000 -- [-1300.242] (-1302.130) (-1301.001) (-1301.179) * [-1300.395] (-1301.837) (-1302.533) (-1303.741) -- 0:00:51
354500 -- (-1300.451) [-1300.842] (-1300.383) (-1301.440) * [-1302.199] (-1302.483) (-1303.398) (-1301.207) -- 0:00:50
355000 -- (-1301.352) (-1301.482) [-1300.891] (-1300.473) * (-1301.640) [-1300.534] (-1301.250) (-1301.020) -- 0:00:50
Average standard deviation of split frequencies: 0.012073
355500 -- (-1302.967) (-1301.027) (-1300.879) [-1300.087] * [-1304.969] (-1302.497) (-1303.016) (-1300.240) -- 0:00:50
356000 -- (-1301.740) [-1301.723] (-1300.673) (-1300.208) * (-1301.904) (-1301.521) (-1302.257) [-1301.369] -- 0:00:50
356500 -- (-1302.157) (-1301.465) (-1301.090) [-1300.143] * [-1302.900] (-1299.957) (-1302.247) (-1301.401) -- 0:00:50
357000 -- (-1300.863) (-1300.562) (-1300.793) [-1302.482] * (-1302.152) (-1302.853) (-1302.871) [-1301.947] -- 0:00:50
357500 -- [-1299.820] (-1301.845) (-1303.757) (-1302.401) * (-1300.520) (-1302.184) [-1301.436] (-1301.324) -- 0:00:50
358000 -- (-1302.047) (-1300.306) (-1300.563) [-1302.255] * (-1299.779) [-1299.910] (-1302.999) (-1305.226) -- 0:00:50
358500 -- (-1302.879) (-1300.619) (-1301.266) [-1305.619] * (-1301.021) [-1302.991] (-1303.063) (-1304.861) -- 0:00:50
359000 -- (-1301.320) (-1304.202) (-1302.782) [-1301.954] * (-1302.190) (-1302.753) (-1301.847) [-1303.333] -- 0:00:49
359500 -- (-1301.343) (-1306.088) [-1304.148] (-1300.148) * (-1303.920) (-1302.757) (-1303.675) [-1300.696] -- 0:00:49
360000 -- [-1302.044] (-1302.880) (-1302.940) (-1301.151) * (-1303.125) [-1302.475] (-1302.020) (-1302.992) -- 0:00:49
Average standard deviation of split frequencies: 0.012148
360500 -- (-1300.250) (-1306.491) [-1301.213] (-1302.740) * [-1301.992] (-1301.801) (-1300.176) (-1300.241) -- 0:00:49
361000 -- (-1302.324) (-1304.535) (-1300.982) [-1303.264] * [-1301.352] (-1302.078) (-1301.064) (-1303.993) -- 0:00:49
361500 -- (-1299.912) [-1301.480] (-1301.112) (-1302.062) * [-1301.485] (-1301.023) (-1300.681) (-1300.649) -- 0:00:49
362000 -- (-1301.437) [-1302.482] (-1302.476) (-1300.798) * [-1300.318] (-1301.897) (-1301.004) (-1300.589) -- 0:00:49
362500 -- (-1302.513) [-1301.654] (-1300.672) (-1300.556) * (-1302.566) (-1303.065) [-1303.066] (-1301.186) -- 0:00:49
363000 -- (-1302.445) (-1301.979) [-1300.549] (-1302.651) * [-1302.225] (-1303.516) (-1305.194) (-1302.874) -- 0:00:49
363500 -- (-1301.334) [-1301.099] (-1301.077) (-1305.966) * (-1302.208) [-1301.767] (-1306.257) (-1299.944) -- 0:00:49
364000 -- (-1301.066) (-1300.559) [-1300.954] (-1302.661) * (-1303.459) (-1301.251) (-1301.728) [-1300.338] -- 0:00:48
364500 -- (-1301.225) [-1305.078] (-1301.138) (-1301.774) * (-1300.889) [-1300.637] (-1302.784) (-1301.238) -- 0:00:50
365000 -- [-1300.353] (-1304.119) (-1302.167) (-1301.597) * (-1301.857) (-1300.435) (-1301.090) [-1300.149] -- 0:00:50
Average standard deviation of split frequencies: 0.013595
365500 -- [-1300.999] (-1309.486) (-1301.766) (-1301.526) * (-1300.367) (-1300.809) (-1301.732) [-1301.210] -- 0:00:50
366000 -- [-1300.792] (-1305.556) (-1302.834) (-1300.784) * (-1301.278) (-1303.481) [-1302.066] (-1303.958) -- 0:00:50
366500 -- (-1302.598) (-1300.747) (-1302.929) [-1301.506] * [-1302.226] (-1302.268) (-1302.900) (-1302.083) -- 0:00:50
367000 -- (-1306.881) (-1299.887) (-1305.692) [-1299.779] * [-1303.408] (-1301.975) (-1304.714) (-1303.488) -- 0:00:50
367500 -- (-1304.002) [-1301.902] (-1299.771) (-1300.677) * (-1301.319) (-1300.730) [-1302.596] (-1301.836) -- 0:00:49
368000 -- (-1307.180) (-1302.154) [-1301.601] (-1300.349) * (-1301.737) [-1300.990] (-1303.307) (-1300.299) -- 0:00:49
368500 -- (-1307.785) (-1301.550) (-1306.155) [-1301.019] * (-1302.566) [-1304.121] (-1301.863) (-1302.155) -- 0:00:49
369000 -- (-1303.708) (-1300.445) [-1305.262] (-1300.393) * [-1303.169] (-1306.846) (-1304.603) (-1302.351) -- 0:00:49
369500 -- [-1302.360] (-1304.112) (-1307.716) (-1300.232) * [-1307.473] (-1306.721) (-1302.371) (-1304.606) -- 0:00:49
370000 -- [-1302.601] (-1300.625) (-1306.862) (-1301.506) * (-1302.849) (-1304.144) [-1300.748] (-1302.415) -- 0:00:49
Average standard deviation of split frequencies: 0.014060
370500 -- (-1303.441) [-1300.653] (-1303.941) (-1303.593) * (-1300.883) (-1303.048) (-1302.133) [-1300.593] -- 0:00:49
371000 -- (-1300.579) (-1301.835) [-1303.876] (-1303.726) * [-1300.755] (-1303.927) (-1301.433) (-1301.349) -- 0:00:49
371500 -- [-1301.336] (-1300.250) (-1303.140) (-1302.547) * (-1303.721) [-1302.647] (-1302.865) (-1303.916) -- 0:00:49
372000 -- (-1301.715) [-1300.378] (-1303.222) (-1302.782) * [-1303.157] (-1303.560) (-1301.917) (-1302.821) -- 0:00:48
372500 -- (-1301.497) (-1299.766) (-1300.684) [-1302.855] * [-1301.072] (-1304.409) (-1303.260) (-1303.115) -- 0:00:48
373000 -- (-1301.139) [-1301.324] (-1300.677) (-1302.639) * [-1302.312] (-1303.618) (-1300.882) (-1301.781) -- 0:00:48
373500 -- (-1302.868) [-1301.352] (-1301.037) (-1300.743) * (-1303.004) [-1303.134] (-1301.084) (-1302.519) -- 0:00:48
374000 -- [-1305.676] (-1301.222) (-1303.325) (-1302.153) * (-1306.658) (-1307.431) [-1301.029] (-1302.492) -- 0:00:48
374500 -- [-1302.628] (-1302.133) (-1301.961) (-1307.259) * (-1300.746) [-1302.158] (-1303.091) (-1302.606) -- 0:00:48
375000 -- (-1301.538) (-1300.770) (-1300.596) [-1309.406] * (-1299.967) (-1302.848) (-1303.976) [-1302.477] -- 0:00:48
Average standard deviation of split frequencies: 0.013791
375500 -- (-1304.124) (-1301.067) (-1301.041) [-1309.450] * (-1300.361) (-1301.818) [-1302.004] (-1302.846) -- 0:00:48
376000 -- (-1301.583) (-1304.953) (-1302.852) [-1300.713] * (-1303.620) [-1300.971] (-1302.292) (-1301.299) -- 0:00:48
376500 -- (-1300.068) [-1301.558] (-1301.623) (-1302.153) * (-1307.840) (-1307.701) (-1311.676) [-1300.151] -- 0:00:48
377000 -- (-1301.167) (-1301.617) (-1301.226) [-1301.303] * (-1301.082) (-1301.732) [-1306.317] (-1301.459) -- 0:00:47
377500 -- [-1300.589] (-1299.764) (-1304.421) (-1302.993) * [-1300.666] (-1301.315) (-1304.955) (-1300.861) -- 0:00:47
378000 -- (-1300.766) (-1299.559) [-1304.196] (-1302.436) * (-1303.998) (-1300.910) (-1301.092) [-1300.849] -- 0:00:49
378500 -- (-1301.091) (-1301.215) [-1303.667] (-1302.282) * (-1304.196) [-1302.389] (-1300.209) (-1301.792) -- 0:00:49
379000 -- [-1304.400] (-1301.718) (-1303.711) (-1303.257) * [-1301.306] (-1302.942) (-1301.619) (-1300.050) -- 0:00:49
379500 -- (-1304.357) (-1300.235) (-1301.106) [-1302.388] * (-1301.341) [-1305.427] (-1300.316) (-1299.587) -- 0:00:49
380000 -- (-1300.301) [-1302.364] (-1302.508) (-1303.901) * (-1301.230) (-1300.821) [-1302.363] (-1303.055) -- 0:00:48
Average standard deviation of split frequencies: 0.013003
380500 -- (-1300.152) [-1301.289] (-1299.568) (-1305.542) * (-1301.748) (-1301.520) [-1301.914] (-1300.438) -- 0:00:48
381000 -- (-1300.152) (-1305.388) [-1300.454] (-1303.373) * (-1301.996) [-1299.977] (-1301.110) (-1300.585) -- 0:00:48
381500 -- (-1303.783) (-1301.695) (-1302.073) [-1300.989] * (-1303.539) [-1299.992] (-1301.165) (-1310.280) -- 0:00:48
382000 -- (-1299.560) (-1305.783) [-1305.147] (-1301.183) * (-1303.387) (-1305.416) (-1300.347) [-1303.654] -- 0:00:48
382500 -- (-1300.133) (-1305.036) (-1304.342) [-1300.366] * (-1301.415) (-1301.989) [-1302.392] (-1301.366) -- 0:00:48
383000 -- [-1302.537] (-1300.933) (-1302.291) (-1304.509) * (-1299.864) [-1307.011] (-1302.257) (-1303.621) -- 0:00:48
383500 -- [-1301.661] (-1300.980) (-1305.570) (-1302.455) * (-1300.732) (-1303.253) [-1302.257] (-1302.070) -- 0:00:48
384000 -- (-1304.989) [-1304.243] (-1305.134) (-1302.636) * (-1301.766) [-1300.179] (-1301.722) (-1300.468) -- 0:00:48
384500 -- (-1304.918) (-1303.693) (-1301.122) [-1301.863] * (-1302.553) (-1301.992) [-1302.347] (-1300.079) -- 0:00:48
385000 -- (-1302.271) (-1301.694) (-1304.392) [-1300.760] * (-1301.889) [-1301.204] (-1301.989) (-1301.772) -- 0:00:47
Average standard deviation of split frequencies: 0.012920
385500 -- (-1300.916) (-1302.143) (-1301.483) [-1300.608] * (-1301.316) (-1303.792) [-1301.097] (-1304.568) -- 0:00:47
386000 -- (-1300.837) (-1301.963) (-1302.833) [-1301.733] * (-1301.098) [-1301.879] (-1300.825) (-1303.420) -- 0:00:47
386500 -- [-1304.081] (-1299.909) (-1301.496) (-1304.478) * (-1300.874) [-1302.706] (-1301.346) (-1301.585) -- 0:00:47
387000 -- (-1303.340) [-1299.888] (-1302.325) (-1305.486) * (-1299.943) (-1302.895) [-1300.033] (-1300.638) -- 0:00:47
387500 -- (-1304.252) [-1300.036] (-1306.411) (-1303.789) * (-1299.924) (-1304.621) (-1300.098) [-1300.189] -- 0:00:47
388000 -- (-1301.347) [-1300.387] (-1301.434) (-1306.422) * (-1303.476) (-1303.363) [-1303.951] (-1300.842) -- 0:00:47
388500 -- (-1301.768) [-1300.051] (-1300.360) (-1303.423) * (-1302.189) [-1305.052] (-1301.538) (-1302.721) -- 0:00:47
389000 -- (-1305.873) [-1302.243] (-1300.182) (-1302.004) * (-1301.671) (-1305.532) [-1301.030] (-1299.552) -- 0:00:47
389500 -- (-1302.104) (-1301.469) [-1303.069] (-1302.372) * (-1301.317) [-1302.067] (-1301.498) (-1301.673) -- 0:00:47
390000 -- (-1302.264) (-1300.238) [-1304.262] (-1304.526) * (-1304.905) (-1303.001) [-1303.559] (-1302.109) -- 0:00:46
Average standard deviation of split frequencies: 0.014734
390500 -- (-1300.900) [-1302.068] (-1303.008) (-1303.322) * (-1304.067) (-1303.664) [-1302.028] (-1303.031) -- 0:00:46
391000 -- (-1302.248) (-1306.052) [-1301.658] (-1304.162) * (-1304.065) (-1305.852) (-1302.998) [-1300.402] -- 0:00:46
391500 -- (-1301.157) [-1303.186] (-1300.830) (-1306.697) * (-1304.854) [-1303.021] (-1304.402) (-1301.552) -- 0:00:48
392000 -- (-1302.313) (-1300.256) [-1301.016] (-1304.122) * (-1305.480) (-1304.067) (-1303.771) [-1302.106] -- 0:00:48
392500 -- [-1301.455] (-1302.822) (-1300.910) (-1302.877) * [-1301.713] (-1305.214) (-1301.243) (-1301.365) -- 0:00:47
393000 -- (-1302.847) (-1303.930) (-1300.093) [-1302.297] * (-1301.055) [-1302.123] (-1301.676) (-1301.480) -- 0:00:47
393500 -- [-1300.149] (-1304.577) (-1300.064) (-1300.066) * [-1299.952] (-1302.033) (-1301.503) (-1301.709) -- 0:00:47
394000 -- [-1300.044] (-1305.931) (-1300.699) (-1300.105) * (-1300.777) (-1300.323) (-1300.032) [-1303.912] -- 0:00:47
394500 -- (-1301.331) [-1305.546] (-1301.933) (-1303.526) * (-1303.522) (-1302.049) (-1300.561) [-1300.970] -- 0:00:47
395000 -- (-1301.821) [-1300.820] (-1303.335) (-1301.933) * (-1303.526) [-1300.866] (-1303.088) (-1303.073) -- 0:00:47
Average standard deviation of split frequencies: 0.014661
395500 -- (-1303.609) (-1300.492) [-1302.014] (-1303.255) * [-1303.936] (-1302.378) (-1303.283) (-1302.483) -- 0:00:47
396000 -- [-1302.638] (-1303.018) (-1309.308) (-1301.953) * (-1303.304) (-1303.513) (-1303.918) [-1301.410] -- 0:00:47
396500 -- [-1303.465] (-1301.616) (-1302.089) (-1301.134) * [-1302.585] (-1303.201) (-1303.372) (-1301.314) -- 0:00:47
397000 -- [-1301.999] (-1302.943) (-1301.713) (-1302.846) * (-1301.144) [-1303.821] (-1301.760) (-1300.341) -- 0:00:47
397500 -- [-1302.089] (-1302.311) (-1303.928) (-1301.515) * (-1301.513) [-1302.881] (-1300.095) (-1301.467) -- 0:00:46
398000 -- (-1304.350) [-1300.197] (-1302.527) (-1303.175) * (-1299.543) [-1301.700] (-1300.683) (-1300.446) -- 0:00:46
398500 -- (-1303.358) (-1299.986) [-1301.484] (-1301.946) * (-1299.804) (-1299.984) (-1303.220) [-1301.257] -- 0:00:46
399000 -- (-1303.486) (-1299.859) [-1300.703] (-1301.360) * [-1300.125] (-1300.584) (-1303.969) (-1299.824) -- 0:00:46
399500 -- (-1302.068) [-1302.869] (-1300.851) (-1300.470) * (-1302.941) (-1301.076) [-1300.588] (-1304.232) -- 0:00:46
400000 -- (-1305.871) (-1303.694) (-1307.502) [-1303.396] * [-1302.280] (-1301.624) (-1303.970) (-1301.380) -- 0:00:46
Average standard deviation of split frequencies: 0.014428
400500 -- (-1304.472) (-1301.606) [-1303.312] (-1302.391) * [-1300.763] (-1301.010) (-1303.541) (-1301.356) -- 0:00:46
401000 -- [-1301.006] (-1303.308) (-1306.859) (-1306.783) * [-1304.273] (-1301.286) (-1303.541) (-1300.657) -- 0:00:46
401500 -- [-1300.578] (-1306.004) (-1300.283) (-1302.286) * (-1302.155) (-1300.775) [-1302.356] (-1303.059) -- 0:00:46
402000 -- (-1300.200) (-1301.556) (-1300.623) [-1301.296] * (-1300.998) [-1302.303] (-1301.432) (-1306.121) -- 0:00:46
402500 -- [-1300.450] (-1301.744) (-1303.162) (-1301.340) * (-1303.748) (-1303.511) [-1300.539] (-1302.405) -- 0:00:46
403000 -- (-1302.603) (-1300.521) (-1303.428) [-1300.976] * (-1300.800) (-1304.310) [-1302.423] (-1304.067) -- 0:00:45
403500 -- (-1300.688) (-1301.009) [-1301.982] (-1300.595) * (-1305.368) (-1301.224) [-1300.793] (-1303.559) -- 0:00:45
404000 -- (-1300.198) [-1301.270] (-1302.361) (-1303.738) * (-1305.023) [-1300.737] (-1301.213) (-1304.401) -- 0:00:45
404500 -- (-1300.144) (-1302.618) [-1301.199] (-1303.892) * [-1300.069] (-1302.475) (-1300.955) (-1301.159) -- 0:00:45
405000 -- (-1300.495) [-1300.554] (-1303.938) (-1301.789) * (-1301.159) [-1300.973] (-1301.900) (-1300.352) -- 0:00:47
Average standard deviation of split frequencies: 0.013872
405500 -- (-1300.563) (-1301.017) [-1303.421] (-1303.163) * (-1301.857) (-1305.021) (-1299.640) [-1299.889] -- 0:00:46
406000 -- (-1300.809) (-1302.479) (-1299.704) [-1302.271] * (-1303.094) [-1303.402] (-1300.064) (-1299.886) -- 0:00:46
406500 -- (-1304.417) [-1303.748] (-1300.959) (-1300.324) * [-1301.709] (-1302.353) (-1300.801) (-1299.821) -- 0:00:46
407000 -- (-1302.345) (-1301.204) [-1302.401] (-1299.890) * [-1305.842] (-1302.175) (-1302.042) (-1300.796) -- 0:00:46
407500 -- (-1302.135) (-1301.023) (-1303.494) [-1300.492] * (-1303.653) [-1304.293] (-1302.312) (-1300.659) -- 0:00:46
408000 -- (-1301.802) [-1302.827] (-1303.448) (-1300.514) * (-1301.889) [-1301.108] (-1302.018) (-1304.016) -- 0:00:46
408500 -- (-1301.154) (-1303.308) (-1302.852) [-1300.666] * (-1302.338) [-1303.231] (-1302.913) (-1300.220) -- 0:00:46
409000 -- (-1303.950) (-1304.393) [-1301.241] (-1301.743) * (-1300.980) (-1304.338) [-1301.856] (-1301.153) -- 0:00:46
409500 -- (-1302.887) (-1303.912) (-1301.871) [-1299.913] * (-1300.861) (-1307.490) [-1301.588] (-1302.542) -- 0:00:46
410000 -- [-1301.128] (-1301.728) (-1300.174) (-1300.067) * (-1300.021) (-1304.149) (-1302.495) [-1300.174] -- 0:00:46
Average standard deviation of split frequencies: 0.013775
410500 -- [-1300.812] (-1301.784) (-1301.720) (-1301.217) * (-1299.893) [-1300.391] (-1302.732) (-1301.519) -- 0:00:45
411000 -- (-1301.876) (-1300.507) (-1305.201) [-1300.060] * (-1302.435) (-1303.135) (-1301.648) [-1300.376] -- 0:00:45
411500 -- (-1301.343) (-1299.481) [-1305.783] (-1299.982) * [-1305.080] (-1303.260) (-1302.000) (-1301.324) -- 0:00:45
412000 -- (-1301.480) (-1301.486) (-1302.920) [-1300.103] * (-1305.588) (-1301.350) [-1301.482] (-1300.569) -- 0:00:45
412500 -- [-1303.007] (-1302.637) (-1302.894) (-1301.400) * [-1301.927] (-1300.990) (-1301.550) (-1303.124) -- 0:00:45
413000 -- (-1299.786) [-1303.968] (-1302.420) (-1301.232) * [-1302.203] (-1300.353) (-1302.475) (-1300.935) -- 0:00:45
413500 -- [-1299.866] (-1303.905) (-1303.435) (-1306.913) * (-1302.324) [-1300.502] (-1304.022) (-1302.705) -- 0:00:45
414000 -- [-1300.411] (-1305.726) (-1302.469) (-1300.656) * (-1302.802) (-1300.554) [-1304.862] (-1302.441) -- 0:00:45
414500 -- (-1301.615) [-1303.056] (-1301.407) (-1300.061) * (-1300.670) (-1302.058) (-1306.959) [-1301.341] -- 0:00:45
415000 -- (-1300.006) [-1304.170] (-1302.317) (-1300.884) * (-1300.664) (-1302.650) (-1305.232) [-1303.240] -- 0:00:45
Average standard deviation of split frequencies: 0.013360
415500 -- (-1299.573) [-1299.925] (-1300.675) (-1301.089) * (-1300.704) (-1303.591) (-1302.248) [-1301.701] -- 0:00:45
416000 -- (-1300.196) (-1300.868) (-1300.494) [-1301.477] * [-1300.674] (-1301.982) (-1300.556) (-1300.521) -- 0:00:44
416500 -- (-1303.339) (-1299.586) (-1302.495) [-1303.485] * (-1300.342) (-1301.831) (-1300.880) [-1302.494] -- 0:00:44
417000 -- (-1303.094) (-1300.559) (-1303.561) [-1303.493] * (-1301.403) (-1301.049) [-1300.576] (-1304.771) -- 0:00:44
417500 -- (-1303.211) (-1302.157) (-1306.016) [-1300.883] * (-1302.785) (-1301.534) (-1303.602) [-1302.098] -- 0:00:44
418000 -- (-1300.491) (-1302.100) (-1306.097) [-1301.379] * (-1302.567) (-1305.664) (-1301.971) [-1300.116] -- 0:00:45
418500 -- [-1303.559] (-1301.452) (-1300.530) (-1305.641) * (-1300.954) (-1301.834) [-1301.422] (-1303.859) -- 0:00:45
419000 -- (-1302.143) (-1300.113) [-1300.078] (-1304.674) * (-1301.756) (-1305.252) [-1301.475] (-1301.981) -- 0:00:45
419500 -- (-1304.740) [-1300.112] (-1303.607) (-1302.046) * [-1300.975] (-1303.525) (-1299.423) (-1303.734) -- 0:00:45
420000 -- (-1303.573) (-1302.064) (-1301.938) [-1303.228] * (-1301.488) (-1300.538) (-1300.131) [-1301.764] -- 0:00:45
Average standard deviation of split frequencies: 0.013624
420500 -- (-1304.828) (-1300.841) (-1307.215) [-1299.943] * (-1300.119) (-1301.203) [-1300.559] (-1305.897) -- 0:00:45
421000 -- [-1302.364] (-1300.671) (-1308.651) (-1304.239) * (-1304.196) (-1302.580) (-1305.261) [-1304.195] -- 0:00:45
421500 -- (-1299.727) [-1300.686] (-1303.835) (-1303.298) * (-1302.602) [-1300.980] (-1301.150) (-1302.183) -- 0:00:45
422000 -- [-1302.031] (-1305.569) (-1300.437) (-1302.394) * (-1301.815) (-1301.149) [-1302.660] (-1299.910) -- 0:00:45
422500 -- (-1303.275) (-1306.395) (-1302.715) [-1303.644] * (-1301.217) [-1303.765] (-1301.332) (-1300.587) -- 0:00:45
423000 -- [-1303.000] (-1304.398) (-1302.510) (-1302.792) * (-1303.671) (-1307.742) (-1300.058) [-1300.450] -- 0:00:45
423500 -- (-1300.423) (-1300.801) (-1301.002) [-1300.710] * (-1302.580) [-1303.549] (-1300.246) (-1300.447) -- 0:00:44
424000 -- (-1303.586) [-1303.196] (-1302.977) (-1301.179) * (-1303.677) [-1302.201] (-1300.872) (-1302.337) -- 0:00:44
424500 -- (-1299.887) (-1300.258) [-1302.032] (-1302.179) * [-1299.745] (-1302.857) (-1301.128) (-1301.063) -- 0:00:44
425000 -- (-1301.835) (-1300.953) (-1301.040) [-1302.207] * [-1300.408] (-1301.437) (-1302.368) (-1302.386) -- 0:00:44
Average standard deviation of split frequencies: 0.013978
425500 -- (-1301.786) [-1299.846] (-1300.166) (-1300.849) * (-1300.453) [-1300.774] (-1301.392) (-1300.556) -- 0:00:44
426000 -- (-1299.723) [-1300.347] (-1300.408) (-1300.852) * (-1300.082) (-1301.701) (-1302.663) [-1301.668] -- 0:00:44
426500 -- (-1302.363) (-1300.262) [-1300.954] (-1300.551) * (-1301.525) [-1301.517] (-1301.264) (-1301.479) -- 0:00:44
427000 -- (-1304.705) (-1301.369) [-1301.854] (-1303.160) * [-1301.525] (-1302.178) (-1303.129) (-1303.241) -- 0:00:44
427500 -- (-1301.260) (-1300.568) [-1301.103] (-1303.186) * (-1300.440) (-1308.919) [-1303.593] (-1301.271) -- 0:00:44
428000 -- (-1299.435) (-1303.023) [-1299.606] (-1299.781) * [-1304.598] (-1302.001) (-1301.357) (-1301.047) -- 0:00:44
428500 -- [-1300.779] (-1313.062) (-1301.568) (-1300.382) * [-1303.528] (-1302.890) (-1301.693) (-1302.820) -- 0:00:44
429000 -- [-1301.949] (-1313.518) (-1300.905) (-1300.610) * [-1301.753] (-1303.623) (-1307.436) (-1303.094) -- 0:00:43
429500 -- (-1301.222) (-1302.181) (-1303.354) [-1303.932] * (-1301.858) (-1301.360) (-1302.588) [-1301.244] -- 0:00:43
430000 -- (-1301.079) [-1304.295] (-1302.510) (-1302.675) * (-1301.461) (-1303.649) [-1301.245] (-1305.429) -- 0:00:43
Average standard deviation of split frequencies: 0.013538
430500 -- (-1304.367) (-1301.218) [-1303.263] (-1302.066) * (-1300.967) (-1302.800) [-1302.262] (-1304.916) -- 0:00:44
431000 -- (-1299.820) [-1302.357] (-1302.292) (-1300.590) * [-1304.192] (-1304.040) (-1300.506) (-1304.845) -- 0:00:44
431500 -- (-1302.158) (-1304.512) (-1303.002) [-1301.981] * (-1304.713) [-1300.521] (-1302.736) (-1306.297) -- 0:00:44
432000 -- (-1301.935) (-1302.809) [-1304.611] (-1301.334) * [-1306.707] (-1299.703) (-1301.416) (-1303.210) -- 0:00:44
432500 -- (-1302.448) (-1301.951) [-1301.261] (-1300.048) * (-1300.589) (-1299.988) [-1301.031] (-1301.531) -- 0:00:44
433000 -- (-1302.626) (-1303.513) (-1301.091) [-1300.215] * [-1303.041] (-1305.389) (-1301.293) (-1305.880) -- 0:00:44
433500 -- (-1308.630) [-1301.762] (-1301.919) (-1300.980) * (-1303.090) (-1301.155) [-1300.037] (-1300.942) -- 0:00:44
434000 -- (-1304.401) (-1300.095) (-1302.198) [-1300.078] * (-1301.829) [-1304.476] (-1299.565) (-1306.073) -- 0:00:44
434500 -- (-1303.178) [-1299.773] (-1302.732) (-1299.717) * (-1302.201) (-1303.810) [-1299.907] (-1301.566) -- 0:00:44
435000 -- (-1300.432) (-1302.190) [-1301.072] (-1301.264) * (-1301.041) [-1301.407] (-1301.320) (-1301.744) -- 0:00:44
Average standard deviation of split frequencies: 0.013259
435500 -- (-1301.584) (-1304.094) (-1301.549) [-1301.908] * [-1302.307] (-1303.633) (-1300.914) (-1303.819) -- 0:00:44
436000 -- [-1302.238] (-1304.821) (-1304.107) (-1304.278) * (-1300.394) [-1301.113] (-1301.789) (-1302.331) -- 0:00:43
436500 -- (-1302.505) (-1304.392) (-1301.530) [-1304.747] * (-1301.664) (-1303.462) [-1300.945] (-1300.545) -- 0:00:43
437000 -- (-1303.678) (-1302.438) [-1302.089] (-1301.456) * (-1301.208) [-1301.884] (-1303.767) (-1302.278) -- 0:00:43
437500 -- [-1304.257] (-1303.004) (-1301.238) (-1300.924) * (-1304.375) [-1302.999] (-1302.777) (-1301.466) -- 0:00:43
438000 -- [-1304.429] (-1301.464) (-1301.058) (-1310.083) * [-1300.470] (-1305.023) (-1303.842) (-1300.625) -- 0:00:43
438500 -- (-1300.446) (-1303.808) [-1302.190] (-1301.155) * (-1300.588) [-1302.505] (-1300.612) (-1299.886) -- 0:00:43
439000 -- [-1303.025] (-1303.705) (-1300.628) (-1301.621) * (-1300.624) (-1302.574) [-1302.938] (-1300.171) -- 0:00:43
439500 -- (-1301.030) (-1303.476) [-1300.124] (-1303.196) * [-1301.452] (-1302.761) (-1299.775) (-1301.776) -- 0:00:43
440000 -- [-1301.070] (-1304.597) (-1303.450) (-1300.509) * [-1302.458] (-1302.637) (-1303.812) (-1304.283) -- 0:00:43
Average standard deviation of split frequencies: 0.013847
440500 -- (-1303.318) [-1301.249] (-1305.993) (-1303.257) * (-1301.161) [-1300.216] (-1302.896) (-1301.758) -- 0:00:43
441000 -- (-1303.977) (-1300.806) (-1306.307) [-1300.573] * [-1300.309] (-1301.894) (-1302.130) (-1303.242) -- 0:00:43
441500 -- [-1301.928] (-1302.886) (-1303.289) (-1302.332) * (-1300.827) [-1305.415] (-1301.077) (-1303.118) -- 0:00:43
442000 -- (-1301.548) (-1304.396) (-1301.092) [-1302.182] * (-1303.451) (-1301.084) [-1303.078] (-1301.667) -- 0:00:42
442500 -- (-1302.212) [-1305.393] (-1303.429) (-1303.493) * (-1303.264) (-1300.341) [-1303.365] (-1306.483) -- 0:00:42
443000 -- (-1302.172) [-1302.674] (-1300.382) (-1302.078) * [-1301.033] (-1299.856) (-1302.403) (-1303.864) -- 0:00:42
443500 -- (-1300.848) [-1302.788] (-1301.368) (-1301.664) * (-1301.996) (-1302.226) (-1300.048) [-1303.359] -- 0:00:42
444000 -- (-1302.140) [-1302.043] (-1302.034) (-1304.592) * [-1301.734] (-1303.483) (-1300.569) (-1301.863) -- 0:00:43
444500 -- (-1302.606) [-1302.709] (-1301.980) (-1303.643) * (-1299.765) (-1300.208) (-1299.476) [-1301.387] -- 0:00:43
445000 -- [-1303.679] (-1301.808) (-1301.549) (-1302.235) * (-1300.387) (-1302.245) (-1308.751) [-1303.749] -- 0:00:43
Average standard deviation of split frequencies: 0.014621
445500 -- (-1305.461) (-1303.390) (-1300.002) [-1300.322] * [-1301.074] (-1300.068) (-1301.394) (-1304.034) -- 0:00:43
446000 -- (-1301.816) (-1300.809) (-1304.280) [-1299.901] * (-1302.579) (-1300.186) (-1303.457) [-1305.363] -- 0:00:43
446500 -- (-1301.038) [-1301.796] (-1301.519) (-1301.172) * (-1303.010) [-1300.413] (-1301.505) (-1302.750) -- 0:00:43
447000 -- (-1300.972) [-1301.904] (-1300.896) (-1302.660) * (-1304.995) (-1300.944) [-1302.749] (-1307.620) -- 0:00:43
447500 -- (-1302.397) (-1301.149) [-1301.821] (-1302.697) * (-1303.982) (-1302.358) [-1303.257] (-1303.468) -- 0:00:43
448000 -- (-1301.434) (-1300.199) (-1300.917) [-1300.134] * (-1304.285) (-1301.705) (-1300.725) [-1301.077] -- 0:00:43
448500 -- [-1300.716] (-1301.081) (-1302.022) (-1304.099) * (-1302.021) (-1300.653) (-1303.842) [-1303.281] -- 0:00:43
449000 -- [-1304.020] (-1301.862) (-1300.847) (-1307.435) * [-1300.980] (-1301.620) (-1310.099) (-1299.788) -- 0:00:42
449500 -- (-1309.372) (-1301.816) (-1301.757) [-1303.640] * (-1304.156) (-1308.639) (-1301.448) [-1301.862] -- 0:00:42
450000 -- (-1307.346) (-1299.718) (-1300.635) [-1303.427] * (-1301.651) [-1303.103] (-1300.580) (-1302.997) -- 0:00:42
Average standard deviation of split frequencies: 0.013773
450500 -- (-1306.969) (-1302.616) [-1300.389] (-1301.515) * (-1304.042) (-1301.126) (-1304.276) [-1301.892] -- 0:00:42
451000 -- (-1306.905) (-1302.371) (-1303.305) [-1301.219] * (-1301.569) [-1300.537] (-1304.518) (-1301.037) -- 0:00:42
451500 -- (-1306.520) (-1301.137) (-1301.085) [-1301.350] * [-1305.081] (-1300.170) (-1303.264) (-1302.403) -- 0:00:42
452000 -- (-1308.765) [-1302.554] (-1301.091) (-1301.172) * [-1302.763] (-1301.385) (-1305.229) (-1301.085) -- 0:00:42
452500 -- (-1303.714) (-1302.841) [-1300.511] (-1300.279) * [-1304.346] (-1301.251) (-1300.054) (-1304.003) -- 0:00:42
453000 -- [-1302.620] (-1303.824) (-1300.070) (-1301.383) * (-1300.535) [-1301.429] (-1300.361) (-1303.320) -- 0:00:42
453500 -- (-1303.525) (-1305.019) (-1301.484) [-1299.756] * (-1301.365) (-1302.006) (-1301.408) [-1301.540] -- 0:00:42
454000 -- (-1303.591) (-1302.949) (-1303.511) [-1301.416] * [-1302.162] (-1303.690) (-1303.131) (-1300.458) -- 0:00:42
454500 -- (-1305.779) (-1300.542) (-1302.972) [-1300.658] * (-1305.080) (-1303.696) [-1301.585] (-1300.501) -- 0:00:42
455000 -- (-1304.287) [-1302.441] (-1300.715) (-1306.028) * [-1301.041] (-1304.327) (-1300.582) (-1300.344) -- 0:00:41
Average standard deviation of split frequencies: 0.012041
455500 -- (-1302.112) (-1303.229) (-1300.540) [-1305.438] * (-1301.081) [-1299.779] (-1300.793) (-1301.662) -- 0:00:41
456000 -- (-1302.076) (-1301.655) (-1300.645) [-1305.420] * (-1303.315) [-1301.356] (-1302.346) (-1300.523) -- 0:00:41
456500 -- (-1304.728) (-1301.330) (-1306.206) [-1300.585] * (-1300.967) (-1300.294) (-1302.313) [-1301.750] -- 0:00:41
457000 -- (-1305.821) [-1303.644] (-1304.559) (-1299.690) * (-1300.386) [-1299.952] (-1301.972) (-1304.546) -- 0:00:41
457500 -- (-1308.443) (-1305.509) [-1301.839] (-1300.737) * (-1303.635) (-1301.464) (-1302.783) [-1307.676] -- 0:00:42
458000 -- [-1301.222] (-1299.848) (-1305.743) (-1300.705) * (-1303.925) [-1300.188] (-1300.872) (-1300.458) -- 0:00:42
458500 -- [-1300.514] (-1302.433) (-1305.935) (-1303.377) * [-1300.847] (-1300.644) (-1301.718) (-1300.387) -- 0:00:42
459000 -- [-1300.672] (-1301.750) (-1304.249) (-1304.668) * (-1301.985) (-1302.174) [-1301.275] (-1300.284) -- 0:00:42
459500 -- (-1300.675) [-1302.030] (-1302.217) (-1302.324) * (-1300.962) (-1301.306) [-1301.806] (-1299.925) -- 0:00:42
460000 -- (-1300.679) (-1306.851) (-1302.347) [-1304.753] * (-1303.432) (-1301.024) (-1304.072) [-1302.912] -- 0:00:42
Average standard deviation of split frequencies: 0.012159
460500 -- (-1303.270) [-1303.307] (-1308.890) (-1302.330) * (-1303.697) (-1301.103) [-1302.523] (-1303.260) -- 0:00:42
461000 -- (-1304.959) [-1304.524] (-1304.877) (-1303.157) * (-1302.119) (-1303.813) (-1304.398) [-1301.337] -- 0:00:42
461500 -- [-1300.825] (-1300.828) (-1301.808) (-1305.602) * (-1301.338) [-1300.721] (-1304.346) (-1302.984) -- 0:00:42
462000 -- (-1301.390) (-1302.588) [-1302.746] (-1302.196) * (-1302.307) (-1301.923) [-1300.260] (-1302.922) -- 0:00:41
462500 -- (-1304.962) [-1302.938] (-1302.203) (-1300.537) * (-1301.455) (-1302.957) (-1302.373) [-1301.599] -- 0:00:41
463000 -- (-1304.300) (-1302.613) (-1302.189) [-1299.845] * (-1301.801) (-1300.664) [-1301.348] (-1300.337) -- 0:00:41
463500 -- (-1301.875) (-1301.716) [-1300.045] (-1301.328) * (-1301.008) (-1300.664) [-1304.874] (-1301.185) -- 0:00:41
464000 -- (-1300.366) (-1303.530) [-1300.137] (-1300.818) * (-1302.941) [-1300.075] (-1303.054) (-1301.110) -- 0:00:41
464500 -- [-1300.679] (-1302.031) (-1300.121) (-1306.285) * [-1301.792] (-1300.764) (-1302.674) (-1301.560) -- 0:00:41
465000 -- (-1300.725) (-1301.467) (-1301.644) [-1300.677] * [-1300.486] (-1299.843) (-1302.783) (-1300.410) -- 0:00:41
Average standard deviation of split frequencies: 0.012083
465500 -- (-1300.793) (-1302.061) (-1303.384) [-1302.178] * (-1300.331) (-1301.777) (-1299.773) [-1302.777] -- 0:00:41
466000 -- (-1299.962) [-1301.264] (-1301.886) (-1300.730) * [-1300.214] (-1301.830) (-1300.127) (-1301.024) -- 0:00:41
466500 -- (-1300.078) (-1301.227) (-1307.342) [-1300.659] * (-1301.071) (-1303.876) (-1305.302) [-1302.881] -- 0:00:41
467000 -- (-1301.088) [-1301.108] (-1302.714) (-1302.948) * [-1304.034] (-1303.864) (-1304.090) (-1306.206) -- 0:00:41
467500 -- (-1300.435) (-1301.162) (-1302.196) [-1304.402] * (-1303.631) (-1303.076) [-1302.767] (-1302.439) -- 0:00:41
468000 -- [-1302.805] (-1301.255) (-1300.395) (-1302.231) * (-1300.945) [-1305.271] (-1304.223) (-1300.470) -- 0:00:40
468500 -- (-1303.088) (-1301.974) [-1299.679] (-1301.464) * (-1302.770) (-1301.744) (-1302.711) [-1300.698] -- 0:00:40
469000 -- (-1302.376) (-1303.487) [-1301.731] (-1302.467) * (-1306.557) [-1303.905] (-1300.623) (-1310.917) -- 0:00:40
469500 -- (-1303.710) (-1304.480) [-1301.523] (-1302.518) * (-1304.126) (-1301.735) (-1300.961) [-1301.282] -- 0:00:40
470000 -- (-1300.008) (-1299.435) (-1301.717) [-1301.142] * (-1301.535) (-1301.224) [-1300.364] (-1299.791) -- 0:00:40
Average standard deviation of split frequencies: 0.011724
470500 -- [-1300.228] (-1300.676) (-1302.839) (-1305.809) * (-1301.446) (-1305.215) [-1302.365] (-1301.955) -- 0:00:40
471000 -- (-1301.290) (-1299.632) (-1302.754) [-1300.177] * (-1303.793) (-1302.495) (-1301.025) [-1299.647] -- 0:00:41
471500 -- (-1300.141) [-1303.171] (-1300.490) (-1301.173) * (-1304.421) (-1301.429) (-1300.321) [-1299.526] -- 0:00:41
472000 -- (-1300.026) (-1302.596) [-1301.125] (-1302.464) * (-1300.464) (-1301.282) [-1300.378] (-1301.314) -- 0:00:41
472500 -- (-1301.384) (-1300.924) (-1301.660) [-1301.538] * (-1301.203) (-1302.317) [-1301.922] (-1301.315) -- 0:00:41
473000 -- (-1300.089) (-1299.751) [-1302.635] (-1300.711) * (-1305.132) [-1302.754] (-1301.898) (-1300.912) -- 0:00:41
473500 -- (-1300.935) [-1301.742] (-1304.658) (-1301.378) * (-1302.187) (-1301.073) (-1304.610) [-1300.344] -- 0:00:41
474000 -- (-1301.242) [-1300.916] (-1303.471) (-1306.596) * (-1301.536) (-1310.276) (-1301.277) [-1301.547] -- 0:00:41
474500 -- (-1302.402) (-1300.377) (-1304.016) [-1302.289] * (-1302.820) (-1303.766) (-1302.016) [-1300.530] -- 0:00:40
475000 -- [-1301.742] (-1304.800) (-1302.278) (-1303.047) * [-1302.090] (-1302.767) (-1300.064) (-1301.315) -- 0:00:40
Average standard deviation of split frequencies: 0.011127
475500 -- (-1308.333) (-1304.791) (-1300.779) [-1304.939] * [-1301.636] (-1303.312) (-1300.074) (-1302.243) -- 0:00:40
476000 -- (-1300.998) (-1303.134) [-1301.386] (-1302.100) * [-1303.871] (-1302.593) (-1300.581) (-1301.533) -- 0:00:40
476500 -- (-1300.513) [-1303.608] (-1299.630) (-1302.746) * [-1300.341] (-1304.597) (-1300.628) (-1300.856) -- 0:00:40
477000 -- (-1301.294) (-1303.294) [-1299.719] (-1303.171) * (-1301.688) (-1304.641) (-1301.480) [-1302.769] -- 0:00:40
477500 -- (-1302.969) (-1300.198) [-1302.746] (-1303.477) * (-1303.070) (-1305.362) (-1302.970) [-1301.171] -- 0:00:40
478000 -- (-1302.075) (-1301.396) (-1303.291) [-1299.808] * [-1303.214] (-1301.085) (-1300.679) (-1301.479) -- 0:00:40
478500 -- (-1301.665) (-1301.863) [-1302.786] (-1299.518) * [-1303.553] (-1302.586) (-1300.485) (-1301.888) -- 0:00:40
479000 -- (-1303.146) (-1305.727) (-1307.425) [-1301.457] * (-1303.438) (-1303.218) [-1300.854] (-1302.054) -- 0:00:40
479500 -- (-1301.376) [-1301.146] (-1301.314) (-1302.484) * (-1301.806) (-1302.732) [-1304.120] (-1302.788) -- 0:00:40
480000 -- [-1300.649] (-1304.771) (-1303.801) (-1300.790) * (-1301.271) (-1302.910) [-1300.211] (-1299.693) -- 0:00:40
Average standard deviation of split frequencies: 0.011538
480500 -- (-1301.868) [-1300.420] (-1303.298) (-1302.533) * (-1305.488) [-1306.992] (-1302.739) (-1302.486) -- 0:00:40
481000 -- (-1303.082) (-1303.333) (-1301.594) [-1302.544] * (-1300.915) (-1307.838) (-1304.771) [-1300.870] -- 0:00:39
481500 -- (-1300.558) (-1304.311) [-1302.182] (-1300.874) * (-1304.332) (-1305.904) (-1303.597) [-1300.719] -- 0:00:39
482000 -- (-1300.512) (-1300.206) (-1300.055) [-1302.996] * [-1302.842] (-1305.728) (-1301.337) (-1300.117) -- 0:00:39
482500 -- (-1300.417) (-1302.598) (-1300.034) [-1300.376] * [-1302.474] (-1300.027) (-1304.758) (-1300.112) -- 0:00:39
483000 -- (-1300.159) (-1302.156) (-1300.548) [-1300.543] * (-1302.426) (-1301.206) (-1303.051) [-1302.954] -- 0:00:39
483500 -- [-1300.886] (-1302.349) (-1300.449) (-1300.510) * (-1303.649) (-1300.868) (-1307.740) [-1300.360] -- 0:00:39
484000 -- [-1302.177] (-1301.782) (-1303.346) (-1301.497) * (-1309.342) [-1301.941] (-1302.880) (-1300.179) -- 0:00:40
484500 -- (-1301.460) (-1303.201) [-1300.217] (-1301.482) * (-1304.283) [-1301.777] (-1309.128) (-1300.679) -- 0:00:40
485000 -- (-1304.939) (-1306.383) [-1301.264] (-1301.183) * (-1300.834) (-1301.279) [-1302.088] (-1300.319) -- 0:00:40
Average standard deviation of split frequencies: 0.011526
485500 -- (-1301.244) (-1301.231) (-1301.416) [-1301.658] * (-1301.459) [-1306.174] (-1301.136) (-1302.446) -- 0:00:40
486000 -- (-1300.320) (-1303.844) (-1302.917) [-1302.413] * (-1300.524) (-1304.366) [-1301.615] (-1301.683) -- 0:00:40
486500 -- (-1300.457) [-1300.042] (-1300.775) (-1301.971) * (-1300.380) (-1304.124) [-1303.009] (-1300.896) -- 0:00:40
487000 -- (-1302.847) [-1300.319] (-1301.610) (-1301.593) * (-1303.392) (-1302.514) [-1302.389] (-1301.812) -- 0:00:40
487500 -- [-1300.459] (-1300.704) (-1300.334) (-1302.488) * (-1304.532) [-1299.925] (-1302.067) (-1303.820) -- 0:00:39
488000 -- [-1307.768] (-1300.264) (-1302.678) (-1300.235) * [-1303.393] (-1300.653) (-1300.863) (-1304.629) -- 0:00:39
488500 -- [-1302.775] (-1301.430) (-1303.543) (-1305.250) * (-1302.630) (-1301.785) (-1300.153) [-1300.263] -- 0:00:39
489000 -- [-1304.398] (-1305.578) (-1300.092) (-1301.794) * (-1300.085) [-1302.089] (-1303.975) (-1300.980) -- 0:00:39
489500 -- (-1304.857) (-1306.095) [-1301.044] (-1301.932) * (-1303.108) (-1301.889) (-1301.212) [-1303.695] -- 0:00:39
490000 -- [-1304.483] (-1306.339) (-1308.285) (-1306.159) * [-1301.491] (-1300.695) (-1307.633) (-1304.487) -- 0:00:39
Average standard deviation of split frequencies: 0.010738
490500 -- (-1303.361) [-1301.360] (-1303.614) (-1304.905) * [-1300.876] (-1301.880) (-1302.400) (-1305.388) -- 0:00:39
491000 -- (-1301.032) [-1301.362] (-1299.774) (-1301.944) * (-1302.550) (-1302.751) [-1300.929] (-1308.081) -- 0:00:39
491500 -- (-1302.085) (-1300.040) [-1300.287] (-1302.653) * (-1300.094) (-1304.061) (-1302.411) [-1302.062] -- 0:00:39
492000 -- (-1302.351) (-1301.143) [-1303.976] (-1301.168) * [-1300.117] (-1304.672) (-1302.374) (-1301.013) -- 0:00:39
492500 -- (-1302.122) (-1301.221) [-1303.216] (-1299.934) * (-1299.893) (-1302.956) [-1309.526] (-1301.645) -- 0:00:39
493000 -- (-1302.679) [-1302.195] (-1302.016) (-1300.486) * [-1305.671] (-1300.729) (-1302.099) (-1301.988) -- 0:00:39
493500 -- (-1302.423) [-1304.445] (-1302.206) (-1301.009) * [-1300.057] (-1300.622) (-1303.042) (-1304.444) -- 0:00:39
494000 -- (-1301.058) (-1302.734) (-1301.940) [-1301.792] * (-1300.277) [-1303.232] (-1301.411) (-1302.732) -- 0:00:38
494500 -- (-1300.101) (-1304.543) (-1302.203) [-1302.022] * (-1300.981) (-1302.150) (-1302.550) [-1306.873] -- 0:00:38
495000 -- [-1300.379] (-1308.075) (-1304.322) (-1300.244) * (-1299.764) (-1301.995) (-1300.732) [-1301.405] -- 0:00:38
Average standard deviation of split frequencies: 0.011125
495500 -- [-1301.713] (-1301.839) (-1303.619) (-1303.266) * (-1299.678) [-1301.648] (-1300.583) (-1301.835) -- 0:00:38
496000 -- (-1301.174) [-1302.374] (-1303.718) (-1305.219) * (-1302.840) [-1302.782] (-1303.786) (-1307.507) -- 0:00:38
496500 -- (-1302.822) (-1301.494) [-1304.493] (-1302.667) * (-1300.915) (-1300.913) (-1302.081) [-1302.755] -- 0:00:38
497000 -- (-1301.931) [-1303.702] (-1299.930) (-1299.874) * [-1300.575] (-1301.905) (-1301.685) (-1302.756) -- 0:00:38
497500 -- (-1301.217) (-1301.160) (-1300.717) [-1302.257] * (-1300.569) [-1302.434] (-1301.299) (-1302.037) -- 0:00:39
498000 -- (-1302.630) (-1301.704) [-1300.453] (-1304.525) * (-1303.375) [-1301.028] (-1301.716) (-1301.184) -- 0:00:39
498500 -- (-1302.578) [-1303.320] (-1305.100) (-1305.265) * (-1302.482) (-1301.912) [-1301.516] (-1302.133) -- 0:00:39
499000 -- [-1300.631] (-1301.214) (-1303.782) (-1301.208) * (-1307.541) (-1302.427) (-1302.148) [-1299.834] -- 0:00:39
499500 -- (-1301.293) (-1301.026) (-1306.555) [-1305.309] * [-1302.155] (-1300.972) (-1301.124) (-1303.806) -- 0:00:39
500000 -- (-1301.198) [-1302.203] (-1305.904) (-1301.061) * (-1301.777) (-1300.296) (-1300.461) [-1303.746] -- 0:00:39
Average standard deviation of split frequencies: 0.011465
500500 -- [-1300.596] (-1301.986) (-1305.089) (-1303.520) * [-1302.496] (-1300.730) (-1301.267) (-1301.642) -- 0:00:38
501000 -- (-1301.773) (-1301.606) [-1301.241] (-1300.290) * (-1301.003) (-1300.215) [-1303.063] (-1301.286) -- 0:00:38
501500 -- [-1300.430] (-1301.190) (-1301.233) (-1306.022) * (-1311.415) (-1300.443) (-1300.364) [-1303.994] -- 0:00:38
502000 -- (-1302.195) (-1303.145) (-1305.237) [-1303.017] * (-1304.000) (-1300.235) [-1300.688] (-1301.640) -- 0:00:38
502500 -- (-1307.688) [-1301.617] (-1302.254) (-1301.796) * (-1301.785) (-1300.995) (-1300.596) [-1301.433] -- 0:00:38
503000 -- (-1300.861) [-1299.723] (-1301.726) (-1300.493) * (-1300.063) (-1301.219) (-1300.403) [-1301.725] -- 0:00:38
503500 -- (-1300.852) [-1299.914] (-1303.118) (-1301.258) * (-1301.790) (-1304.226) [-1301.541] (-1304.184) -- 0:00:38
504000 -- (-1299.733) [-1299.434] (-1301.168) (-1299.856) * (-1303.184) (-1302.823) [-1302.815] (-1301.119) -- 0:00:38
504500 -- [-1300.947] (-1300.206) (-1303.380) (-1300.858) * (-1302.099) [-1302.710] (-1301.266) (-1302.144) -- 0:00:38
505000 -- [-1306.299] (-1301.976) (-1304.087) (-1303.914) * [-1301.392] (-1302.424) (-1305.291) (-1303.354) -- 0:00:38
Average standard deviation of split frequencies: 0.011728
505500 -- (-1304.454) [-1303.020] (-1303.528) (-1303.837) * (-1302.172) [-1301.828] (-1300.902) (-1301.830) -- 0:00:38
506000 -- (-1302.183) [-1300.343] (-1300.664) (-1302.368) * (-1302.320) (-1303.156) [-1300.295] (-1301.422) -- 0:00:38
506500 -- (-1301.781) [-1299.909] (-1301.212) (-1300.189) * (-1301.993) (-1300.656) [-1301.353] (-1301.569) -- 0:00:37
507000 -- [-1301.066] (-1300.042) (-1300.303) (-1307.554) * (-1300.671) (-1301.345) (-1299.963) [-1301.542] -- 0:00:37
507500 -- (-1300.155) (-1300.570) (-1302.067) [-1307.659] * (-1300.158) (-1300.743) [-1303.080] (-1304.181) -- 0:00:37
508000 -- (-1302.985) (-1300.103) (-1303.723) [-1299.968] * (-1299.870) [-1301.721] (-1304.565) (-1303.523) -- 0:00:37
508500 -- [-1304.341] (-1300.347) (-1303.644) (-1302.861) * (-1300.757) (-1301.532) [-1301.188] (-1303.203) -- 0:00:37
509000 -- (-1304.370) [-1303.483] (-1302.579) (-1300.513) * [-1303.447] (-1301.084) (-1303.339) (-1302.514) -- 0:00:37
509500 -- (-1304.220) (-1302.444) (-1305.038) [-1301.824] * (-1303.134) (-1301.428) (-1304.205) [-1299.530] -- 0:00:37
510000 -- [-1300.838] (-1302.207) (-1302.026) (-1300.922) * [-1301.321] (-1301.229) (-1307.237) (-1299.593) -- 0:00:37
Average standard deviation of split frequencies: 0.012347
510500 -- (-1308.147) [-1301.647] (-1306.222) (-1302.488) * (-1302.886) [-1300.521] (-1303.481) (-1301.201) -- 0:00:38
511000 -- (-1304.569) [-1301.117] (-1304.357) (-1306.431) * [-1303.552] (-1300.875) (-1300.180) (-1301.392) -- 0:00:38
511500 -- [-1301.045] (-1305.540) (-1303.908) (-1305.652) * (-1301.941) (-1304.014) [-1301.161] (-1303.334) -- 0:00:38
512000 -- (-1305.209) [-1302.281] (-1302.065) (-1301.195) * (-1301.649) (-1301.166) (-1304.706) [-1301.259] -- 0:00:38
512500 -- (-1300.761) (-1303.881) [-1300.053] (-1305.649) * [-1301.435] (-1301.177) (-1301.698) (-1301.290) -- 0:00:38
513000 -- (-1299.775) (-1307.385) [-1303.071] (-1300.744) * (-1299.955) [-1300.321] (-1301.804) (-1301.557) -- 0:00:37
513500 -- (-1299.926) (-1303.412) (-1301.868) [-1300.668] * [-1304.282] (-1301.095) (-1300.361) (-1301.527) -- 0:00:37
514000 -- (-1302.375) (-1303.437) (-1301.827) [-1300.251] * (-1305.953) (-1306.785) (-1300.646) [-1301.807] -- 0:00:37
514500 -- (-1305.532) (-1302.334) (-1301.184) [-1300.960] * [-1300.625] (-1303.278) (-1302.184) (-1306.137) -- 0:00:37
515000 -- (-1301.701) (-1303.638) (-1304.963) [-1303.760] * (-1301.604) (-1301.550) (-1302.006) [-1303.734] -- 0:00:37
Average standard deviation of split frequencies: 0.011762
515500 -- (-1301.089) [-1305.589] (-1300.934) (-1307.176) * (-1300.961) (-1301.755) (-1300.398) [-1302.484] -- 0:00:37
516000 -- (-1303.606) (-1302.300) (-1300.686) [-1307.858] * (-1302.279) [-1299.763] (-1299.971) (-1301.486) -- 0:00:37
516500 -- (-1302.547) [-1301.497] (-1301.199) (-1302.666) * (-1302.779) [-1300.439] (-1300.165) (-1303.544) -- 0:00:37
517000 -- [-1303.851] (-1300.822) (-1300.133) (-1302.256) * (-1300.673) [-1300.321] (-1301.550) (-1304.991) -- 0:00:37
517500 -- [-1303.577] (-1300.040) (-1299.970) (-1302.241) * (-1300.078) [-1301.928] (-1301.152) (-1300.795) -- 0:00:37
518000 -- (-1301.153) (-1301.235) [-1303.091] (-1303.263) * [-1300.078] (-1301.694) (-1303.276) (-1302.006) -- 0:00:37
518500 -- [-1301.153] (-1301.143) (-1300.548) (-1301.159) * [-1301.069] (-1304.033) (-1300.574) (-1301.588) -- 0:00:37
519000 -- (-1299.747) (-1303.416) [-1300.127] (-1305.351) * (-1303.726) (-1301.899) (-1302.950) [-1300.815] -- 0:00:37
519500 -- [-1300.778] (-1308.158) (-1300.884) (-1303.464) * [-1302.103] (-1301.582) (-1304.017) (-1300.686) -- 0:00:36
520000 -- [-1300.775] (-1300.984) (-1302.671) (-1302.252) * (-1301.541) (-1301.592) (-1301.817) [-1301.064] -- 0:00:36
Average standard deviation of split frequencies: 0.012011
520500 -- (-1302.578) (-1300.267) (-1303.751) [-1300.549] * [-1301.076] (-1300.561) (-1301.407) (-1300.107) -- 0:00:36
521000 -- (-1300.406) (-1301.272) (-1301.262) [-1300.748] * (-1300.552) [-1300.258] (-1302.062) (-1303.137) -- 0:00:36
521500 -- [-1302.556] (-1301.213) (-1303.165) (-1303.554) * (-1300.242) (-1300.074) [-1301.247] (-1301.613) -- 0:00:36
522000 -- (-1302.289) (-1299.857) (-1305.562) [-1301.239] * (-1300.300) (-1301.747) (-1300.770) [-1303.247] -- 0:00:36
522500 -- (-1300.680) (-1299.949) [-1300.896] (-1301.350) * [-1302.957] (-1303.897) (-1301.481) (-1302.333) -- 0:00:36
523000 -- (-1304.375) [-1301.280] (-1300.473) (-1301.283) * [-1303.050] (-1301.450) (-1301.401) (-1303.265) -- 0:00:36
523500 -- (-1300.493) (-1301.017) [-1300.761] (-1301.785) * [-1302.275] (-1301.277) (-1302.138) (-1302.472) -- 0:00:36
524000 -- [-1300.733] (-1301.403) (-1299.913) (-1304.482) * (-1301.659) (-1302.923) [-1302.270] (-1301.047) -- 0:00:37
524500 -- (-1305.060) [-1303.233] (-1299.681) (-1301.706) * (-1303.234) (-1301.732) [-1302.007] (-1300.916) -- 0:00:37
525000 -- (-1303.837) (-1301.571) [-1299.927] (-1302.537) * (-1301.591) (-1303.169) (-1301.940) [-1300.776] -- 0:00:37
Average standard deviation of split frequencies: 0.011890
525500 -- [-1301.113] (-1300.193) (-1300.926) (-1301.771) * (-1303.048) [-1301.251] (-1302.937) (-1301.127) -- 0:00:37
526000 -- (-1300.949) (-1301.628) (-1301.859) [-1303.491] * (-1301.935) [-1302.705] (-1301.512) (-1303.102) -- 0:00:36
526500 -- (-1301.466) (-1304.154) [-1302.372] (-1303.477) * (-1300.856) (-1303.087) [-1301.907] (-1299.880) -- 0:00:36
527000 -- (-1304.898) [-1300.561] (-1302.921) (-1302.350) * [-1300.040] (-1300.563) (-1302.281) (-1305.003) -- 0:00:36
527500 -- [-1300.390] (-1300.807) (-1304.538) (-1300.616) * (-1303.124) (-1300.642) [-1300.961] (-1300.738) -- 0:00:36
528000 -- (-1302.228) (-1302.019) [-1301.014] (-1301.879) * [-1300.305] (-1300.513) (-1305.282) (-1302.086) -- 0:00:36
528500 -- [-1299.588] (-1303.157) (-1301.514) (-1300.786) * (-1301.038) (-1300.676) (-1301.253) [-1303.339] -- 0:00:36
529000 -- [-1300.599] (-1302.478) (-1302.401) (-1301.267) * (-1301.654) (-1301.762) [-1300.084] (-1304.591) -- 0:00:36
529500 -- [-1300.565] (-1301.652) (-1302.608) (-1302.711) * (-1303.853) [-1301.620] (-1303.384) (-1304.861) -- 0:00:36
530000 -- (-1301.099) [-1301.103] (-1300.791) (-1302.533) * (-1306.133) (-1303.661) [-1300.541] (-1300.511) -- 0:00:36
Average standard deviation of split frequencies: 0.011489
530500 -- (-1299.888) [-1300.686] (-1300.532) (-1306.047) * [-1300.491] (-1302.737) (-1302.443) (-1303.499) -- 0:00:36
531000 -- (-1300.169) (-1301.558) [-1302.558] (-1302.447) * [-1300.573] (-1302.103) (-1302.016) (-1304.081) -- 0:00:36
531500 -- (-1301.118) [-1301.312] (-1300.415) (-1303.422) * (-1299.983) (-1302.076) [-1301.098] (-1300.558) -- 0:00:36
532000 -- (-1306.009) [-1300.947] (-1304.047) (-1301.363) * [-1300.702] (-1303.522) (-1301.199) (-1302.896) -- 0:00:36
532500 -- [-1301.121] (-1300.911) (-1300.756) (-1303.293) * [-1299.879] (-1303.753) (-1302.240) (-1302.749) -- 0:00:35
533000 -- [-1301.392] (-1300.481) (-1303.584) (-1301.238) * (-1301.157) (-1301.804) [-1304.892] (-1300.976) -- 0:00:35
533500 -- (-1305.818) (-1302.181) [-1300.236] (-1300.503) * [-1302.938] (-1301.987) (-1302.438) (-1302.410) -- 0:00:35
534000 -- (-1301.161) (-1303.878) [-1300.787] (-1301.079) * (-1301.633) [-1303.492] (-1301.186) (-1300.606) -- 0:00:35
534500 -- (-1301.331) (-1303.671) (-1300.454) [-1300.158] * (-1301.509) (-1304.292) (-1305.444) [-1300.127] -- 0:00:35
535000 -- (-1303.100) (-1303.874) (-1301.605) [-1300.743] * (-1302.018) (-1300.617) (-1305.360) [-1300.510] -- 0:00:35
Average standard deviation of split frequencies: 0.011726
535500 -- (-1301.348) (-1300.086) [-1301.786] (-1302.837) * (-1300.787) (-1300.920) (-1300.240) [-1302.774] -- 0:00:35
536000 -- (-1302.590) [-1300.939] (-1301.458) (-1303.556) * [-1302.194] (-1303.281) (-1304.337) (-1301.732) -- 0:00:35
536500 -- (-1301.693) (-1302.111) (-1301.385) [-1305.626] * [-1307.888] (-1304.575) (-1302.115) (-1302.463) -- 0:00:35
537000 -- (-1306.365) (-1300.552) (-1302.022) [-1304.608] * (-1302.278) [-1301.076] (-1301.201) (-1303.123) -- 0:00:35
537500 -- (-1302.359) (-1299.657) (-1299.514) [-1300.250] * (-1301.266) (-1300.122) [-1301.216] (-1303.501) -- 0:00:36
538000 -- (-1302.988) (-1300.705) [-1300.261] (-1300.312) * (-1300.597) (-1301.783) (-1301.987) [-1302.130] -- 0:00:36
538500 -- (-1302.177) (-1302.699) (-1300.273) [-1300.938] * (-1302.439) (-1301.717) (-1301.902) [-1305.550] -- 0:00:35
539000 -- (-1301.744) (-1301.508) [-1300.866] (-1302.070) * [-1305.024] (-1302.391) (-1302.203) (-1307.041) -- 0:00:35
539500 -- (-1300.742) (-1302.995) [-1301.097] (-1300.244) * (-1301.999) [-1303.963] (-1301.983) (-1302.689) -- 0:00:35
540000 -- (-1300.512) [-1301.078] (-1302.118) (-1303.608) * [-1300.566] (-1301.426) (-1303.234) (-1303.997) -- 0:00:35
Average standard deviation of split frequencies: 0.011160
540500 -- (-1303.114) (-1305.043) (-1300.794) [-1300.886] * [-1300.813] (-1301.408) (-1301.926) (-1301.430) -- 0:00:35
541000 -- (-1301.904) (-1302.728) (-1301.870) [-1301.035] * [-1300.904] (-1302.878) (-1305.165) (-1303.641) -- 0:00:35
541500 -- (-1303.474) [-1302.929] (-1301.974) (-1300.325) * (-1302.535) (-1299.767) (-1303.799) [-1301.815] -- 0:00:35
542000 -- [-1301.977] (-1305.800) (-1301.132) (-1299.964) * (-1302.376) (-1304.248) (-1305.518) [-1300.754] -- 0:00:35
542500 -- [-1303.217] (-1301.963) (-1306.240) (-1301.019) * (-1301.104) (-1300.640) [-1302.329] (-1300.389) -- 0:00:35
543000 -- [-1305.211] (-1307.843) (-1303.081) (-1301.007) * (-1303.709) (-1300.990) [-1300.353] (-1299.895) -- 0:00:35
543500 -- (-1303.533) [-1300.444] (-1302.578) (-1301.891) * [-1302.403] (-1300.759) (-1303.344) (-1300.495) -- 0:00:35
544000 -- (-1305.395) (-1301.125) (-1301.861) [-1303.213] * (-1305.415) [-1301.998] (-1302.441) (-1305.333) -- 0:00:35
544500 -- [-1300.858] (-1304.943) (-1301.737) (-1300.580) * (-1303.267) (-1300.359) (-1304.758) [-1301.241] -- 0:00:35
545000 -- [-1300.242] (-1302.926) (-1301.237) (-1300.911) * [-1304.014] (-1304.232) (-1301.015) (-1302.020) -- 0:00:35
Average standard deviation of split frequencies: 0.010821
545500 -- (-1300.960) [-1303.580] (-1301.983) (-1300.318) * (-1300.302) [-1302.613] (-1309.041) (-1301.007) -- 0:00:34
546000 -- (-1301.709) (-1302.306) (-1301.865) [-1300.487] * [-1305.449] (-1301.823) (-1303.253) (-1299.533) -- 0:00:34
546500 -- (-1308.620) [-1303.672] (-1304.063) (-1304.038) * [-1302.048] (-1301.538) (-1302.620) (-1300.624) -- 0:00:34
547000 -- (-1301.236) [-1299.895] (-1305.934) (-1302.773) * (-1300.460) [-1301.491] (-1301.675) (-1301.638) -- 0:00:34
547500 -- (-1302.210) [-1300.023] (-1303.462) (-1307.011) * (-1300.365) (-1301.531) [-1300.052] (-1301.769) -- 0:00:34
548000 -- (-1305.357) (-1302.215) (-1303.966) [-1303.412] * [-1299.958] (-1301.520) (-1300.877) (-1303.262) -- 0:00:34
548500 -- (-1302.597) (-1302.317) [-1301.135] (-1302.794) * [-1301.689] (-1301.249) (-1300.992) (-1301.198) -- 0:00:34
549000 -- (-1302.616) (-1301.802) (-1302.469) [-1303.020] * (-1303.049) (-1299.810) (-1302.487) [-1300.243] -- 0:00:34
549500 -- (-1304.955) (-1304.679) [-1301.760] (-1304.844) * (-1302.948) (-1299.562) [-1301.599] (-1301.386) -- 0:00:34
550000 -- [-1299.780] (-1302.282) (-1302.310) (-1305.214) * (-1300.813) (-1300.819) [-1302.098] (-1299.729) -- 0:00:34
Average standard deviation of split frequencies: 0.010330
550500 -- [-1301.428] (-1303.006) (-1300.058) (-1299.940) * (-1300.655) (-1301.653) [-1300.674] (-1300.433) -- 0:00:34
551000 -- (-1299.928) [-1306.392] (-1302.913) (-1304.538) * (-1301.212) [-1302.593] (-1301.016) (-1306.273) -- 0:00:35
551500 -- [-1300.216] (-1303.118) (-1304.586) (-1301.283) * (-1301.738) (-1301.353) [-1304.068] (-1302.434) -- 0:00:34
552000 -- [-1303.099] (-1303.279) (-1302.297) (-1301.277) * (-1301.592) (-1302.325) [-1299.909] (-1307.318) -- 0:00:34
552500 -- (-1300.803) (-1301.628) [-1300.626] (-1302.204) * [-1301.017] (-1301.592) (-1302.166) (-1300.355) -- 0:00:34
553000 -- (-1301.759) (-1303.500) [-1301.505] (-1300.673) * (-1302.896) [-1300.068] (-1299.892) (-1301.194) -- 0:00:34
553500 -- (-1299.866) [-1300.984] (-1301.274) (-1300.596) * (-1303.640) [-1300.022] (-1302.384) (-1304.923) -- 0:00:34
554000 -- (-1302.882) (-1300.984) [-1299.983] (-1302.055) * [-1303.085] (-1300.147) (-1302.581) (-1303.708) -- 0:00:34
554500 -- [-1302.629] (-1302.503) (-1299.907) (-1301.199) * [-1301.474] (-1302.073) (-1300.827) (-1299.794) -- 0:00:34
555000 -- (-1301.540) (-1303.542) (-1301.734) [-1300.998] * (-1301.679) (-1302.632) (-1301.626) [-1303.431] -- 0:00:34
Average standard deviation of split frequencies: 0.010626
555500 -- (-1300.776) (-1301.224) (-1300.896) [-1300.477] * [-1302.813] (-1302.632) (-1302.632) (-1306.757) -- 0:00:34
556000 -- (-1302.531) (-1299.843) (-1304.410) [-1300.475] * [-1301.129] (-1302.599) (-1302.388) (-1300.815) -- 0:00:34
556500 -- [-1301.293] (-1301.555) (-1307.116) (-1305.695) * (-1300.001) [-1301.973] (-1299.696) (-1300.983) -- 0:00:34
557000 -- (-1300.285) (-1303.810) [-1302.387] (-1300.830) * (-1303.067) (-1301.453) (-1300.488) [-1302.330] -- 0:00:34
557500 -- (-1301.194) (-1308.120) (-1301.522) [-1301.010] * [-1302.395] (-1300.285) (-1300.129) (-1304.954) -- 0:00:34
558000 -- (-1301.812) [-1300.394] (-1301.536) (-1304.756) * (-1303.132) (-1300.978) (-1300.078) [-1303.781] -- 0:00:34
558500 -- (-1300.596) (-1299.627) (-1302.220) [-1303.969] * (-1305.146) (-1308.414) (-1299.750) [-1301.165] -- 0:00:33
559000 -- [-1299.925] (-1300.720) (-1305.297) (-1299.889) * (-1303.099) [-1306.240] (-1306.362) (-1300.149) -- 0:00:33
559500 -- (-1299.865) [-1300.255] (-1302.211) (-1300.237) * (-1300.767) [-1303.573] (-1305.842) (-1301.891) -- 0:00:33
560000 -- (-1299.823) (-1301.802) [-1299.877] (-1300.649) * (-1304.414) (-1301.761) [-1302.469] (-1301.744) -- 0:00:33
Average standard deviation of split frequencies: 0.011267
560500 -- (-1301.162) (-1303.319) [-1302.184] (-1300.649) * (-1302.827) (-1301.611) [-1300.937] (-1308.379) -- 0:00:33
561000 -- (-1306.329) [-1300.274] (-1299.919) (-1302.419) * (-1299.782) [-1300.627] (-1301.487) (-1305.806) -- 0:00:33
561500 -- (-1307.648) (-1303.964) [-1301.268] (-1300.909) * (-1300.724) (-1300.725) [-1300.727] (-1304.225) -- 0:00:33
562000 -- (-1309.420) [-1302.605] (-1301.714) (-1299.879) * (-1302.482) [-1300.610] (-1301.407) (-1300.949) -- 0:00:33
562500 -- [-1303.156] (-1300.238) (-1300.402) (-1302.747) * (-1301.426) (-1300.147) (-1301.120) [-1300.142] -- 0:00:33
563000 -- (-1302.161) [-1299.935] (-1301.118) (-1302.147) * [-1300.907] (-1301.337) (-1300.311) (-1302.612) -- 0:00:33
563500 -- (-1301.620) (-1300.633) [-1301.970] (-1302.300) * (-1300.362) (-1303.028) (-1301.988) [-1300.040] -- 0:00:33
564000 -- (-1301.404) [-1299.717] (-1302.218) (-1300.145) * [-1304.561] (-1302.515) (-1305.231) (-1301.477) -- 0:00:33
564500 -- [-1302.362] (-1302.054) (-1302.160) (-1300.103) * [-1301.347] (-1299.889) (-1302.200) (-1302.732) -- 0:00:33
565000 -- (-1302.047) [-1300.670] (-1300.258) (-1299.630) * (-1303.680) [-1299.680] (-1308.032) (-1303.897) -- 0:00:33
Average standard deviation of split frequencies: 0.011160
565500 -- (-1300.252) (-1301.742) (-1300.204) [-1300.672] * (-1303.159) [-1301.593] (-1303.397) (-1303.578) -- 0:00:33
566000 -- [-1302.518] (-1303.319) (-1300.823) (-1301.413) * (-1304.461) (-1307.273) (-1305.168) [-1301.162] -- 0:00:33
566500 -- (-1301.247) (-1306.777) (-1301.822) [-1302.051] * (-1303.026) (-1303.078) (-1303.640) [-1302.644] -- 0:00:33
567000 -- [-1303.462] (-1301.913) (-1301.002) (-1301.933) * (-1306.737) (-1302.037) (-1301.289) [-1301.015] -- 0:00:33
567500 -- (-1303.022) [-1301.785] (-1301.069) (-1302.869) * (-1301.594) [-1301.390] (-1303.266) (-1300.768) -- 0:00:33
568000 -- (-1302.135) (-1302.431) [-1301.276] (-1304.812) * (-1299.877) [-1302.330] (-1301.580) (-1301.548) -- 0:00:33
568500 -- (-1305.256) (-1300.091) [-1302.576] (-1303.672) * (-1299.484) (-1302.434) [-1303.906] (-1302.805) -- 0:00:33
569000 -- (-1300.241) [-1300.595] (-1305.028) (-1302.760) * (-1300.746) (-1300.340) [-1301.261] (-1299.970) -- 0:00:33
569500 -- (-1301.623) (-1303.767) (-1300.792) [-1301.315] * (-1301.232) (-1302.945) (-1306.696) [-1300.586] -- 0:00:33
570000 -- [-1300.059] (-1303.644) (-1301.356) (-1302.241) * (-1302.633) (-1302.708) [-1300.345] (-1301.437) -- 0:00:33
Average standard deviation of split frequencies: 0.010739
570500 -- (-1300.123) [-1301.221] (-1302.383) (-1300.601) * (-1300.830) (-1300.605) [-1305.102] (-1300.591) -- 0:00:33
571000 -- (-1301.832) [-1302.642] (-1301.024) (-1300.721) * (-1300.374) (-1305.238) (-1302.328) [-1303.183] -- 0:00:33
571500 -- (-1302.070) (-1300.790) [-1300.050] (-1300.550) * (-1301.567) (-1302.858) [-1300.668] (-1302.917) -- 0:00:32
572000 -- (-1302.445) [-1301.633] (-1303.627) (-1306.376) * [-1302.619] (-1302.948) (-1306.501) (-1304.552) -- 0:00:32
572500 -- (-1302.188) [-1300.391] (-1300.422) (-1301.687) * (-1300.672) [-1302.189] (-1310.194) (-1302.588) -- 0:00:32
573000 -- (-1301.191) (-1301.141) [-1300.807] (-1303.598) * (-1300.789) (-1308.301) [-1301.555] (-1303.968) -- 0:00:32
573500 -- [-1303.190] (-1300.506) (-1300.081) (-1300.830) * [-1303.217] (-1305.116) (-1300.786) (-1302.451) -- 0:00:32
574000 -- [-1300.231] (-1300.400) (-1300.088) (-1302.097) * (-1300.691) [-1307.058] (-1301.005) (-1303.442) -- 0:00:32
574500 -- [-1300.076] (-1302.882) (-1300.093) (-1302.061) * [-1302.884] (-1304.904) (-1301.078) (-1299.533) -- 0:00:32
575000 -- (-1299.445) (-1304.308) (-1301.916) [-1301.098] * [-1300.407] (-1303.793) (-1301.730) (-1301.943) -- 0:00:32
Average standard deviation of split frequencies: 0.010912
575500 -- (-1300.619) (-1300.785) (-1303.902) [-1303.321] * (-1302.278) (-1302.160) (-1302.914) [-1302.758] -- 0:00:32
576000 -- (-1301.649) (-1301.180) (-1303.694) [-1303.417] * (-1300.372) (-1302.356) (-1304.489) [-1302.434] -- 0:00:32
576500 -- [-1301.507] (-1302.458) (-1303.576) (-1300.775) * (-1300.347) (-1302.034) [-1302.353] (-1301.789) -- 0:00:32
577000 -- (-1302.466) (-1302.269) (-1307.392) [-1300.676] * (-1300.119) (-1302.742) [-1304.297] (-1301.547) -- 0:00:32
577500 -- (-1301.961) (-1301.069) (-1303.149) [-1302.206] * (-1302.218) (-1303.929) (-1304.056) [-1301.719] -- 0:00:32
578000 -- [-1302.041] (-1300.728) (-1302.557) (-1302.260) * (-1303.588) (-1300.337) (-1301.118) [-1300.664] -- 0:00:32
578500 -- (-1304.984) (-1302.042) [-1301.425] (-1303.659) * (-1304.942) (-1300.337) [-1300.271] (-1300.456) -- 0:00:32
579000 -- [-1301.617] (-1304.001) (-1302.255) (-1304.990) * (-1303.694) (-1301.626) (-1301.750) [-1300.661] -- 0:00:32
579500 -- [-1304.426] (-1302.541) (-1302.390) (-1302.259) * (-1302.194) (-1300.231) [-1302.684] (-1304.712) -- 0:00:32
580000 -- (-1307.054) (-1306.417) [-1301.254] (-1303.726) * (-1301.501) (-1301.007) [-1301.253] (-1304.021) -- 0:00:32
Average standard deviation of split frequencies: 0.011149
580500 -- (-1302.942) [-1300.799] (-1300.027) (-1300.960) * (-1303.858) (-1300.037) (-1300.824) [-1302.504] -- 0:00:32
581000 -- (-1303.024) [-1299.607] (-1300.928) (-1299.907) * [-1302.252] (-1299.755) (-1304.528) (-1303.906) -- 0:00:32
581500 -- [-1304.032] (-1301.218) (-1300.947) (-1305.204) * (-1303.300) [-1301.616] (-1300.913) (-1303.605) -- 0:00:32
582000 -- (-1302.657) [-1300.041] (-1300.179) (-1301.665) * (-1300.992) (-1304.205) (-1301.226) [-1302.464] -- 0:00:32
582500 -- (-1301.801) [-1303.705] (-1301.806) (-1299.603) * [-1301.674] (-1300.951) (-1300.767) (-1304.699) -- 0:00:32
583000 -- (-1304.330) [-1301.600] (-1308.176) (-1300.332) * [-1301.347] (-1300.493) (-1310.606) (-1301.389) -- 0:00:32
583500 -- (-1302.858) (-1301.388) (-1306.637) [-1301.785] * [-1300.071] (-1300.609) (-1299.877) (-1301.155) -- 0:00:32
584000 -- (-1301.935) (-1300.187) (-1303.711) [-1304.881] * (-1302.836) (-1301.810) [-1299.951] (-1302.867) -- 0:00:32
584500 -- (-1302.189) (-1303.362) [-1301.362] (-1300.466) * (-1307.015) (-1301.147) (-1300.193) [-1301.602] -- 0:00:31
585000 -- (-1301.522) (-1301.915) (-1304.426) [-1300.979] * (-1304.364) [-1299.547] (-1300.290) (-1303.531) -- 0:00:31
Average standard deviation of split frequencies: 0.010351
585500 -- (-1302.218) (-1301.708) [-1305.164] (-1303.374) * (-1305.641) (-1300.509) [-1300.970] (-1304.368) -- 0:00:31
586000 -- [-1302.687] (-1302.384) (-1303.654) (-1301.669) * (-1299.722) (-1299.543) (-1301.584) [-1299.435] -- 0:00:31
586500 -- (-1301.316) (-1301.557) (-1300.377) [-1300.815] * (-1303.666) (-1302.416) [-1301.391] (-1302.107) -- 0:00:31
587000 -- (-1301.316) [-1304.480] (-1303.119) (-1299.905) * [-1300.684] (-1301.822) (-1304.468) (-1300.949) -- 0:00:31
587500 -- [-1301.449] (-1305.902) (-1299.395) (-1301.750) * (-1300.505) [-1301.286] (-1302.063) (-1305.226) -- 0:00:31
588000 -- (-1301.870) (-1306.789) (-1299.926) [-1302.454] * [-1303.967] (-1301.889) (-1305.986) (-1309.048) -- 0:00:31
588500 -- (-1303.166) (-1303.870) [-1300.542] (-1302.454) * (-1301.088) (-1301.966) (-1299.963) [-1302.418] -- 0:00:31
589000 -- (-1301.377) (-1302.398) (-1301.337) [-1300.940] * (-1300.843) (-1302.306) [-1300.395] (-1302.725) -- 0:00:31
589500 -- (-1305.848) (-1300.545) [-1300.319] (-1305.450) * (-1300.769) (-1303.094) (-1300.570) [-1301.594] -- 0:00:31
590000 -- (-1304.144) (-1301.634) [-1300.795] (-1304.306) * [-1302.214] (-1301.375) (-1300.570) (-1300.398) -- 0:00:31
Average standard deviation of split frequencies: 0.010588
590500 -- [-1303.934] (-1299.778) (-1300.804) (-1302.605) * (-1301.328) [-1300.910] (-1300.981) (-1302.101) -- 0:00:31
591000 -- (-1304.458) [-1301.065] (-1300.764) (-1300.517) * [-1299.713] (-1300.904) (-1301.997) (-1300.881) -- 0:00:31
591500 -- [-1301.296] (-1302.177) (-1300.991) (-1300.474) * [-1300.961] (-1301.761) (-1301.421) (-1302.115) -- 0:00:31
592000 -- [-1300.213] (-1301.637) (-1306.957) (-1303.142) * [-1301.242] (-1306.024) (-1301.409) (-1300.246) -- 0:00:31
592500 -- (-1301.166) (-1303.300) (-1300.676) [-1304.044] * (-1300.008) [-1301.999] (-1301.672) (-1302.065) -- 0:00:31
593000 -- [-1299.943] (-1303.581) (-1304.994) (-1303.559) * (-1305.627) [-1303.574] (-1303.249) (-1301.939) -- 0:00:31
593500 -- (-1300.392) (-1301.444) [-1302.023] (-1303.811) * (-1303.452) (-1301.686) (-1303.892) [-1301.113] -- 0:00:31
594000 -- (-1300.395) [-1300.743] (-1302.642) (-1302.156) * (-1300.171) (-1300.859) (-1301.847) [-1300.906] -- 0:00:31
594500 -- (-1301.004) (-1301.146) [-1303.997] (-1301.461) * (-1306.633) [-1300.913] (-1303.334) (-1306.230) -- 0:00:31
595000 -- (-1302.983) [-1301.526] (-1302.686) (-1304.079) * [-1303.465] (-1301.344) (-1303.766) (-1303.803) -- 0:00:31
Average standard deviation of split frequencies: 0.010019
595500 -- (-1302.050) (-1302.490) [-1304.385] (-1302.617) * [-1306.713] (-1300.767) (-1302.031) (-1307.365) -- 0:00:31
596000 -- (-1302.162) (-1301.505) (-1301.839) [-1302.423] * (-1304.335) (-1302.400) [-1302.218] (-1303.952) -- 0:00:31
596500 -- (-1301.827) (-1301.133) [-1302.607] (-1301.730) * [-1301.469] (-1306.000) (-1302.350) (-1307.978) -- 0:00:31
597000 -- (-1302.682) (-1302.381) (-1302.430) [-1300.947] * (-1302.269) (-1300.453) (-1304.320) [-1301.565] -- 0:00:31
597500 -- (-1301.091) (-1301.973) (-1303.561) [-1300.058] * (-1304.672) [-1304.906] (-1303.026) (-1301.666) -- 0:00:30
598000 -- (-1303.414) [-1302.520] (-1302.865) (-1306.489) * (-1303.228) (-1303.750) [-1302.532] (-1301.358) -- 0:00:30
598500 -- (-1304.773) (-1304.601) [-1301.386] (-1303.474) * (-1300.630) (-1303.035) [-1300.363] (-1303.184) -- 0:00:30
599000 -- (-1300.987) (-1302.505) [-1301.044] (-1301.373) * (-1301.179) (-1301.535) (-1299.891) [-1302.649] -- 0:00:30
599500 -- (-1302.206) [-1302.265] (-1302.810) (-1299.569) * (-1299.898) (-1299.575) (-1301.672) [-1301.866] -- 0:00:30
600000 -- (-1304.531) (-1304.690) [-1299.586] (-1300.032) * (-1301.763) [-1299.723] (-1302.933) (-1301.569) -- 0:00:30
Average standard deviation of split frequencies: 0.009993
600500 -- (-1306.025) (-1305.939) [-1299.626] (-1301.254) * (-1301.848) (-1300.529) (-1300.912) [-1302.651] -- 0:00:30
601000 -- [-1300.812] (-1305.263) (-1299.742) (-1300.924) * (-1300.977) (-1301.323) [-1300.249] (-1304.012) -- 0:00:30
601500 -- [-1301.816] (-1309.033) (-1302.817) (-1302.779) * [-1303.813] (-1299.694) (-1300.068) (-1303.839) -- 0:00:30
602000 -- (-1301.321) (-1307.074) [-1300.138] (-1303.746) * (-1302.791) (-1301.771) [-1300.329] (-1304.247) -- 0:00:30
602500 -- (-1299.804) (-1304.167) (-1303.013) [-1301.520] * (-1303.413) [-1302.388] (-1302.472) (-1303.553) -- 0:00:30
603000 -- (-1299.615) (-1302.033) [-1304.417] (-1302.079) * (-1304.008) (-1305.535) [-1301.010] (-1301.958) -- 0:00:30
603500 -- (-1305.479) (-1301.457) (-1301.748) [-1302.399] * (-1302.768) (-1299.777) (-1301.018) [-1301.041] -- 0:00:30
604000 -- (-1301.861) [-1301.164] (-1302.091) (-1301.933) * [-1302.797] (-1301.545) (-1300.523) (-1301.556) -- 0:00:30
604500 -- (-1300.619) (-1300.720) (-1301.074) [-1301.972] * (-1305.137) (-1303.447) [-1301.499] (-1299.700) -- 0:00:30
605000 -- (-1302.484) (-1301.524) (-1304.478) [-1299.645] * [-1301.584] (-1301.132) (-1302.494) (-1300.920) -- 0:00:30
Average standard deviation of split frequencies: 0.009853
605500 -- (-1301.515) (-1301.654) [-1303.339] (-1299.785) * (-1304.473) [-1301.461] (-1303.497) (-1305.134) -- 0:00:30
606000 -- (-1301.149) (-1301.445) [-1303.782] (-1300.412) * (-1301.490) (-1302.210) [-1301.736] (-1304.494) -- 0:00:30
606500 -- (-1301.070) [-1301.445] (-1302.805) (-1299.660) * (-1302.392) (-1300.483) (-1299.928) [-1303.778] -- 0:00:30
607000 -- (-1301.219) [-1300.498] (-1302.084) (-1301.075) * [-1301.120] (-1303.591) (-1301.864) (-1300.064) -- 0:00:30
607500 -- (-1301.717) (-1301.684) (-1301.776) [-1301.670] * (-1301.180) [-1306.621] (-1300.545) (-1299.845) -- 0:00:30
608000 -- (-1301.226) (-1302.354) (-1305.560) [-1300.143] * (-1305.045) [-1301.517] (-1301.118) (-1300.250) -- 0:00:30
608500 -- (-1301.517) (-1305.342) (-1303.062) [-1303.907] * (-1303.697) (-1301.224) (-1302.950) [-1304.581] -- 0:00:30
609000 -- (-1300.774) (-1303.901) (-1300.934) [-1303.938] * (-1304.960) [-1303.848] (-1306.873) (-1305.611) -- 0:00:30
609500 -- (-1301.737) (-1300.467) [-1301.056] (-1302.123) * [-1305.082] (-1308.400) (-1301.986) (-1300.209) -- 0:00:30
610000 -- (-1302.457) (-1304.463) [-1301.958] (-1302.796) * (-1301.994) [-1303.269] (-1304.098) (-1301.323) -- 0:00:30
Average standard deviation of split frequencies: 0.009366
610500 -- (-1302.063) (-1300.818) [-1299.546] (-1302.111) * (-1306.610) [-1303.367] (-1303.360) (-1300.304) -- 0:00:29
611000 -- (-1304.122) (-1302.512) [-1300.348] (-1300.585) * (-1301.650) (-1302.796) (-1303.429) [-1299.932] -- 0:00:29
611500 -- (-1301.487) [-1301.540] (-1300.077) (-1301.081) * (-1305.442) (-1300.411) [-1303.466] (-1302.064) -- 0:00:29
612000 -- (-1302.278) (-1302.348) [-1303.489] (-1300.346) * (-1300.145) (-1302.946) (-1301.557) [-1302.095] -- 0:00:29
612500 -- (-1300.439) (-1300.746) [-1300.766] (-1301.946) * [-1302.009] (-1301.183) (-1301.990) (-1305.674) -- 0:00:29
613000 -- [-1299.812] (-1300.587) (-1301.512) (-1300.193) * (-1303.752) (-1303.060) [-1300.983] (-1303.637) -- 0:00:29
613500 -- (-1300.750) (-1301.485) (-1300.477) [-1300.029] * [-1300.757] (-1307.422) (-1304.341) (-1303.164) -- 0:00:29
614000 -- (-1302.130) (-1300.158) [-1300.814] (-1304.103) * (-1300.024) (-1305.544) (-1304.331) [-1301.980] -- 0:00:29
614500 -- (-1302.794) (-1301.143) [-1301.274] (-1303.332) * (-1301.708) (-1304.488) (-1302.200) [-1301.544] -- 0:00:29
615000 -- (-1302.682) [-1301.161] (-1303.724) (-1302.679) * (-1303.718) (-1302.301) [-1302.680] (-1300.936) -- 0:00:29
Average standard deviation of split frequencies: 0.009336
615500 -- (-1302.713) (-1301.923) (-1304.593) [-1301.701] * (-1302.580) (-1306.788) [-1301.480] (-1299.617) -- 0:00:29
616000 -- (-1307.055) (-1301.581) (-1303.978) [-1301.169] * (-1301.747) (-1302.042) [-1300.110] (-1300.340) -- 0:00:29
616500 -- [-1300.547] (-1302.367) (-1302.579) (-1299.955) * (-1307.565) (-1302.911) (-1299.808) [-1300.593] -- 0:00:29
617000 -- (-1300.230) [-1301.227] (-1302.579) (-1302.740) * (-1306.962) [-1301.094] (-1302.930) (-1300.578) -- 0:00:29
617500 -- [-1300.041] (-1301.898) (-1301.176) (-1300.016) * (-1306.172) [-1301.676] (-1301.324) (-1304.984) -- 0:00:29
618000 -- (-1299.942) (-1300.886) [-1302.188] (-1301.758) * (-1305.555) [-1300.600] (-1301.089) (-1300.509) -- 0:00:29
618500 -- [-1299.722] (-1301.850) (-1301.343) (-1304.067) * [-1302.439] (-1302.354) (-1301.843) (-1305.955) -- 0:00:29
619000 -- (-1299.726) (-1301.296) [-1300.311] (-1301.288) * (-1302.796) (-1301.454) (-1300.960) [-1304.167] -- 0:00:29
619500 -- (-1302.355) [-1299.510] (-1302.840) (-1302.442) * (-1301.252) (-1300.923) (-1303.459) [-1302.515] -- 0:00:29
620000 -- (-1299.844) (-1302.855) (-1302.142) [-1300.724] * (-1301.174) [-1301.872] (-1302.029) (-1301.795) -- 0:00:29
Average standard deviation of split frequencies: 0.009215
620500 -- (-1300.623) [-1300.326] (-1301.964) (-1300.922) * [-1304.359] (-1302.695) (-1306.677) (-1301.526) -- 0:00:29
621000 -- (-1304.339) [-1301.983] (-1302.092) (-1300.797) * (-1305.167) (-1302.125) (-1304.599) [-1300.202] -- 0:00:29
621500 -- (-1300.784) (-1303.407) [-1301.302] (-1301.227) * (-1303.522) [-1300.188] (-1306.791) (-1299.417) -- 0:00:29
622000 -- [-1301.516] (-1304.445) (-1299.695) (-1304.009) * (-1306.699) [-1299.864] (-1304.688) (-1300.883) -- 0:00:29
622500 -- [-1301.705] (-1303.036) (-1301.419) (-1311.051) * (-1300.958) (-1309.847) (-1309.836) [-1300.440] -- 0:00:29
623000 -- (-1300.204) (-1302.137) (-1302.670) [-1303.478] * [-1303.221] (-1299.848) (-1300.870) (-1299.819) -- 0:00:29
623500 -- (-1299.843) (-1302.662) [-1300.969] (-1302.339) * (-1304.151) [-1300.552] (-1301.392) (-1299.913) -- 0:00:28
624000 -- (-1303.148) (-1302.483) [-1301.166] (-1301.691) * (-1301.104) (-1301.049) (-1303.836) [-1301.128] -- 0:00:28
624500 -- [-1302.062] (-1300.455) (-1301.839) (-1300.748) * (-1301.059) (-1300.566) [-1308.322] (-1300.750) -- 0:00:28
625000 -- (-1302.353) [-1300.005] (-1302.496) (-1300.943) * [-1302.298] (-1301.364) (-1300.268) (-1306.100) -- 0:00:28
Average standard deviation of split frequencies: 0.008635
625500 -- [-1302.996] (-1300.084) (-1302.417) (-1304.239) * [-1301.998] (-1303.861) (-1301.880) (-1300.907) -- 0:00:28
626000 -- (-1302.376) (-1302.993) (-1302.683) [-1305.105] * [-1300.968] (-1300.580) (-1302.872) (-1302.341) -- 0:00:28
626500 -- (-1302.923) (-1305.340) (-1302.471) [-1300.959] * (-1301.649) [-1301.298] (-1302.989) (-1303.196) -- 0:00:28
627000 -- [-1300.399] (-1302.140) (-1301.107) (-1301.425) * (-1301.353) [-1299.984] (-1306.718) (-1303.007) -- 0:00:28
627500 -- [-1300.055] (-1302.302) (-1301.936) (-1301.382) * (-1303.959) (-1301.140) [-1301.229] (-1302.021) -- 0:00:28
628000 -- (-1300.588) (-1301.308) [-1300.213] (-1301.844) * (-1308.120) (-1306.410) (-1301.799) [-1300.174] -- 0:00:28
628500 -- [-1299.874] (-1304.244) (-1301.677) (-1308.106) * (-1304.440) (-1301.491) [-1300.619] (-1301.560) -- 0:00:28
629000 -- [-1300.957] (-1304.847) (-1299.846) (-1301.398) * (-1301.897) (-1302.595) (-1302.612) [-1300.982] -- 0:00:28
629500 -- (-1305.097) (-1301.596) [-1301.233] (-1300.475) * (-1301.502) (-1300.375) (-1302.005) [-1300.188] -- 0:00:28
630000 -- (-1306.194) [-1300.609] (-1302.155) (-1300.521) * (-1300.362) (-1300.812) [-1301.812] (-1302.644) -- 0:00:28
Average standard deviation of split frequencies: 0.008571
630500 -- (-1306.719) [-1302.046] (-1307.141) (-1300.496) * (-1300.788) (-1300.786) [-1300.803] (-1302.444) -- 0:00:28
631000 -- (-1306.977) (-1302.130) (-1300.608) [-1301.834] * (-1300.693) [-1301.537] (-1303.124) (-1301.281) -- 0:00:28
631500 -- [-1300.904] (-1304.223) (-1301.301) (-1299.711) * (-1300.789) (-1306.407) [-1301.518] (-1301.576) -- 0:00:28
632000 -- (-1302.065) [-1300.457] (-1301.353) (-1307.540) * [-1304.895] (-1301.935) (-1300.581) (-1301.890) -- 0:00:28
632500 -- [-1300.395] (-1300.828) (-1301.324) (-1303.066) * (-1302.049) [-1300.760] (-1300.782) (-1302.712) -- 0:00:28
633000 -- (-1300.479) (-1303.519) (-1301.018) [-1300.784] * (-1301.455) (-1300.527) (-1299.827) [-1300.700] -- 0:00:28
633500 -- [-1302.634] (-1300.802) (-1302.515) (-1301.325) * [-1299.446] (-1301.052) (-1303.552) (-1306.151) -- 0:00:28
634000 -- [-1301.981] (-1300.968) (-1306.136) (-1301.602) * (-1299.820) [-1303.824] (-1304.476) (-1303.195) -- 0:00:28
634500 -- (-1300.148) (-1302.956) (-1303.542) [-1300.666] * [-1301.321] (-1301.109) (-1306.223) (-1308.100) -- 0:00:28
635000 -- [-1303.806] (-1300.919) (-1303.184) (-1303.085) * (-1302.938) (-1301.325) (-1302.041) [-1302.461] -- 0:00:28
Average standard deviation of split frequencies: 0.008351
635500 -- (-1300.454) (-1300.451) (-1305.929) [-1299.651] * (-1303.163) (-1300.310) (-1300.746) [-1311.354] -- 0:00:28
636000 -- (-1307.360) (-1301.164) (-1300.737) [-1299.589] * (-1302.737) (-1301.348) (-1302.252) [-1304.781] -- 0:00:28
636500 -- [-1304.052] (-1302.562) (-1305.798) (-1305.840) * (-1301.997) (-1303.571) [-1301.518] (-1303.687) -- 0:00:27
637000 -- (-1304.531) [-1300.877] (-1309.324) (-1307.775) * (-1302.545) [-1300.628] (-1301.681) (-1304.236) -- 0:00:27
637500 -- [-1300.663] (-1305.651) (-1306.377) (-1303.095) * (-1301.603) (-1300.353) (-1302.964) [-1303.950] -- 0:00:27
638000 -- (-1302.953) [-1302.258] (-1302.355) (-1303.001) * (-1301.004) (-1302.181) [-1303.795] (-1303.985) -- 0:00:27
638500 -- (-1303.564) (-1307.987) (-1301.685) [-1301.053] * (-1302.184) (-1303.973) [-1304.430] (-1306.640) -- 0:00:27
639000 -- (-1301.269) (-1304.555) (-1304.872) [-1301.120] * (-1299.938) [-1306.076] (-1300.340) (-1302.636) -- 0:00:27
639500 -- (-1300.250) (-1301.125) [-1301.908] (-1300.799) * (-1299.741) (-1302.270) (-1300.512) [-1301.969] -- 0:00:27
640000 -- [-1300.708] (-1300.094) (-1301.883) (-1299.758) * (-1302.904) [-1302.437] (-1300.486) (-1300.391) -- 0:00:27
Average standard deviation of split frequencies: 0.008682
640500 -- [-1300.305] (-1300.523) (-1302.640) (-1301.875) * [-1301.717] (-1300.440) (-1301.426) (-1302.603) -- 0:00:27
641000 -- (-1301.415) [-1300.560] (-1301.825) (-1303.847) * (-1302.928) (-1305.875) (-1303.635) [-1301.314] -- 0:00:27
641500 -- (-1301.415) (-1301.324) (-1302.234) [-1303.554] * (-1303.092) (-1300.217) (-1302.884) [-1301.418] -- 0:00:27
642000 -- [-1301.166] (-1302.073) (-1301.323) (-1302.384) * (-1302.617) [-1301.360] (-1300.988) (-1301.833) -- 0:00:27
642500 -- (-1301.475) (-1301.993) (-1300.947) [-1303.210] * (-1300.814) [-1301.602] (-1300.800) (-1299.913) -- 0:00:27
643000 -- [-1304.711] (-1301.128) (-1300.860) (-1302.632) * (-1302.414) (-1300.711) [-1301.177] (-1302.601) -- 0:00:27
643500 -- (-1303.399) (-1300.290) [-1301.202] (-1303.386) * (-1302.158) (-1300.290) [-1300.704] (-1302.086) -- 0:00:27
644000 -- (-1304.674) [-1302.509] (-1301.187) (-1302.149) * [-1303.163] (-1300.592) (-1300.788) (-1302.568) -- 0:00:27
644500 -- (-1302.624) (-1303.185) [-1300.357] (-1302.376) * (-1303.990) (-1304.067) [-1302.561] (-1302.606) -- 0:00:27
645000 -- (-1306.117) (-1304.746) (-1300.281) [-1300.035] * [-1299.903] (-1310.635) (-1301.506) (-1301.318) -- 0:00:27
Average standard deviation of split frequencies: 0.008805
645500 -- (-1301.180) [-1301.123] (-1300.965) (-1302.951) * (-1305.405) [-1309.096] (-1304.805) (-1305.074) -- 0:00:27
646000 -- (-1303.898) (-1304.669) (-1300.591) [-1304.139] * (-1303.865) (-1303.144) (-1302.018) [-1303.293] -- 0:00:27
646500 -- (-1301.886) (-1305.340) (-1300.620) [-1302.860] * (-1307.617) [-1301.142] (-1303.116) (-1300.098) -- 0:00:27
647000 -- (-1302.024) [-1304.354] (-1301.051) (-1300.989) * [-1302.904] (-1300.043) (-1304.229) (-1301.447) -- 0:00:27
647500 -- (-1301.751) (-1303.961) (-1301.762) [-1301.688] * [-1304.861] (-1306.212) (-1304.541) (-1302.244) -- 0:00:27
648000 -- (-1300.736) (-1303.191) (-1304.105) [-1301.212] * (-1304.211) [-1303.621] (-1304.706) (-1302.732) -- 0:00:27
648500 -- (-1301.435) [-1303.629] (-1303.120) (-1303.184) * [-1303.241] (-1301.157) (-1302.877) (-1301.889) -- 0:00:27
649000 -- (-1303.474) (-1303.102) (-1302.459) [-1301.862] * (-1300.835) [-1300.123] (-1303.634) (-1303.615) -- 0:00:27
649500 -- (-1301.830) (-1299.612) [-1300.436] (-1302.304) * (-1302.209) [-1300.858] (-1304.829) (-1301.095) -- 0:00:26
650000 -- (-1301.807) [-1303.424] (-1302.239) (-1303.524) * (-1300.711) [-1300.054] (-1302.508) (-1301.903) -- 0:00:26
Average standard deviation of split frequencies: 0.008501
650500 -- (-1305.036) [-1300.889] (-1303.962) (-1303.642) * (-1300.600) (-1302.637) [-1300.798] (-1302.109) -- 0:00:26
651000 -- (-1301.749) [-1302.971] (-1301.206) (-1302.281) * (-1302.459) (-1301.840) [-1301.128] (-1303.990) -- 0:00:26
651500 -- (-1300.280) [-1302.392] (-1300.375) (-1303.094) * (-1303.214) [-1300.545] (-1300.273) (-1299.954) -- 0:00:26
652000 -- (-1300.265) (-1301.635) [-1300.527] (-1302.630) * [-1300.644] (-1303.134) (-1300.828) (-1302.446) -- 0:00:26
652500 -- (-1300.713) (-1301.881) (-1302.316) [-1301.266] * (-1302.893) [-1303.403] (-1301.032) (-1304.935) -- 0:00:26
653000 -- [-1303.243] (-1302.646) (-1303.618) (-1301.473) * (-1301.496) (-1302.774) [-1307.705] (-1301.554) -- 0:00:26
653500 -- (-1302.338) [-1301.120] (-1303.563) (-1302.961) * [-1302.325] (-1299.971) (-1301.739) (-1300.487) -- 0:00:26
654000 -- (-1302.046) [-1301.140] (-1304.024) (-1303.475) * (-1304.375) (-1304.795) [-1302.085] (-1300.996) -- 0:00:26
654500 -- (-1300.952) (-1300.309) [-1303.467] (-1300.374) * (-1300.673) (-1299.710) (-1301.474) [-1303.487] -- 0:00:26
655000 -- [-1300.983] (-1300.305) (-1300.925) (-1300.540) * (-1300.189) [-1299.573] (-1301.193) (-1301.117) -- 0:00:26
Average standard deviation of split frequencies: 0.008264
655500 -- (-1301.648) (-1304.677) (-1301.194) [-1304.330] * [-1301.020] (-1300.763) (-1300.419) (-1304.133) -- 0:00:26
656000 -- (-1302.598) (-1302.375) [-1300.077] (-1303.004) * (-1304.920) (-1301.884) (-1301.930) [-1302.072] -- 0:00:26
656500 -- (-1302.913) (-1300.516) (-1299.668) [-1301.166] * (-1300.088) (-1302.411) (-1302.922) [-1301.457] -- 0:00:26
657000 -- [-1300.382] (-1300.477) (-1300.728) (-1301.106) * (-1300.083) (-1304.120) [-1300.142] (-1301.815) -- 0:00:26
657500 -- (-1300.387) (-1303.207) (-1301.752) [-1301.389] * (-1300.777) [-1301.524] (-1303.947) (-1301.755) -- 0:00:26
658000 -- [-1301.516] (-1303.345) (-1303.222) (-1300.477) * [-1300.157] (-1303.865) (-1301.736) (-1309.652) -- 0:00:26
658500 -- (-1300.768) (-1302.900) (-1307.567) [-1300.011] * (-1302.276) (-1302.951) [-1303.870] (-1301.570) -- 0:00:26
659000 -- (-1300.610) (-1303.232) (-1300.212) [-1301.499] * [-1302.177] (-1304.099) (-1303.998) (-1300.921) -- 0:00:26
659500 -- (-1303.746) (-1303.905) (-1304.367) [-1303.667] * (-1302.078) [-1300.291] (-1303.592) (-1302.050) -- 0:00:26
660000 -- (-1301.471) (-1304.303) (-1300.702) [-1301.888] * (-1301.476) (-1300.452) [-1301.735] (-1301.889) -- 0:00:26
Average standard deviation of split frequencies: 0.007983
660500 -- [-1309.369] (-1302.391) (-1300.249) (-1303.901) * [-1300.958] (-1300.348) (-1301.533) (-1301.832) -- 0:00:26
661000 -- (-1306.859) (-1300.024) (-1299.934) [-1301.557] * (-1301.673) (-1300.400) (-1304.223) [-1301.619] -- 0:00:26
661500 -- [-1302.540] (-1300.139) (-1300.447) (-1302.460) * [-1302.783] (-1301.187) (-1305.473) (-1303.152) -- 0:00:26
662000 -- (-1300.956) (-1301.473) (-1300.662) [-1300.838] * (-1300.782) [-1303.875] (-1301.693) (-1309.216) -- 0:00:26
662500 -- (-1300.919) (-1299.633) [-1300.631] (-1300.789) * (-1300.675) [-1304.060] (-1299.856) (-1303.880) -- 0:00:25
663000 -- (-1307.026) (-1301.239) [-1302.473] (-1300.984) * [-1300.767] (-1300.686) (-1303.269) (-1302.254) -- 0:00:25
663500 -- (-1305.149) [-1301.675] (-1303.904) (-1301.432) * (-1301.045) (-1305.818) (-1301.734) [-1301.477] -- 0:00:25
664000 -- (-1300.884) (-1300.954) [-1301.358] (-1301.129) * (-1300.739) (-1303.329) (-1300.591) [-1302.045] -- 0:00:25
664500 -- (-1304.540) [-1301.018] (-1306.505) (-1301.642) * (-1302.838) (-1302.287) [-1300.182] (-1304.711) -- 0:00:25
665000 -- (-1307.594) (-1301.028) [-1302.026] (-1302.627) * (-1302.595) (-1302.526) (-1300.421) [-1301.345] -- 0:00:25
Average standard deviation of split frequencies: 0.007697
665500 -- (-1300.244) (-1310.332) (-1302.723) [-1301.104] * [-1301.338] (-1301.744) (-1302.973) (-1303.241) -- 0:00:25
666000 -- (-1300.366) (-1303.282) [-1301.985] (-1302.349) * [-1300.867] (-1303.438) (-1309.222) (-1302.036) -- 0:00:25
666500 -- (-1305.502) (-1303.059) [-1301.661] (-1300.617) * (-1301.917) [-1301.204] (-1302.675) (-1299.888) -- 0:00:25
667000 -- [-1302.433] (-1303.582) (-1303.687) (-1299.916) * (-1304.163) (-1303.093) [-1301.957] (-1301.707) -- 0:00:25
667500 -- (-1305.932) (-1307.656) (-1307.681) [-1300.508] * (-1305.365) [-1300.835] (-1302.155) (-1301.160) -- 0:00:25
668000 -- (-1300.833) (-1304.281) (-1308.365) [-1302.608] * (-1304.761) [-1303.132] (-1310.595) (-1301.380) -- 0:00:25
668500 -- (-1300.374) (-1301.998) (-1302.318) [-1300.611] * (-1301.118) [-1300.923] (-1301.632) (-1302.785) -- 0:00:25
669000 -- (-1302.760) (-1300.347) (-1302.991) [-1301.056] * (-1300.939) [-1302.908] (-1303.048) (-1299.853) -- 0:00:25
669500 -- [-1303.072] (-1302.984) (-1301.864) (-1303.202) * [-1302.633] (-1304.653) (-1300.339) (-1301.757) -- 0:00:25
670000 -- (-1303.178) [-1302.427] (-1301.479) (-1300.616) * (-1302.358) [-1302.322] (-1302.061) (-1302.092) -- 0:00:25
Average standard deviation of split frequencies: 0.007544
670500 -- (-1301.988) (-1306.623) [-1300.925] (-1301.450) * (-1302.024) [-1300.948] (-1306.190) (-1301.909) -- 0:00:25
671000 -- (-1302.144) (-1306.289) (-1301.750) [-1300.845] * [-1301.584] (-1304.639) (-1302.473) (-1305.512) -- 0:00:25
671500 -- (-1302.069) (-1300.161) (-1302.789) [-1302.273] * (-1301.722) (-1304.431) (-1299.745) [-1301.663] -- 0:00:25
672000 -- (-1302.694) [-1300.716] (-1300.529) (-1304.386) * (-1303.703) (-1304.715) [-1299.443] (-1302.750) -- 0:00:25
672500 -- (-1301.762) [-1302.771] (-1301.391) (-1302.338) * (-1308.473) [-1301.359] (-1302.050) (-1300.021) -- 0:00:25
673000 -- [-1300.607] (-1305.238) (-1301.173) (-1302.116) * (-1305.630) (-1301.677) [-1303.045] (-1300.096) -- 0:00:25
673500 -- (-1300.115) [-1305.648] (-1300.703) (-1303.316) * (-1318.919) (-1301.122) (-1303.819) [-1300.338] -- 0:00:25
674000 -- (-1305.450) (-1300.858) [-1301.093] (-1300.562) * (-1299.659) (-1301.433) (-1304.389) [-1300.133] -- 0:00:25
674500 -- [-1301.515] (-1304.947) (-1300.914) (-1304.563) * (-1300.645) (-1301.344) (-1306.202) [-1301.464] -- 0:00:25
675000 -- (-1301.480) (-1300.262) [-1300.810] (-1299.737) * (-1304.365) (-1300.779) (-1301.015) [-1303.292] -- 0:00:25
Average standard deviation of split frequencies: 0.006695
675500 -- (-1302.942) [-1300.873] (-1300.954) (-1302.151) * (-1300.798) (-1301.216) (-1302.407) [-1302.528] -- 0:00:24
676000 -- (-1303.117) (-1300.349) (-1304.299) [-1301.707] * [-1299.929] (-1304.119) (-1303.395) (-1303.628) -- 0:00:24
676500 -- (-1304.416) [-1303.203] (-1301.749) (-1304.124) * (-1302.048) (-1301.808) [-1303.594] (-1304.493) -- 0:00:24
677000 -- (-1300.931) (-1300.138) (-1300.128) [-1300.927] * (-1304.694) [-1300.457] (-1304.497) (-1299.798) -- 0:00:24
677500 -- (-1300.014) (-1301.824) [-1300.994] (-1302.154) * (-1303.608) (-1301.808) [-1301.483] (-1303.696) -- 0:00:24
678000 -- (-1300.810) (-1300.002) [-1304.374] (-1301.511) * (-1300.725) (-1303.129) (-1302.466) [-1301.088] -- 0:00:24
678500 -- [-1301.153] (-1300.485) (-1301.861) (-1305.923) * (-1302.193) (-1307.250) (-1304.878) [-1300.651] -- 0:00:24
679000 -- (-1303.027) (-1303.123) [-1303.338] (-1304.829) * (-1306.591) (-1301.613) [-1303.106] (-1301.755) -- 0:00:24
679500 -- (-1306.104) (-1303.996) (-1303.852) [-1301.093] * (-1301.583) [-1300.774] (-1300.768) (-1301.745) -- 0:00:24
680000 -- (-1299.897) (-1300.313) (-1301.097) [-1301.045] * (-1309.040) (-1300.823) [-1300.920] (-1303.294) -- 0:00:24
Average standard deviation of split frequencies: 0.005818
680500 -- (-1300.662) (-1301.275) (-1302.465) [-1299.969] * [-1300.625] (-1299.916) (-1304.506) (-1311.650) -- 0:00:24
681000 -- (-1300.410) (-1300.846) (-1301.376) [-1299.641] * (-1301.181) (-1300.010) (-1303.128) [-1300.416] -- 0:00:24
681500 -- [-1300.342] (-1300.314) (-1301.758) (-1300.413) * [-1300.818] (-1300.348) (-1302.026) (-1301.649) -- 0:00:24
682000 -- (-1302.017) (-1304.911) (-1301.148) [-1301.345] * [-1300.611] (-1302.574) (-1305.435) (-1300.730) -- 0:00:24
682500 -- (-1300.841) (-1303.815) [-1301.284] (-1305.306) * (-1299.676) (-1303.199) (-1301.511) [-1301.202] -- 0:00:24
683000 -- (-1301.119) (-1303.837) [-1302.674] (-1303.506) * (-1299.686) (-1305.389) (-1300.412) [-1300.920] -- 0:00:24
683500 -- (-1301.958) (-1300.459) (-1300.774) [-1301.263] * [-1301.031] (-1301.556) (-1301.306) (-1301.757) -- 0:00:24
684000 -- (-1301.153) (-1301.957) [-1300.099] (-1306.958) * (-1300.958) [-1301.071] (-1300.964) (-1305.696) -- 0:00:24
684500 -- (-1301.303) (-1302.132) [-1300.112] (-1303.313) * (-1300.757) (-1301.937) (-1305.038) [-1300.759] -- 0:00:24
685000 -- (-1302.159) (-1303.121) (-1299.930) [-1303.970] * (-1300.110) [-1301.014] (-1311.176) (-1302.529) -- 0:00:24
Average standard deviation of split frequencies: 0.005543
685500 -- [-1301.139] (-1300.598) (-1302.311) (-1302.193) * (-1302.062) (-1307.698) [-1302.079] (-1302.050) -- 0:00:24
686000 -- (-1300.368) [-1300.869] (-1305.140) (-1301.552) * [-1304.419] (-1302.144) (-1303.942) (-1300.844) -- 0:00:24
686500 -- (-1300.471) [-1301.752] (-1301.611) (-1302.443) * (-1302.732) (-1305.637) [-1305.035] (-1300.880) -- 0:00:24
687000 -- (-1301.447) [-1300.540] (-1301.242) (-1305.253) * (-1303.751) [-1303.278] (-1305.578) (-1300.855) -- 0:00:24
687500 -- (-1300.617) (-1302.939) (-1301.130) [-1302.457] * (-1301.019) (-1306.504) (-1305.098) [-1301.765] -- 0:00:24
688000 -- (-1301.605) [-1302.791] (-1302.777) (-1307.386) * (-1301.009) (-1304.709) (-1303.767) [-1302.368] -- 0:00:24
688500 -- (-1300.488) [-1301.692] (-1306.539) (-1304.179) * (-1300.487) [-1301.134] (-1303.558) (-1300.479) -- 0:00:23
689000 -- [-1300.912] (-1300.533) (-1301.864) (-1304.707) * (-1299.704) [-1302.230] (-1300.665) (-1304.300) -- 0:00:23
689500 -- [-1300.808] (-1300.615) (-1303.014) (-1302.539) * (-1304.236) (-1302.700) (-1300.020) [-1302.351] -- 0:00:23
690000 -- (-1305.322) (-1301.423) (-1304.920) [-1301.007] * (-1303.376) [-1300.369] (-1300.919) (-1299.892) -- 0:00:23
Average standard deviation of split frequencies: 0.005415
690500 -- [-1302.273] (-1302.844) (-1305.039) (-1302.237) * [-1302.076] (-1300.381) (-1300.800) (-1303.652) -- 0:00:23
691000 -- (-1302.181) (-1301.662) [-1303.233] (-1300.249) * (-1302.663) (-1300.885) [-1300.505] (-1300.223) -- 0:00:23
691500 -- (-1302.087) (-1300.451) [-1304.029] (-1301.185) * (-1302.835) (-1303.381) [-1300.019] (-1303.916) -- 0:00:23
692000 -- (-1301.895) (-1301.703) (-1305.399) [-1302.240] * [-1303.171] (-1302.319) (-1303.279) (-1302.330) -- 0:00:23
692500 -- (-1302.479) (-1300.891) [-1301.254] (-1302.669) * (-1303.655) [-1301.074] (-1302.140) (-1302.867) -- 0:00:23
693000 -- (-1300.972) (-1301.516) [-1302.826] (-1301.403) * (-1301.805) (-1301.422) [-1301.410] (-1302.686) -- 0:00:23
693500 -- [-1301.441] (-1300.963) (-1307.560) (-1302.954) * (-1306.785) (-1302.310) (-1302.468) [-1302.821] -- 0:00:23
694000 -- (-1304.636) [-1301.844] (-1302.607) (-1302.392) * (-1303.948) (-1300.970) (-1302.519) [-1301.368] -- 0:00:23
694500 -- (-1306.918) (-1301.906) (-1301.721) [-1302.495] * (-1300.694) [-1300.140] (-1301.901) (-1302.166) -- 0:00:23
695000 -- (-1299.721) (-1302.230) [-1301.925] (-1300.294) * (-1301.343) (-1300.232) [-1299.729] (-1306.987) -- 0:00:23
Average standard deviation of split frequencies: 0.005644
695500 -- [-1300.287] (-1305.057) (-1300.991) (-1300.279) * (-1304.278) (-1299.832) [-1300.939] (-1301.769) -- 0:00:23
696000 -- (-1300.773) (-1304.070) (-1302.207) [-1301.081] * (-1304.182) (-1300.852) [-1304.008] (-1301.478) -- 0:00:23
696500 -- (-1300.182) (-1305.146) [-1301.379] (-1302.234) * (-1301.693) (-1303.550) [-1303.854] (-1303.782) -- 0:00:23
697000 -- (-1300.122) [-1304.619] (-1300.990) (-1300.966) * (-1303.972) (-1301.908) (-1300.118) [-1303.422] -- 0:00:23
697500 -- [-1301.647] (-1302.143) (-1302.770) (-1301.723) * (-1300.896) (-1301.634) [-1302.006] (-1303.499) -- 0:00:22
698000 -- (-1301.248) (-1301.664) (-1301.268) [-1300.152] * (-1299.417) (-1301.671) (-1302.985) [-1305.667] -- 0:00:23
698500 -- [-1299.663] (-1304.930) (-1305.421) (-1300.244) * (-1304.645) (-1300.340) (-1301.564) [-1301.383] -- 0:00:23
699000 -- (-1303.143) [-1299.622] (-1304.158) (-1303.946) * [-1303.781] (-1301.820) (-1302.237) (-1300.618) -- 0:00:23
699500 -- [-1300.128] (-1300.900) (-1300.455) (-1299.680) * (-1300.954) (-1301.918) [-1302.926] (-1300.639) -- 0:00:23
700000 -- (-1303.455) (-1302.894) (-1300.857) [-1301.488] * (-1300.641) (-1302.373) (-1302.698) [-1301.534] -- 0:00:23
Average standard deviation of split frequencies: 0.005427
700500 -- [-1303.569] (-1300.981) (-1304.914) (-1299.768) * (-1303.390) [-1302.398] (-1300.796) (-1301.977) -- 0:00:23
701000 -- [-1301.658] (-1304.529) (-1302.656) (-1300.210) * [-1301.892] (-1300.437) (-1301.966) (-1302.107) -- 0:00:23
701500 -- [-1301.074] (-1302.935) (-1304.121) (-1303.652) * (-1301.607) (-1301.872) (-1301.646) [-1306.456] -- 0:00:22
702000 -- (-1305.167) (-1301.171) [-1302.326] (-1303.544) * (-1302.050) [-1303.972] (-1308.896) (-1300.995) -- 0:00:22
702500 -- (-1302.712) (-1300.951) [-1301.552] (-1303.160) * (-1301.340) [-1300.317] (-1307.934) (-1300.467) -- 0:00:22
703000 -- (-1299.989) [-1302.097] (-1302.401) (-1301.383) * (-1301.250) (-1300.443) [-1303.796] (-1302.035) -- 0:00:22
703500 -- (-1304.361) (-1304.930) (-1302.011) [-1300.678] * (-1301.474) [-1301.246] (-1301.133) (-1300.725) -- 0:00:22
704000 -- (-1305.719) (-1307.200) [-1300.633] (-1302.189) * (-1302.851) (-1303.765) (-1302.122) [-1301.450] -- 0:00:22
704500 -- (-1307.839) [-1300.588] (-1302.096) (-1305.055) * (-1300.873) (-1308.627) (-1301.315) [-1302.253] -- 0:00:22
705000 -- (-1303.804) (-1299.441) (-1303.713) [-1309.030] * [-1301.560] (-1302.165) (-1301.183) (-1302.918) -- 0:00:22
Average standard deviation of split frequencies: 0.005297
705500 -- [-1301.023] (-1301.303) (-1301.704) (-1301.272) * [-1301.480] (-1300.509) (-1302.915) (-1301.179) -- 0:00:22
706000 -- [-1301.584] (-1303.784) (-1302.974) (-1304.813) * (-1305.037) (-1302.141) [-1300.802] (-1303.440) -- 0:00:22
706500 -- (-1300.521) [-1304.159] (-1303.966) (-1303.167) * [-1302.154] (-1302.774) (-1302.902) (-1299.712) -- 0:00:22
707000 -- [-1301.906] (-1301.554) (-1302.609) (-1302.421) * [-1300.026] (-1302.226) (-1303.172) (-1302.779) -- 0:00:22
707500 -- (-1301.260) (-1301.485) [-1302.782] (-1301.262) * (-1300.355) (-1306.061) [-1300.855] (-1302.255) -- 0:00:22
708000 -- (-1301.389) (-1303.031) [-1300.310] (-1302.324) * (-1301.574) [-1300.601] (-1301.544) (-1301.273) -- 0:00:22
708500 -- (-1300.615) [-1300.345] (-1302.876) (-1301.328) * (-1302.249) (-1301.200) (-1301.760) [-1301.516] -- 0:00:22
709000 -- (-1303.753) (-1301.373) (-1303.562) [-1302.504] * (-1307.829) (-1300.380) (-1299.798) [-1302.375] -- 0:00:22
709500 -- (-1301.946) (-1301.076) [-1302.153] (-1300.191) * [-1302.485] (-1304.467) (-1299.406) (-1300.304) -- 0:00:22
710000 -- [-1301.889] (-1301.597) (-1301.436) (-1302.970) * [-1301.077] (-1302.526) (-1300.599) (-1301.338) -- 0:00:22
Average standard deviation of split frequencies: 0.005351
710500 -- [-1302.000] (-1299.832) (-1307.474) (-1300.863) * (-1301.643) (-1301.874) [-1300.026] (-1306.139) -- 0:00:22
711000 -- (-1304.444) (-1300.438) [-1303.331] (-1301.971) * (-1300.279) [-1301.979] (-1300.322) (-1306.879) -- 0:00:21
711500 -- (-1303.588) [-1300.293] (-1303.826) (-1302.053) * (-1300.452) (-1308.886) [-1306.578] (-1303.103) -- 0:00:22
712000 -- (-1306.308) (-1301.377) [-1301.345] (-1301.503) * (-1303.357) (-1302.302) [-1301.124] (-1300.584) -- 0:00:22
712500 -- (-1310.444) [-1301.091] (-1300.525) (-1299.560) * [-1301.460] (-1299.943) (-1299.987) (-1302.959) -- 0:00:22
713000 -- (-1300.551) (-1302.297) (-1304.246) [-1300.393] * (-1300.354) (-1300.832) [-1300.781] (-1302.879) -- 0:00:22
713500 -- [-1301.428] (-1300.454) (-1302.320) (-1303.160) * (-1301.598) [-1304.315] (-1302.926) (-1302.819) -- 0:00:22
714000 -- [-1299.890] (-1302.299) (-1302.322) (-1302.210) * (-1302.247) [-1304.061] (-1307.233) (-1304.259) -- 0:00:22
714500 -- (-1300.794) (-1301.846) [-1300.916] (-1300.738) * [-1302.284] (-1302.884) (-1304.294) (-1300.783) -- 0:00:21
715000 -- (-1303.214) [-1300.787] (-1301.806) (-1301.248) * (-1299.986) [-1301.803] (-1303.367) (-1304.714) -- 0:00:21
Average standard deviation of split frequencies: 0.005530
715500 -- (-1302.607) [-1300.546] (-1303.278) (-1300.335) * (-1300.787) [-1302.533] (-1301.621) (-1302.310) -- 0:00:21
716000 -- (-1302.495) (-1302.250) (-1301.411) [-1300.117] * (-1305.494) (-1303.461) [-1300.133] (-1300.746) -- 0:00:21
716500 -- (-1302.122) (-1300.780) [-1303.015] (-1301.782) * [-1304.886] (-1305.128) (-1301.981) (-1301.966) -- 0:00:21
717000 -- (-1299.952) (-1303.129) (-1303.439) [-1300.482] * [-1302.444] (-1301.360) (-1304.612) (-1302.924) -- 0:00:21
717500 -- (-1300.232) (-1303.573) (-1305.332) [-1301.052] * (-1307.317) [-1300.711] (-1303.488) (-1301.093) -- 0:00:21
718000 -- (-1300.128) (-1301.727) (-1306.437) [-1300.699] * (-1303.242) (-1299.936) (-1304.326) [-1299.841] -- 0:00:21
718500 -- [-1300.636] (-1300.987) (-1306.759) (-1301.921) * (-1304.425) (-1299.472) (-1305.534) [-1299.930] -- 0:00:21
719000 -- (-1304.361) [-1302.025] (-1300.842) (-1304.453) * [-1300.299] (-1301.813) (-1304.276) (-1299.910) -- 0:00:21
719500 -- (-1303.626) (-1300.170) (-1300.435) [-1304.120] * (-1300.283) (-1300.263) (-1301.584) [-1302.694] -- 0:00:21
720000 -- (-1304.934) (-1300.782) [-1301.794] (-1303.612) * (-1301.272) [-1300.039] (-1301.346) (-1301.814) -- 0:00:21
Average standard deviation of split frequencies: 0.005800
720500 -- (-1301.292) [-1302.854] (-1302.498) (-1304.978) * (-1300.927) (-1307.030) (-1301.236) [-1300.265] -- 0:00:21
721000 -- (-1300.828) [-1300.743] (-1301.670) (-1302.964) * (-1301.829) (-1307.124) [-1302.283] (-1302.499) -- 0:00:21
721500 -- (-1300.684) (-1301.734) (-1302.752) [-1303.652] * [-1302.155] (-1302.814) (-1299.858) (-1302.048) -- 0:00:21
722000 -- [-1305.718] (-1303.412) (-1300.298) (-1302.201) * [-1300.233] (-1302.297) (-1302.724) (-1300.781) -- 0:00:21
722500 -- (-1306.500) (-1301.117) [-1303.193] (-1302.887) * (-1306.343) (-1303.969) [-1300.554] (-1300.148) -- 0:00:21
723000 -- (-1300.503) (-1304.484) [-1303.050] (-1302.853) * (-1302.878) (-1301.103) [-1302.936] (-1305.778) -- 0:00:21
723500 -- [-1300.836] (-1305.635) (-1301.589) (-1303.137) * [-1303.966] (-1300.945) (-1301.432) (-1300.491) -- 0:00:21
724000 -- [-1300.536] (-1300.778) (-1300.155) (-1304.466) * (-1303.702) (-1301.586) [-1300.463] (-1300.213) -- 0:00:20
724500 -- [-1300.550] (-1303.616) (-1300.491) (-1305.402) * (-1306.264) (-1301.002) [-1300.021] (-1300.268) -- 0:00:20
725000 -- (-1302.121) (-1302.084) [-1302.870] (-1303.147) * (-1302.487) (-1300.891) (-1301.501) [-1301.345] -- 0:00:21
Average standard deviation of split frequencies: 0.006363
725500 -- (-1304.428) (-1300.499) [-1300.464] (-1304.299) * [-1300.685] (-1301.618) (-1301.245) (-1301.508) -- 0:00:21
726000 -- (-1301.620) [-1303.131] (-1301.945) (-1304.028) * (-1302.430) [-1300.207] (-1300.154) (-1305.900) -- 0:00:21
726500 -- (-1305.922) (-1301.389) (-1302.341) [-1304.466] * (-1301.714) (-1302.764) [-1304.183] (-1303.403) -- 0:00:21
727000 -- (-1300.551) (-1307.639) [-1300.334] (-1304.945) * (-1301.870) (-1305.351) [-1301.468] (-1301.719) -- 0:00:21
727500 -- [-1299.852] (-1302.056) (-1302.378) (-1303.128) * (-1301.184) (-1307.607) [-1303.456] (-1300.192) -- 0:00:20
728000 -- [-1300.477] (-1301.897) (-1301.566) (-1302.356) * (-1302.540) (-1300.826) (-1304.419) [-1303.528] -- 0:00:20
728500 -- [-1302.278] (-1301.919) (-1300.204) (-1303.001) * [-1300.640] (-1301.443) (-1302.590) (-1303.642) -- 0:00:20
729000 -- (-1301.964) (-1303.704) [-1301.143] (-1303.445) * (-1300.585) (-1301.982) [-1303.940] (-1303.911) -- 0:00:20
729500 -- (-1302.740) (-1300.675) (-1301.629) [-1301.304] * [-1302.892] (-1301.332) (-1300.813) (-1306.252) -- 0:00:20
730000 -- (-1302.395) (-1306.025) (-1303.292) [-1300.315] * (-1302.033) [-1302.122] (-1301.085) (-1303.721) -- 0:00:20
Average standard deviation of split frequencies: 0.006108
730500 -- (-1302.401) (-1301.217) (-1302.328) [-1303.167] * (-1300.930) (-1300.857) [-1301.231] (-1304.939) -- 0:00:20
731000 -- [-1301.585] (-1302.092) (-1301.513) (-1300.615) * (-1300.293) (-1300.418) [-1300.189] (-1303.356) -- 0:00:20
731500 -- (-1301.619) [-1300.330] (-1302.116) (-1299.992) * [-1302.482] (-1301.931) (-1300.565) (-1302.709) -- 0:00:20
732000 -- (-1300.726) (-1302.029) [-1300.676] (-1302.706) * (-1304.668) [-1302.816] (-1305.131) (-1303.984) -- 0:00:20
732500 -- [-1300.283] (-1301.131) (-1304.963) (-1301.230) * (-1300.060) (-1303.095) [-1304.691] (-1301.033) -- 0:00:20
733000 -- [-1302.379] (-1301.124) (-1303.887) (-1300.922) * (-1302.271) (-1300.486) (-1300.510) [-1301.515] -- 0:00:20
733500 -- (-1307.186) [-1300.635] (-1310.670) (-1303.689) * (-1300.979) [-1301.067] (-1300.534) (-1300.220) -- 0:00:20
734000 -- (-1308.189) [-1300.953] (-1305.811) (-1302.396) * (-1302.212) [-1302.753] (-1305.086) (-1300.668) -- 0:00:20
734500 -- [-1299.875] (-1303.134) (-1299.945) (-1303.352) * (-1304.743) (-1302.159) [-1300.567] (-1301.532) -- 0:00:20
735000 -- (-1299.947) [-1300.829] (-1300.439) (-1302.154) * (-1302.557) [-1301.765] (-1300.587) (-1303.194) -- 0:00:20
Average standard deviation of split frequencies: 0.006704
735500 -- [-1300.381] (-1301.408) (-1299.821) (-1301.276) * [-1300.310] (-1308.332) (-1300.167) (-1300.846) -- 0:00:20
736000 -- (-1300.030) (-1299.872) (-1301.370) [-1301.536] * (-1300.344) [-1300.779] (-1302.135) (-1304.605) -- 0:00:20
736500 -- (-1302.107) [-1299.825] (-1301.257) (-1302.336) * (-1303.205) (-1301.612) [-1304.566] (-1303.772) -- 0:00:20
737000 -- (-1302.655) [-1300.438] (-1305.876) (-1300.866) * (-1301.961) [-1304.494] (-1300.827) (-1303.739) -- 0:00:19
737500 -- [-1300.585] (-1302.087) (-1302.069) (-1301.508) * (-1300.305) [-1300.131] (-1304.299) (-1304.048) -- 0:00:19
738000 -- (-1300.073) (-1301.075) [-1299.747] (-1300.215) * (-1303.921) (-1300.925) (-1304.492) [-1303.228] -- 0:00:19
738500 -- [-1300.803] (-1301.390) (-1302.223) (-1301.848) * (-1300.827) (-1302.178) [-1300.477] (-1300.561) -- 0:00:20
739000 -- (-1301.727) (-1302.858) [-1300.142] (-1301.704) * [-1301.422] (-1300.851) (-1300.392) (-1302.960) -- 0:00:20
739500 -- (-1306.736) (-1301.587) [-1300.546] (-1303.560) * [-1302.663] (-1302.608) (-1301.268) (-1305.164) -- 0:00:20
740000 -- [-1303.524] (-1303.797) (-1301.047) (-1303.520) * [-1301.546] (-1302.605) (-1302.095) (-1301.133) -- 0:00:20
Average standard deviation of split frequencies: 0.007043
740500 -- [-1300.117] (-1302.181) (-1302.698) (-1303.422) * (-1305.931) (-1304.047) [-1301.580] (-1302.927) -- 0:00:19
741000 -- (-1301.986) [-1304.611] (-1304.692) (-1302.532) * (-1301.622) (-1300.810) (-1302.386) [-1302.807] -- 0:00:19
741500 -- (-1304.793) (-1302.204) (-1304.716) [-1300.214] * (-1301.455) (-1302.020) [-1304.895] (-1300.190) -- 0:00:19
742000 -- [-1304.775] (-1300.143) (-1299.751) (-1301.591) * (-1300.046) (-1300.904) (-1302.767) [-1301.611] -- 0:00:19
742500 -- (-1306.588) (-1304.686) [-1300.782] (-1303.969) * [-1301.594] (-1301.844) (-1301.113) (-1304.808) -- 0:00:19
743000 -- (-1303.825) (-1300.195) [-1302.592] (-1299.876) * (-1300.999) [-1300.253] (-1304.895) (-1301.779) -- 0:00:19
743500 -- (-1302.989) [-1300.247] (-1303.556) (-1300.698) * (-1302.975) [-1300.187] (-1300.363) (-1301.516) -- 0:00:19
744000 -- (-1306.662) [-1300.341] (-1300.234) (-1302.571) * (-1304.990) (-1302.450) (-1302.310) [-1303.538] -- 0:00:19
744500 -- (-1301.114) (-1302.454) [-1300.257] (-1304.740) * (-1300.294) [-1303.130] (-1300.607) (-1302.163) -- 0:00:19
745000 -- (-1304.284) [-1302.405] (-1301.971) (-1302.589) * (-1299.449) [-1302.624] (-1302.179) (-1302.491) -- 0:00:19
Average standard deviation of split frequencies: 0.006825
745500 -- (-1301.381) (-1302.313) [-1300.948] (-1304.985) * [-1304.308] (-1300.119) (-1300.706) (-1302.154) -- 0:00:19
746000 -- (-1305.028) [-1300.236] (-1302.028) (-1302.795) * (-1303.570) [-1299.636] (-1306.110) (-1301.715) -- 0:00:19
746500 -- (-1304.106) [-1302.326] (-1302.887) (-1302.565) * (-1302.112) (-1299.617) [-1303.401] (-1301.956) -- 0:00:19
747000 -- [-1305.319] (-1301.198) (-1302.302) (-1302.721) * (-1300.760) (-1301.452) (-1303.174) [-1302.226] -- 0:00:19
747500 -- (-1303.170) (-1304.504) (-1303.879) [-1303.787] * (-1300.318) [-1301.037] (-1301.618) (-1305.788) -- 0:00:19
748000 -- (-1305.426) (-1300.481) (-1304.035) [-1301.511] * (-1302.583) (-1300.055) [-1299.488] (-1302.816) -- 0:00:19
748500 -- (-1305.967) (-1300.104) (-1302.014) [-1301.889] * [-1302.973] (-1303.417) (-1301.361) (-1302.111) -- 0:00:19
749000 -- (-1302.413) (-1300.540) (-1304.357) [-1300.561] * [-1303.998] (-1302.922) (-1302.235) (-1300.532) -- 0:00:19
749500 -- (-1302.248) (-1300.117) [-1301.364] (-1300.531) * (-1299.892) (-1301.989) (-1304.210) [-1300.586] -- 0:00:19
750000 -- [-1302.774] (-1300.352) (-1303.410) (-1303.574) * (-1299.869) (-1300.618) [-1301.289] (-1303.247) -- 0:00:19
Average standard deviation of split frequencies: 0.006782
750500 -- [-1301.765] (-1302.887) (-1302.325) (-1305.750) * (-1303.463) (-1307.157) [-1299.692] (-1301.764) -- 0:00:18
751000 -- (-1303.196) (-1304.174) (-1300.383) [-1303.689] * [-1300.507] (-1304.913) (-1299.792) (-1304.005) -- 0:00:18
751500 -- (-1301.930) (-1303.098) (-1301.460) [-1305.836] * (-1301.916) (-1302.216) [-1302.416] (-1301.567) -- 0:00:18
752000 -- (-1299.956) [-1300.807] (-1299.979) (-1306.365) * (-1300.174) (-1300.416) [-1300.797] (-1301.512) -- 0:00:19
752500 -- (-1302.492) (-1302.008) (-1300.433) [-1300.664] * (-1301.254) (-1300.312) (-1302.811) [-1302.456] -- 0:00:19
753000 -- (-1299.790) [-1301.671] (-1301.722) (-1302.715) * (-1300.114) [-1305.525] (-1301.044) (-1303.421) -- 0:00:19
753500 -- (-1301.327) [-1302.468] (-1304.858) (-1302.667) * (-1300.242) (-1305.069) (-1300.294) [-1300.526] -- 0:00:18
754000 -- (-1301.008) (-1302.321) (-1300.913) [-1302.399] * (-1302.499) [-1301.405] (-1300.602) (-1300.611) -- 0:00:18
754500 -- (-1301.094) [-1301.091] (-1300.990) (-1301.920) * (-1303.364) (-1304.167) (-1299.928) [-1304.585] -- 0:00:18
755000 -- (-1301.308) (-1303.212) [-1303.472] (-1302.108) * [-1300.673] (-1302.730) (-1301.243) (-1300.625) -- 0:00:18
Average standard deviation of split frequencies: 0.007150
755500 -- [-1301.855] (-1301.751) (-1302.335) (-1301.300) * (-1300.575) (-1299.923) [-1301.599] (-1300.473) -- 0:00:18
756000 -- (-1301.347) (-1300.869) (-1305.838) [-1299.573] * (-1300.589) (-1299.946) (-1300.547) [-1301.256] -- 0:00:18
756500 -- (-1300.121) (-1300.424) (-1300.981) [-1299.994] * (-1302.003) [-1303.205] (-1300.309) (-1304.124) -- 0:00:18
757000 -- (-1300.344) (-1301.902) (-1301.355) [-1300.450] * [-1303.069] (-1304.718) (-1303.050) (-1303.471) -- 0:00:18
757500 -- (-1299.877) (-1300.996) [-1302.123] (-1301.309) * (-1302.449) (-1304.864) [-1302.315] (-1303.298) -- 0:00:18
758000 -- (-1302.510) [-1300.347] (-1300.513) (-1303.847) * (-1302.019) [-1302.202] (-1302.779) (-1300.813) -- 0:00:18
758500 -- (-1306.083) (-1304.765) [-1300.707] (-1307.230) * [-1300.886] (-1302.208) (-1301.138) (-1301.071) -- 0:00:18
759000 -- (-1300.981) (-1302.629) [-1301.836] (-1303.319) * (-1300.665) [-1303.580] (-1301.701) (-1303.102) -- 0:00:18
759500 -- (-1300.891) (-1301.014) (-1301.419) [-1305.078] * (-1301.624) (-1303.398) (-1300.367) [-1302.720] -- 0:00:18
760000 -- [-1301.281] (-1301.982) (-1304.489) (-1300.874) * (-1306.555) (-1302.710) [-1301.267] (-1303.031) -- 0:00:18
Average standard deviation of split frequencies: 0.007230
760500 -- (-1302.236) (-1303.047) [-1300.865] (-1305.014) * (-1303.947) [-1303.100] (-1304.868) (-1300.219) -- 0:00:18
761000 -- (-1300.869) [-1305.297] (-1300.180) (-1300.299) * [-1300.580] (-1302.698) (-1307.302) (-1302.423) -- 0:00:18
761500 -- [-1303.218] (-1306.322) (-1301.505) (-1302.034) * (-1302.331) (-1301.764) [-1300.758] (-1302.041) -- 0:00:18
762000 -- (-1301.065) (-1302.459) [-1302.754] (-1301.808) * (-1300.268) [-1299.965] (-1305.286) (-1302.769) -- 0:00:18
762500 -- [-1301.509] (-1301.451) (-1299.985) (-1303.796) * (-1303.230) [-1301.997] (-1309.804) (-1303.589) -- 0:00:18
763000 -- (-1301.091) [-1300.019] (-1301.209) (-1301.457) * (-1301.088) [-1304.188] (-1306.531) (-1302.835) -- 0:00:18
763500 -- (-1300.987) (-1301.309) [-1300.634] (-1301.897) * [-1300.825] (-1308.396) (-1301.494) (-1303.261) -- 0:00:17
764000 -- (-1304.706) (-1301.382) (-1302.565) [-1300.655] * (-1301.053) (-1310.219) (-1300.872) [-1301.757] -- 0:00:17
764500 -- (-1302.150) [-1299.981] (-1303.254) (-1300.389) * (-1301.264) (-1304.319) [-1301.469] (-1308.381) -- 0:00:17
765000 -- [-1303.288] (-1300.011) (-1301.743) (-1301.025) * [-1300.338] (-1304.262) (-1301.192) (-1307.018) -- 0:00:18
Average standard deviation of split frequencies: 0.006852
765500 -- (-1301.596) [-1300.433] (-1303.695) (-1302.177) * (-1302.394) [-1301.566] (-1299.822) (-1301.722) -- 0:00:18
766000 -- (-1302.000) [-1301.316] (-1301.711) (-1302.248) * (-1302.874) (-1302.750) (-1300.597) [-1300.469] -- 0:00:18
766500 -- (-1299.993) (-1303.230) [-1305.536] (-1299.897) * [-1302.652] (-1300.707) (-1300.316) (-1301.599) -- 0:00:17
767000 -- (-1300.867) [-1300.751] (-1301.720) (-1308.704) * [-1301.595] (-1303.778) (-1300.218) (-1306.201) -- 0:00:17
767500 -- [-1301.329] (-1301.427) (-1302.683) (-1307.518) * (-1302.416) (-1303.094) (-1299.876) [-1300.998] -- 0:00:17
768000 -- [-1302.598] (-1302.529) (-1306.300) (-1301.866) * (-1301.363) [-1300.378] (-1300.678) (-1302.382) -- 0:00:17
768500 -- (-1303.089) [-1301.583] (-1300.842) (-1306.209) * [-1303.085] (-1303.047) (-1304.937) (-1300.428) -- 0:00:17
769000 -- (-1300.089) (-1303.669) (-1301.342) [-1303.837] * (-1302.461) (-1303.041) (-1302.927) [-1300.921] -- 0:00:17
769500 -- (-1301.795) (-1305.572) [-1300.513] (-1303.285) * [-1302.919] (-1301.887) (-1303.612) (-1300.688) -- 0:00:17
770000 -- [-1301.753] (-1300.580) (-1303.548) (-1305.917) * (-1301.352) [-1301.203] (-1304.026) (-1300.077) -- 0:00:17
Average standard deviation of split frequencies: 0.006932
770500 -- [-1300.084] (-1300.737) (-1301.776) (-1304.910) * (-1300.144) (-1302.252) [-1305.784] (-1301.311) -- 0:00:17
771000 -- (-1300.169) (-1302.099) [-1303.715] (-1303.387) * (-1300.076) [-1301.255] (-1302.408) (-1300.379) -- 0:00:17
771500 -- (-1299.903) (-1301.400) (-1301.491) [-1301.362] * (-1300.327) [-1300.644] (-1302.472) (-1301.558) -- 0:00:17
772000 -- (-1300.106) (-1305.315) (-1305.787) [-1301.434] * (-1300.469) (-1300.705) (-1300.421) [-1299.798] -- 0:00:17
772500 -- (-1302.428) (-1305.051) (-1300.029) [-1302.349] * (-1300.017) (-1306.454) [-1301.261] (-1300.418) -- 0:00:17
773000 -- (-1301.054) [-1302.786] (-1306.547) (-1303.885) * (-1300.581) (-1302.826) (-1301.895) [-1301.098] -- 0:00:17
773500 -- (-1304.464) [-1300.009] (-1305.345) (-1304.735) * [-1300.799] (-1301.320) (-1303.190) (-1300.885) -- 0:00:17
774000 -- [-1302.496] (-1304.177) (-1302.533) (-1301.154) * (-1301.423) [-1300.166] (-1303.594) (-1303.382) -- 0:00:17
774500 -- [-1301.675] (-1301.618) (-1300.160) (-1301.001) * (-1300.333) (-1301.783) (-1299.783) [-1302.403] -- 0:00:17
775000 -- (-1300.171) [-1303.264] (-1301.588) (-1303.548) * (-1300.141) [-1303.397] (-1303.370) (-1302.379) -- 0:00:17
Average standard deviation of split frequencies: 0.007128
775500 -- (-1301.722) (-1302.625) [-1299.739] (-1301.670) * (-1301.508) [-1301.259] (-1301.580) (-1302.354) -- 0:00:17
776000 -- (-1301.376) [-1301.602] (-1301.421) (-1304.374) * [-1303.482] (-1308.015) (-1300.034) (-1302.146) -- 0:00:17
776500 -- (-1300.714) (-1300.127) [-1301.975] (-1304.495) * (-1303.521) [-1308.301] (-1300.749) (-1303.257) -- 0:00:16
777000 -- [-1302.098] (-1299.868) (-1302.292) (-1300.858) * (-1300.734) [-1303.076] (-1301.143) (-1303.500) -- 0:00:16
777500 -- (-1300.624) (-1301.871) [-1302.859] (-1303.293) * (-1305.502) (-1301.536) (-1304.033) [-1300.481] -- 0:00:16
778000 -- [-1301.940] (-1304.912) (-1303.119) (-1301.353) * (-1301.552) [-1299.902] (-1303.150) (-1300.487) -- 0:00:16
778500 -- [-1301.442] (-1301.424) (-1301.238) (-1301.262) * [-1302.974] (-1300.365) (-1302.546) (-1302.641) -- 0:00:17
779000 -- (-1302.457) [-1303.462] (-1301.411) (-1299.734) * (-1300.698) (-1300.152) [-1304.749] (-1302.591) -- 0:00:17
779500 -- (-1300.219) (-1304.572) [-1302.375] (-1303.350) * (-1300.234) (-1299.708) (-1305.116) [-1302.075] -- 0:00:16
780000 -- (-1301.281) (-1308.418) (-1302.220) [-1302.769] * [-1300.680] (-1301.080) (-1302.585) (-1300.458) -- 0:00:16
Average standard deviation of split frequencies: 0.006723
780500 -- (-1300.587) (-1306.043) [-1302.089] (-1301.435) * (-1301.422) (-1300.996) (-1301.106) [-1300.755] -- 0:00:16
781000 -- [-1299.867] (-1304.486) (-1305.658) (-1304.194) * [-1301.214] (-1306.714) (-1301.438) (-1300.345) -- 0:00:16
781500 -- [-1300.653] (-1304.618) (-1300.527) (-1301.894) * (-1300.869) [-1300.604] (-1300.321) (-1301.099) -- 0:00:16
782000 -- (-1302.106) (-1302.404) [-1300.293] (-1304.775) * (-1301.805) [-1301.666] (-1302.717) (-1302.248) -- 0:00:16
782500 -- (-1302.179) [-1300.341] (-1300.792) (-1305.806) * (-1304.638) (-1301.815) (-1301.530) [-1301.662] -- 0:00:16
783000 -- [-1302.210] (-1303.083) (-1302.187) (-1303.806) * [-1301.544] (-1302.005) (-1299.442) (-1302.295) -- 0:00:16
783500 -- (-1301.649) [-1301.057] (-1301.354) (-1303.092) * (-1301.121) [-1300.979] (-1299.560) (-1300.864) -- 0:00:16
784000 -- (-1302.532) (-1300.853) [-1300.840] (-1300.973) * [-1304.901] (-1301.056) (-1303.820) (-1304.453) -- 0:00:16
784500 -- [-1301.576] (-1301.876) (-1302.408) (-1302.449) * (-1301.251) (-1300.610) [-1300.630] (-1300.126) -- 0:00:16
785000 -- (-1300.826) [-1302.761] (-1301.933) (-1301.590) * (-1300.906) (-1305.276) [-1301.315] (-1305.025) -- 0:00:16
Average standard deviation of split frequencies: 0.006717
785500 -- [-1301.644] (-1304.696) (-1301.155) (-1302.668) * (-1300.514) [-1302.907] (-1304.813) (-1304.328) -- 0:00:16
786000 -- (-1303.259) (-1300.402) [-1304.115] (-1302.654) * (-1302.066) [-1300.126] (-1302.688) (-1300.263) -- 0:00:16
786500 -- (-1303.222) (-1302.180) (-1305.769) [-1303.584] * (-1302.283) [-1300.376] (-1303.154) (-1305.627) -- 0:00:16
787000 -- (-1300.916) (-1302.017) [-1299.600] (-1300.451) * [-1300.460] (-1302.182) (-1303.116) (-1300.548) -- 0:00:16
787500 -- (-1300.682) [-1301.037] (-1300.985) (-1301.902) * (-1301.382) [-1300.270] (-1310.051) (-1302.920) -- 0:00:16
788000 -- (-1300.533) (-1301.609) (-1304.537) [-1302.971] * [-1300.051] (-1301.315) (-1304.881) (-1302.728) -- 0:00:16
788500 -- (-1302.257) (-1304.089) [-1301.798] (-1303.637) * [-1301.994] (-1301.921) (-1303.258) (-1302.581) -- 0:00:16
789000 -- (-1303.775) [-1301.081] (-1304.750) (-1301.865) * (-1301.516) [-1300.489] (-1300.230) (-1306.348) -- 0:00:16
789500 -- [-1300.854] (-1302.412) (-1301.796) (-1302.680) * (-1300.601) [-1301.455] (-1300.333) (-1300.728) -- 0:00:15
790000 -- (-1301.076) (-1302.412) [-1300.424] (-1300.838) * (-1302.272) [-1300.680] (-1301.127) (-1300.931) -- 0:00:15
Average standard deviation of split frequencies: 0.006916
790500 -- (-1301.228) [-1302.303] (-1304.836) (-1301.291) * (-1300.909) [-1301.555] (-1301.469) (-1302.193) -- 0:00:15
791000 -- [-1302.098] (-1300.025) (-1300.329) (-1300.972) * [-1302.062] (-1302.148) (-1305.510) (-1304.733) -- 0:00:15
791500 -- (-1300.157) [-1300.278] (-1300.963) (-1299.896) * (-1304.864) [-1305.934] (-1301.086) (-1301.928) -- 0:00:15
792000 -- [-1300.234] (-1301.857) (-1301.479) (-1301.706) * (-1303.264) (-1305.741) [-1303.105] (-1301.938) -- 0:00:16
792500 -- (-1301.428) (-1304.065) (-1303.695) [-1301.732] * (-1302.414) [-1304.345] (-1304.539) (-1301.285) -- 0:00:15
793000 -- (-1301.819) [-1300.045] (-1303.601) (-1301.631) * (-1301.534) (-1302.519) (-1300.844) [-1301.019] -- 0:00:15
793500 -- [-1300.757] (-1301.464) (-1301.086) (-1300.712) * [-1302.411] (-1302.926) (-1300.829) (-1302.498) -- 0:00:15
794000 -- (-1301.457) [-1304.577] (-1305.580) (-1301.940) * (-1299.667) (-1300.478) (-1300.878) [-1303.642] -- 0:00:15
794500 -- (-1300.443) (-1304.943) (-1308.215) [-1304.403] * [-1299.491] (-1302.907) (-1301.472) (-1302.879) -- 0:00:15
795000 -- (-1302.525) [-1300.758] (-1306.509) (-1303.041) * (-1299.764) [-1305.287] (-1301.291) (-1300.460) -- 0:00:15
Average standard deviation of split frequencies: 0.007107
795500 -- (-1303.190) (-1303.234) [-1301.132] (-1300.589) * (-1299.562) (-1307.293) [-1303.581] (-1300.072) -- 0:00:15
796000 -- [-1305.233] (-1300.900) (-1301.137) (-1300.365) * (-1301.301) (-1301.825) (-1300.968) [-1302.860] -- 0:00:15
796500 -- (-1300.102) (-1299.634) [-1300.096] (-1301.168) * (-1302.065) (-1300.158) [-1301.020] (-1300.291) -- 0:00:15
797000 -- (-1304.105) (-1299.980) [-1299.857] (-1300.983) * [-1302.878] (-1303.431) (-1302.101) (-1303.504) -- 0:00:15
797500 -- [-1300.938] (-1303.832) (-1301.321) (-1301.565) * [-1304.978] (-1304.480) (-1304.673) (-1299.854) -- 0:00:15
798000 -- (-1304.534) (-1300.052) [-1300.262] (-1302.714) * (-1305.276) (-1301.852) [-1301.771] (-1301.179) -- 0:00:15
798500 -- [-1300.377] (-1300.417) (-1300.592) (-1306.167) * (-1301.839) (-1304.596) (-1305.376) [-1303.634] -- 0:00:15
799000 -- [-1300.154] (-1299.765) (-1300.629) (-1302.269) * (-1303.418) (-1305.084) [-1300.117] (-1301.490) -- 0:00:15
799500 -- [-1299.473] (-1300.989) (-1302.658) (-1300.435) * (-1303.137) (-1301.816) [-1301.508] (-1300.959) -- 0:00:15
800000 -- (-1299.360) (-1303.550) [-1299.798] (-1300.324) * (-1300.413) (-1301.853) (-1301.266) [-1302.848] -- 0:00:15
Average standard deviation of split frequencies: 0.007104
800500 -- (-1299.875) (-1301.771) [-1301.272] (-1306.630) * [-1302.918] (-1301.918) (-1299.872) (-1302.692) -- 0:00:15
801000 -- [-1302.491] (-1301.721) (-1300.936) (-1302.255) * (-1299.999) [-1302.118] (-1303.066) (-1303.165) -- 0:00:15
801500 -- (-1302.273) (-1302.707) [-1303.135] (-1303.131) * (-1305.486) [-1301.899] (-1301.114) (-1300.458) -- 0:00:15
802000 -- (-1301.529) (-1301.880) [-1302.697] (-1301.426) * (-1302.943) (-1304.003) (-1304.086) [-1299.922] -- 0:00:15
802500 -- (-1305.574) (-1304.486) (-1303.070) [-1300.931] * (-1302.459) (-1301.690) [-1302.964] (-1304.759) -- 0:00:15
803000 -- (-1303.105) [-1303.047] (-1301.680) (-1300.493) * (-1303.560) [-1300.118] (-1304.188) (-1303.399) -- 0:00:14
803500 -- (-1300.222) (-1305.829) [-1299.749] (-1302.547) * [-1300.444] (-1302.513) (-1302.328) (-1301.042) -- 0:00:14
804000 -- [-1300.868] (-1301.199) (-1301.961) (-1301.568) * (-1304.152) (-1302.798) (-1304.562) [-1300.226] -- 0:00:14
804500 -- (-1301.164) (-1302.519) [-1303.484] (-1306.580) * [-1301.690] (-1302.396) (-1305.650) (-1299.874) -- 0:00:14
805000 -- [-1303.815] (-1304.018) (-1300.157) (-1301.156) * [-1300.381] (-1302.134) (-1299.980) (-1300.970) -- 0:00:14
Average standard deviation of split frequencies: 0.007096
805500 -- (-1302.244) (-1301.263) [-1301.157] (-1304.217) * (-1300.729) (-1302.142) [-1300.180] (-1301.660) -- 0:00:14
806000 -- [-1303.136] (-1302.196) (-1301.882) (-1301.673) * (-1301.535) [-1300.979] (-1299.749) (-1302.905) -- 0:00:14
806500 -- (-1302.610) [-1299.833] (-1302.116) (-1300.256) * (-1300.354) (-1299.715) (-1300.451) [-1303.674] -- 0:00:14
807000 -- (-1301.148) (-1300.715) (-1301.061) [-1304.061] * (-1300.437) [-1300.104] (-1301.653) (-1301.761) -- 0:00:14
807500 -- (-1307.390) (-1301.493) [-1300.791] (-1301.080) * (-1300.637) (-1299.702) (-1303.700) [-1304.694] -- 0:00:14
808000 -- (-1300.722) [-1300.048] (-1301.908) (-1302.972) * (-1305.897) (-1302.373) [-1301.167] (-1301.318) -- 0:00:14
808500 -- (-1302.024) (-1302.079) (-1300.307) [-1303.504] * (-1308.649) (-1303.697) (-1308.880) [-1302.212] -- 0:00:14
809000 -- (-1301.922) [-1299.855] (-1305.011) (-1302.908) * (-1302.441) (-1301.326) [-1302.114] (-1301.834) -- 0:00:14
809500 -- (-1301.538) [-1299.701] (-1308.583) (-1304.261) * (-1303.932) [-1301.258] (-1300.530) (-1302.220) -- 0:00:14
810000 -- (-1300.374) (-1303.816) (-1303.457) [-1304.117] * (-1304.573) (-1305.641) [-1301.082] (-1306.079) -- 0:00:14
Average standard deviation of split frequencies: 0.007249
810500 -- (-1301.952) [-1301.741] (-1301.036) (-1304.176) * (-1301.603) (-1300.670) (-1300.602) [-1301.125] -- 0:00:14
811000 -- [-1299.522] (-1301.337) (-1300.489) (-1301.072) * (-1300.909) (-1300.434) [-1301.866] (-1302.768) -- 0:00:14
811500 -- [-1300.415] (-1300.329) (-1300.368) (-1302.526) * (-1302.612) [-1301.318] (-1300.952) (-1305.259) -- 0:00:14
812000 -- [-1303.908] (-1302.781) (-1305.160) (-1303.084) * [-1302.139] (-1302.025) (-1303.248) (-1301.168) -- 0:00:14
812500 -- (-1302.936) (-1302.955) [-1301.588] (-1300.792) * (-1308.301) (-1308.242) (-1299.796) [-1301.808] -- 0:00:14
813000 -- (-1308.062) (-1300.838) (-1302.227) [-1301.901] * (-1303.742) (-1305.145) [-1299.750] (-1299.889) -- 0:00:14
813500 -- (-1302.136) (-1300.932) [-1300.592] (-1300.411) * (-1302.320) (-1303.591) (-1301.720) [-1301.244] -- 0:00:14
814000 -- (-1303.441) [-1300.199] (-1303.123) (-1301.873) * (-1304.796) (-1302.539) (-1302.552) [-1300.533] -- 0:00:14
814500 -- (-1301.481) (-1301.410) (-1303.550) [-1301.212] * (-1301.694) (-1301.148) [-1303.241] (-1300.678) -- 0:00:14
815000 -- (-1301.400) (-1300.488) (-1301.302) [-1300.579] * [-1301.791] (-1300.713) (-1302.564) (-1303.277) -- 0:00:14
Average standard deviation of split frequencies: 0.006932
815500 -- [-1300.170] (-1299.559) (-1301.987) (-1300.696) * (-1301.927) (-1303.840) [-1301.570] (-1312.617) -- 0:00:14
816000 -- (-1301.087) (-1300.335) [-1300.864] (-1300.664) * [-1299.952] (-1303.172) (-1300.739) (-1306.429) -- 0:00:13
816500 -- (-1300.783) [-1300.792] (-1302.144) (-1306.522) * [-1300.398] (-1300.165) (-1300.659) (-1302.223) -- 0:00:13
817000 -- (-1308.160) (-1300.583) (-1302.021) [-1301.022] * (-1300.353) (-1300.292) [-1302.168] (-1303.125) -- 0:00:13
817500 -- (-1302.636) (-1299.776) (-1302.830) [-1302.450] * [-1302.324] (-1300.209) (-1300.106) (-1301.364) -- 0:00:13
818000 -- (-1303.868) (-1300.146) (-1300.055) [-1300.950] * [-1303.049] (-1300.451) (-1308.402) (-1302.951) -- 0:00:13
818500 -- (-1301.342) (-1300.843) [-1299.799] (-1302.859) * (-1302.871) [-1302.331] (-1304.535) (-1307.568) -- 0:00:13
819000 -- [-1301.257] (-1304.281) (-1299.779) (-1301.943) * (-1305.811) [-1302.983] (-1303.405) (-1300.943) -- 0:00:13
819500 -- (-1302.265) (-1304.935) (-1299.709) [-1308.021] * (-1299.742) [-1301.636] (-1301.837) (-1302.264) -- 0:00:13
820000 -- (-1306.139) (-1300.915) [-1300.010] (-1301.393) * (-1300.235) (-1301.499) (-1302.164) [-1303.383] -- 0:00:13
Average standard deviation of split frequencies: 0.006893
820500 -- (-1303.508) (-1302.520) [-1300.327] (-1301.726) * (-1300.764) [-1300.493] (-1302.326) (-1305.805) -- 0:00:13
821000 -- [-1302.613] (-1304.381) (-1306.535) (-1303.994) * (-1305.748) (-1300.749) (-1301.814) [-1301.051] -- 0:00:13
821500 -- (-1300.611) (-1304.199) (-1301.587) [-1301.499] * [-1301.163] (-1300.986) (-1302.044) (-1304.822) -- 0:00:13
822000 -- (-1303.368) [-1301.814] (-1301.810) (-1300.080) * (-1304.114) [-1300.525] (-1303.024) (-1307.315) -- 0:00:13
822500 -- (-1306.758) (-1301.779) [-1301.341] (-1300.054) * (-1303.857) (-1300.707) (-1301.330) [-1300.855] -- 0:00:13
823000 -- [-1302.211] (-1303.831) (-1305.402) (-1300.140) * (-1301.947) (-1301.475) [-1301.554] (-1303.185) -- 0:00:13
823500 -- [-1300.862] (-1300.244) (-1304.854) (-1301.644) * (-1302.617) (-1303.732) [-1303.184] (-1301.953) -- 0:00:13
824000 -- (-1300.636) (-1301.828) (-1300.139) [-1301.665] * (-1300.906) (-1301.080) [-1301.813] (-1302.375) -- 0:00:13
824500 -- [-1306.435] (-1300.769) (-1301.188) (-1301.333) * (-1300.174) (-1303.235) [-1303.810] (-1301.196) -- 0:00:13
825000 -- [-1304.758] (-1303.626) (-1302.777) (-1301.859) * (-1300.885) (-1304.175) [-1300.448] (-1300.544) -- 0:00:13
Average standard deviation of split frequencies: 0.006925
825500 -- [-1302.173] (-1303.216) (-1301.571) (-1299.868) * (-1301.144) [-1300.850] (-1302.606) (-1300.565) -- 0:00:13
826000 -- (-1302.587) (-1303.625) (-1301.982) [-1299.860] * (-1301.449) [-1303.424] (-1301.470) (-1299.864) -- 0:00:13
826500 -- (-1300.264) [-1301.551] (-1302.336) (-1304.019) * (-1301.616) [-1303.026] (-1304.607) (-1302.774) -- 0:00:13
827000 -- (-1301.918) (-1303.940) (-1304.246) [-1300.936] * [-1301.537] (-1300.797) (-1302.088) (-1300.715) -- 0:00:13
827500 -- [-1301.633] (-1304.044) (-1300.809) (-1300.977) * (-1300.628) (-1302.581) [-1300.877] (-1301.437) -- 0:00:13
828000 -- [-1304.805] (-1301.559) (-1301.279) (-1302.150) * (-1300.992) (-1303.135) (-1303.399) [-1300.860] -- 0:00:13
828500 -- (-1300.852) (-1301.536) (-1300.955) [-1300.939] * (-1300.144) [-1303.774] (-1301.120) (-1301.997) -- 0:00:13
829000 -- [-1300.732] (-1300.752) (-1302.852) (-1300.757) * (-1299.797) (-1305.241) [-1302.740] (-1301.104) -- 0:00:12
829500 -- [-1300.496] (-1302.487) (-1302.809) (-1301.731) * (-1301.045) (-1299.586) [-1299.816] (-1307.260) -- 0:00:12
830000 -- (-1302.705) [-1301.503] (-1302.387) (-1301.113) * (-1301.236) (-1305.133) [-1300.394] (-1300.905) -- 0:00:12
Average standard deviation of split frequencies: 0.007188
830500 -- [-1301.430] (-1302.022) (-1300.026) (-1303.133) * (-1300.571) [-1306.051] (-1305.887) (-1300.563) -- 0:00:12
831000 -- [-1302.105] (-1305.867) (-1300.704) (-1300.376) * [-1302.040] (-1312.977) (-1302.937) (-1303.962) -- 0:00:12
831500 -- (-1312.016) (-1304.558) [-1302.456] (-1301.379) * [-1303.347] (-1302.022) (-1301.770) (-1302.540) -- 0:00:12
832000 -- (-1304.256) (-1301.962) (-1302.392) [-1300.810] * (-1300.573) (-1299.697) [-1301.317] (-1303.509) -- 0:00:12
832500 -- (-1302.801) [-1301.972] (-1304.711) (-1301.405) * (-1300.591) (-1299.653) [-1302.128] (-1300.219) -- 0:00:12
833000 -- (-1300.974) [-1303.745] (-1301.600) (-1302.737) * (-1301.041) [-1300.043] (-1302.619) (-1301.213) -- 0:00:12
833500 -- (-1300.769) (-1307.165) [-1300.347] (-1302.093) * (-1301.662) [-1299.945] (-1307.622) (-1300.973) -- 0:00:12
834000 -- (-1300.780) [-1304.334] (-1300.503) (-1301.831) * [-1302.235] (-1299.979) (-1300.297) (-1302.843) -- 0:00:12
834500 -- (-1302.622) (-1301.777) (-1303.438) [-1300.705] * [-1299.802] (-1301.456) (-1304.011) (-1301.942) -- 0:00:12
835000 -- (-1304.876) (-1302.520) [-1300.666] (-1300.800) * (-1300.440) (-1301.385) (-1305.236) [-1305.774] -- 0:00:12
Average standard deviation of split frequencies: 0.006992
835500 -- [-1305.360] (-1303.942) (-1300.461) (-1300.203) * (-1299.758) (-1302.422) [-1303.025] (-1310.161) -- 0:00:12
836000 -- [-1300.202] (-1301.367) (-1300.459) (-1300.705) * [-1301.677] (-1303.321) (-1301.180) (-1303.488) -- 0:00:12
836500 -- (-1300.449) (-1303.001) [-1301.400] (-1300.291) * (-1300.355) [-1302.038] (-1301.088) (-1300.508) -- 0:00:12
837000 -- (-1300.200) (-1301.052) (-1301.561) [-1299.589] * (-1300.757) (-1302.840) (-1300.480) [-1301.968] -- 0:00:12
837500 -- (-1301.273) [-1300.068] (-1299.930) (-1304.327) * (-1304.202) (-1302.241) [-1301.979] (-1299.991) -- 0:00:12
838000 -- (-1301.783) (-1300.905) [-1299.930] (-1305.390) * (-1303.656) (-1301.245) (-1300.207) [-1302.122] -- 0:00:12
838500 -- (-1304.108) [-1299.982] (-1303.452) (-1305.300) * (-1302.716) [-1302.714] (-1302.253) (-1300.565) -- 0:00:12
839000 -- (-1304.788) (-1302.405) (-1303.113) [-1300.835] * (-1300.514) (-1300.718) (-1302.840) [-1300.507] -- 0:00:12
839500 -- (-1303.533) (-1300.327) (-1301.612) [-1301.884] * (-1301.524) (-1300.481) [-1301.501] (-1302.119) -- 0:00:12
840000 -- (-1304.447) (-1300.727) [-1300.562] (-1301.818) * (-1302.463) (-1302.948) [-1302.280] (-1305.748) -- 0:00:12
Average standard deviation of split frequencies: 0.006692
840500 -- (-1302.179) (-1302.381) (-1305.169) [-1301.616] * [-1302.542] (-1303.218) (-1301.194) (-1301.405) -- 0:00:12
841000 -- (-1302.131) (-1302.728) (-1300.774) [-1301.703] * [-1300.791] (-1301.561) (-1300.347) (-1301.389) -- 0:00:12
841500 -- [-1302.295] (-1304.290) (-1299.886) (-1301.769) * (-1302.603) [-1306.088] (-1301.217) (-1301.896) -- 0:00:12
842000 -- [-1301.849] (-1303.774) (-1300.567) (-1307.698) * [-1300.996] (-1303.894) (-1307.443) (-1300.426) -- 0:00:12
842500 -- (-1304.167) [-1305.505] (-1300.053) (-1300.668) * (-1301.318) [-1302.278] (-1300.142) (-1301.259) -- 0:00:11
843000 -- (-1302.368) [-1301.298] (-1300.114) (-1300.083) * (-1301.417) (-1303.818) [-1302.209] (-1301.066) -- 0:00:11
843500 -- (-1302.875) [-1303.328] (-1300.680) (-1301.397) * (-1300.908) (-1302.037) (-1301.460) [-1302.184] -- 0:00:11
844000 -- (-1301.437) (-1302.347) [-1301.107] (-1302.553) * (-1304.102) (-1301.917) (-1300.977) [-1303.096] -- 0:00:11
844500 -- (-1300.027) (-1301.327) [-1300.878] (-1300.530) * (-1303.039) (-1308.860) (-1303.392) [-1304.677] -- 0:00:11
845000 -- (-1301.414) (-1303.250) (-1305.683) [-1301.245] * [-1302.123] (-1304.562) (-1303.388) (-1305.361) -- 0:00:11
Average standard deviation of split frequencies: 0.006427
845500 -- (-1304.037) (-1301.066) [-1303.138] (-1302.218) * (-1301.708) (-1303.576) (-1300.462) [-1300.681] -- 0:00:11
846000 -- [-1301.593] (-1301.360) (-1301.712) (-1300.619) * (-1301.531) [-1301.081] (-1302.245) (-1302.584) -- 0:00:11
846500 -- [-1300.044] (-1301.488) (-1305.999) (-1300.710) * [-1301.018] (-1306.680) (-1301.652) (-1306.884) -- 0:00:11
847000 -- [-1301.316] (-1302.678) (-1301.996) (-1306.268) * [-1300.607] (-1300.183) (-1302.032) (-1301.453) -- 0:00:11
847500 -- (-1306.882) (-1303.081) [-1302.584] (-1301.540) * (-1300.197) [-1301.259] (-1301.247) (-1302.607) -- 0:00:11
848000 -- [-1302.670] (-1301.379) (-1306.833) (-1302.028) * (-1304.615) (-1302.746) [-1301.680] (-1302.656) -- 0:00:11
848500 -- [-1301.887] (-1305.406) (-1303.120) (-1300.455) * (-1306.636) (-1302.173) [-1302.348] (-1304.579) -- 0:00:11
849000 -- [-1302.642] (-1302.703) (-1301.091) (-1303.025) * (-1302.385) [-1300.783] (-1302.063) (-1302.865) -- 0:00:11
849500 -- (-1302.866) (-1301.717) [-1301.057] (-1302.945) * (-1302.457) [-1301.440] (-1300.537) (-1301.794) -- 0:00:11
850000 -- [-1302.800] (-1303.034) (-1302.958) (-1309.861) * (-1301.505) (-1301.507) [-1300.701] (-1300.310) -- 0:00:11
Average standard deviation of split frequencies: 0.006502
850500 -- (-1304.745) (-1301.641) [-1300.884] (-1302.520) * (-1301.193) (-1301.185) [-1300.153] (-1301.783) -- 0:00:11
851000 -- (-1301.676) [-1300.155] (-1300.886) (-1300.881) * (-1299.711) (-1302.447) [-1300.820] (-1303.547) -- 0:00:11
851500 -- (-1300.974) (-1301.190) (-1302.985) [-1300.060] * (-1299.556) [-1301.222] (-1301.132) (-1300.657) -- 0:00:11
852000 -- [-1300.582] (-1306.504) (-1300.349) (-1303.980) * [-1299.556] (-1304.607) (-1306.916) (-1304.223) -- 0:00:11
852500 -- (-1303.392) (-1308.569) (-1307.195) [-1303.444] * [-1299.992] (-1307.543) (-1303.237) (-1303.028) -- 0:00:11
853000 -- (-1306.298) [-1303.306] (-1304.783) (-1302.246) * [-1301.550] (-1306.222) (-1308.415) (-1301.035) -- 0:00:11
853500 -- (-1300.875) (-1302.359) [-1302.546] (-1306.178) * [-1304.025] (-1305.614) (-1302.347) (-1301.557) -- 0:00:11
854000 -- (-1300.283) (-1303.868) (-1301.631) [-1305.271] * (-1305.625) (-1300.880) [-1302.308] (-1305.966) -- 0:00:11
854500 -- (-1301.253) (-1302.321) (-1302.231) [-1299.859] * (-1305.297) (-1302.393) (-1302.464) [-1301.318] -- 0:00:11
855000 -- (-1303.005) (-1302.760) (-1305.977) [-1301.491] * [-1300.762] (-1301.464) (-1300.339) (-1301.213) -- 0:00:11
Average standard deviation of split frequencies: 0.006535
855500 -- (-1303.988) (-1300.393) (-1301.721) [-1300.737] * (-1304.605) (-1300.625) [-1299.641] (-1302.021) -- 0:00:10
856000 -- [-1302.098] (-1301.877) (-1300.292) (-1302.773) * (-1301.013) [-1302.982] (-1307.046) (-1299.733) -- 0:00:10
856500 -- (-1302.309) [-1301.869] (-1300.942) (-1301.767) * [-1299.840] (-1300.337) (-1303.204) (-1299.619) -- 0:00:10
857000 -- [-1302.220] (-1300.149) (-1301.245) (-1301.211) * (-1301.766) (-1300.538) (-1300.702) [-1301.365] -- 0:00:10
857500 -- (-1301.419) [-1302.303] (-1301.109) (-1301.126) * [-1299.926] (-1302.783) (-1301.469) (-1301.126) -- 0:00:10
858000 -- (-1301.288) (-1303.213) (-1302.309) [-1302.973] * [-1299.710] (-1302.985) (-1300.191) (-1302.672) -- 0:00:10
858500 -- [-1301.449] (-1300.105) (-1303.566) (-1299.766) * [-1299.710] (-1303.622) (-1300.786) (-1301.515) -- 0:00:10
859000 -- (-1302.166) (-1300.590) (-1302.859) [-1300.245] * [-1300.670] (-1301.726) (-1302.637) (-1300.312) -- 0:00:10
859500 -- [-1302.007] (-1303.206) (-1302.568) (-1300.570) * (-1302.330) (-1302.548) (-1302.527) [-1301.169] -- 0:00:10
860000 -- [-1300.354] (-1306.958) (-1302.717) (-1302.955) * (-1300.453) (-1302.480) (-1300.858) [-1301.337] -- 0:00:10
Average standard deviation of split frequencies: 0.006609
860500 -- (-1300.033) [-1301.831] (-1301.987) (-1306.572) * (-1300.017) [-1302.322] (-1301.189) (-1301.556) -- 0:00:10
861000 -- (-1302.488) (-1303.735) (-1302.439) [-1299.956] * (-1302.123) (-1304.015) (-1299.685) [-1302.932] -- 0:00:10
861500 -- [-1304.001] (-1303.098) (-1302.228) (-1300.741) * (-1301.969) [-1299.609] (-1304.861) (-1303.014) -- 0:00:10
862000 -- (-1300.963) [-1301.288] (-1302.148) (-1300.885) * [-1302.745] (-1301.941) (-1305.284) (-1303.103) -- 0:00:10
862500 -- [-1303.863] (-1304.920) (-1300.420) (-1300.658) * (-1300.799) [-1301.941] (-1304.019) (-1301.988) -- 0:00:10
863000 -- (-1304.503) [-1305.149] (-1300.411) (-1301.591) * [-1300.787] (-1302.035) (-1302.294) (-1301.011) -- 0:00:10
863500 -- (-1300.886) (-1301.616) (-1300.481) [-1301.210] * [-1303.680] (-1301.373) (-1301.544) (-1305.160) -- 0:00:10
864000 -- [-1302.492] (-1301.683) (-1301.139) (-1301.723) * (-1302.526) (-1302.609) (-1303.570) [-1301.557] -- 0:00:10
864500 -- (-1301.004) (-1300.366) (-1300.945) [-1301.828] * (-1301.141) [-1301.949] (-1301.278) (-1302.710) -- 0:00:10
865000 -- (-1301.375) (-1301.033) (-1302.563) [-1301.807] * (-1299.865) [-1302.296] (-1300.301) (-1304.036) -- 0:00:10
Average standard deviation of split frequencies: 0.006895
865500 -- (-1300.378) (-1301.022) [-1303.129] (-1301.019) * [-1303.599] (-1303.705) (-1301.383) (-1301.392) -- 0:00:10
866000 -- (-1301.613) (-1302.148) (-1303.573) [-1300.887] * (-1306.595) [-1301.699] (-1301.345) (-1300.460) -- 0:00:10
866500 -- [-1300.014] (-1302.188) (-1303.754) (-1304.254) * [-1301.427] (-1301.774) (-1303.142) (-1303.312) -- 0:00:10
867000 -- [-1300.460] (-1302.077) (-1301.266) (-1301.843) * [-1301.708] (-1301.916) (-1301.516) (-1300.912) -- 0:00:10
867500 -- (-1303.188) [-1303.371] (-1302.853) (-1301.198) * (-1304.079) (-1299.850) (-1303.398) [-1300.279] -- 0:00:10
868000 -- (-1301.669) (-1301.650) (-1302.866) [-1302.178] * (-1301.717) (-1303.693) [-1301.555] (-1299.942) -- 0:00:10
868500 -- (-1302.590) [-1300.890] (-1301.035) (-1300.398) * (-1302.691) [-1304.454] (-1300.160) (-1306.001) -- 0:00:09
869000 -- (-1302.006) [-1301.992] (-1302.266) (-1303.510) * [-1301.987] (-1302.977) (-1300.837) (-1304.774) -- 0:00:09
869500 -- (-1302.243) (-1302.895) [-1301.663] (-1301.940) * (-1303.413) (-1305.818) (-1300.908) [-1302.712] -- 0:00:09
870000 -- [-1301.499] (-1302.640) (-1302.548) (-1301.956) * [-1300.113] (-1300.545) (-1302.832) (-1306.844) -- 0:00:09
Average standard deviation of split frequencies: 0.006966
870500 -- (-1304.501) [-1307.559] (-1301.135) (-1303.258) * [-1299.767] (-1301.137) (-1304.538) (-1315.294) -- 0:00:09
871000 -- (-1303.751) (-1305.031) (-1302.541) [-1300.783] * [-1301.472] (-1303.083) (-1302.479) (-1308.806) -- 0:00:09
871500 -- (-1302.452) [-1307.010] (-1301.090) (-1302.204) * (-1302.247) (-1302.328) [-1302.872] (-1309.833) -- 0:00:09
872000 -- (-1302.196) (-1300.677) [-1300.214] (-1301.505) * (-1302.835) (-1302.197) [-1299.784] (-1300.284) -- 0:00:09
872500 -- (-1303.232) (-1302.772) [-1302.085] (-1302.035) * [-1301.052] (-1302.196) (-1300.819) (-1299.709) -- 0:00:09
873000 -- (-1305.592) [-1301.900] (-1303.727) (-1305.020) * (-1301.376) (-1301.339) [-1299.794] (-1302.890) -- 0:00:09
873500 -- (-1303.302) (-1304.619) [-1301.084] (-1301.476) * [-1301.060] (-1301.980) (-1304.101) (-1300.522) -- 0:00:09
874000 -- (-1304.001) (-1304.113) (-1300.446) [-1301.539] * (-1300.397) (-1301.748) (-1302.614) [-1300.134] -- 0:00:09
874500 -- [-1302.351] (-1304.012) (-1303.140) (-1303.296) * (-1300.931) (-1302.517) (-1304.603) [-1299.707] -- 0:00:09
875000 -- (-1301.731) [-1303.085] (-1300.384) (-1304.437) * (-1301.213) (-1303.299) [-1303.491] (-1301.190) -- 0:00:09
Average standard deviation of split frequencies: 0.007139
875500 -- (-1302.697) (-1300.951) [-1300.657] (-1302.682) * (-1299.932) (-1302.954) (-1304.309) [-1300.535] -- 0:00:09
876000 -- (-1301.350) [-1303.632] (-1304.059) (-1300.445) * [-1302.835] (-1301.311) (-1304.209) (-1300.285) -- 0:00:09
876500 -- [-1303.466] (-1303.432) (-1304.017) (-1301.248) * [-1300.882] (-1302.709) (-1300.037) (-1300.900) -- 0:00:09
877000 -- [-1299.925] (-1301.288) (-1302.704) (-1301.943) * [-1304.021] (-1303.204) (-1301.608) (-1308.172) -- 0:00:09
877500 -- (-1302.405) [-1301.717] (-1302.626) (-1302.444) * (-1302.771) (-1300.589) [-1302.140] (-1306.742) -- 0:00:09
878000 -- (-1302.016) (-1303.119) (-1303.259) [-1299.971] * (-1299.911) (-1306.773) (-1301.491) [-1301.868] -- 0:00:09
878500 -- [-1301.811] (-1301.123) (-1304.312) (-1301.307) * (-1300.200) (-1302.121) [-1302.884] (-1301.512) -- 0:00:09
879000 -- [-1300.666] (-1311.488) (-1303.540) (-1300.719) * (-1299.958) (-1302.376) (-1301.377) [-1302.954] -- 0:00:09
879500 -- (-1300.945) (-1301.875) (-1301.388) [-1302.716] * (-1301.949) (-1301.880) (-1302.483) [-1300.808] -- 0:00:09
880000 -- (-1301.002) [-1302.502] (-1299.766) (-1302.222) * (-1302.433) (-1301.082) (-1303.817) [-1301.566] -- 0:00:09
Average standard deviation of split frequencies: 0.007101
880500 -- (-1303.984) [-1305.028] (-1301.831) (-1302.076) * (-1301.704) [-1300.305] (-1301.707) (-1306.902) -- 0:00:09
881000 -- (-1303.717) [-1300.740] (-1302.282) (-1304.064) * (-1302.011) (-1303.276) [-1303.850] (-1310.888) -- 0:00:09
881500 -- (-1306.181) (-1303.079) (-1301.686) [-1301.527] * (-1304.889) (-1301.600) [-1305.404] (-1303.272) -- 0:00:09
882000 -- (-1301.164) (-1300.461) (-1301.976) [-1300.140] * (-1300.219) [-1302.247] (-1300.503) (-1304.332) -- 0:00:08
882500 -- (-1300.665) (-1302.933) [-1301.138] (-1300.436) * (-1304.099) [-1303.168] (-1302.607) (-1302.799) -- 0:00:08
883000 -- (-1301.863) (-1303.961) [-1304.377] (-1302.006) * (-1303.984) (-1302.431) [-1302.167] (-1304.338) -- 0:00:08
883500 -- (-1300.552) (-1301.098) [-1299.866] (-1302.863) * (-1303.916) (-1303.685) [-1301.830] (-1301.130) -- 0:00:08
884000 -- (-1306.350) [-1301.686] (-1301.197) (-1302.062) * [-1305.098] (-1300.739) (-1301.369) (-1300.914) -- 0:00:08
884500 -- (-1301.327) (-1300.828) [-1299.797] (-1302.512) * [-1300.785] (-1301.869) (-1300.689) (-1302.211) -- 0:00:08
885000 -- (-1301.340) (-1300.791) [-1299.899] (-1301.976) * (-1300.499) [-1301.540] (-1300.363) (-1305.151) -- 0:00:08
Average standard deviation of split frequencies: 0.007023
885500 -- (-1302.389) (-1300.251) [-1301.872] (-1301.564) * (-1301.302) (-1302.392) (-1300.428) [-1301.232] -- 0:00:08
886000 -- (-1302.239) (-1300.542) (-1305.027) [-1300.214] * (-1301.149) (-1300.930) [-1302.142] (-1301.519) -- 0:00:08
886500 -- [-1300.735] (-1301.860) (-1305.844) (-1300.361) * (-1306.572) (-1301.253) [-1303.246] (-1304.193) -- 0:00:08
887000 -- (-1301.599) [-1301.850] (-1302.699) (-1301.241) * (-1305.571) (-1302.686) (-1300.207) [-1301.727] -- 0:00:08
887500 -- (-1301.268) [-1300.946] (-1303.220) (-1299.825) * (-1300.718) (-1303.626) [-1303.977] (-1300.693) -- 0:00:08
888000 -- (-1302.757) [-1300.717] (-1310.503) (-1308.460) * (-1300.281) (-1301.343) (-1301.034) [-1303.799] -- 0:00:08
888500 -- (-1306.599) (-1299.621) (-1305.067) [-1300.764] * (-1302.324) [-1305.373] (-1301.920) (-1300.710) -- 0:00:08
889000 -- (-1303.682) (-1302.581) [-1300.844] (-1302.195) * (-1301.725) (-1301.289) [-1301.098] (-1302.145) -- 0:00:08
889500 -- (-1300.043) (-1300.309) (-1303.530) [-1300.857] * (-1302.684) [-1300.734] (-1300.459) (-1300.776) -- 0:00:08
890000 -- (-1301.257) (-1300.135) [-1300.482] (-1301.038) * (-1304.408) (-1300.036) (-1302.301) [-1301.841] -- 0:00:08
Average standard deviation of split frequencies: 0.007198
890500 -- (-1301.081) (-1302.519) [-1300.757] (-1301.213) * (-1302.803) (-1301.069) (-1306.001) [-1301.947] -- 0:00:08
891000 -- (-1302.077) [-1301.752] (-1303.483) (-1300.118) * (-1303.843) [-1300.190] (-1302.853) (-1304.539) -- 0:00:08
891500 -- [-1300.211] (-1300.712) (-1303.071) (-1307.798) * (-1303.180) (-1299.962) [-1305.193] (-1300.429) -- 0:00:08
892000 -- [-1300.792] (-1302.054) (-1301.584) (-1307.012) * (-1301.401) (-1300.419) [-1303.337] (-1302.365) -- 0:00:08
892500 -- (-1306.777) (-1306.511) (-1304.836) [-1305.290] * [-1301.261] (-1301.315) (-1302.243) (-1300.767) -- 0:00:08
893000 -- (-1304.605) (-1303.783) [-1300.136] (-1305.759) * (-1301.403) (-1302.914) (-1306.227) [-1300.791] -- 0:00:08
893500 -- (-1301.947) (-1302.271) (-1302.227) [-1303.305] * (-1301.140) (-1301.962) (-1300.447) [-1302.387] -- 0:00:08
894000 -- [-1301.309] (-1299.935) (-1301.246) (-1301.993) * (-1305.134) [-1300.724] (-1300.626) (-1301.023) -- 0:00:08
894500 -- (-1302.189) [-1302.435] (-1301.009) (-1301.291) * (-1311.835) (-1300.113) (-1303.812) [-1302.370] -- 0:00:08
895000 -- [-1303.488] (-1303.044) (-1300.959) (-1302.874) * [-1303.863] (-1303.963) (-1299.990) (-1302.846) -- 0:00:07
Average standard deviation of split frequencies: 0.007190
895500 -- [-1301.691] (-1301.117) (-1301.345) (-1300.322) * (-1302.322) (-1305.476) [-1299.780] (-1301.047) -- 0:00:07
896000 -- [-1303.126] (-1302.201) (-1302.132) (-1300.993) * (-1301.671) [-1306.114] (-1300.422) (-1300.600) -- 0:00:07
896500 -- (-1305.979) (-1303.597) (-1302.945) [-1300.734] * (-1300.732) (-1301.170) [-1302.603] (-1302.099) -- 0:00:07
897000 -- [-1300.858] (-1300.215) (-1303.239) (-1303.800) * [-1302.891] (-1299.734) (-1300.535) (-1303.090) -- 0:00:07
897500 -- (-1301.756) (-1300.240) (-1302.966) [-1302.034] * (-1303.000) (-1300.345) (-1304.350) [-1301.612] -- 0:00:07
898000 -- [-1300.755] (-1306.048) (-1300.182) (-1300.700) * (-1302.515) (-1301.235) (-1301.976) [-1300.946] -- 0:00:07
898500 -- [-1301.117] (-1301.012) (-1300.529) (-1306.689) * (-1300.026) (-1304.453) [-1299.909] (-1301.520) -- 0:00:07
899000 -- (-1304.440) [-1300.397] (-1302.419) (-1303.173) * [-1300.036] (-1302.098) (-1300.373) (-1299.888) -- 0:00:07
899500 -- (-1300.762) (-1303.311) (-1300.013) [-1302.438] * [-1303.712] (-1300.317) (-1305.199) (-1301.215) -- 0:00:07
900000 -- (-1300.800) [-1301.602] (-1303.054) (-1304.096) * (-1302.776) (-1306.848) (-1300.742) [-1301.418] -- 0:00:07
Average standard deviation of split frequencies: 0.007746
900500 -- (-1305.215) (-1303.535) (-1303.107) [-1304.807] * (-1302.669) (-1304.972) [-1300.482] (-1302.255) -- 0:00:07
901000 -- (-1304.053) (-1300.872) [-1302.968] (-1301.556) * (-1300.955) (-1300.364) [-1300.186] (-1301.227) -- 0:00:07
901500 -- (-1300.234) (-1301.385) (-1302.612) [-1300.349] * (-1300.811) (-1303.826) (-1300.195) [-1300.737] -- 0:00:07
902000 -- [-1300.916] (-1299.884) (-1302.463) (-1301.423) * (-1299.918) (-1304.388) [-1300.551] (-1304.848) -- 0:00:07
902500 -- (-1300.399) [-1301.169] (-1301.025) (-1303.345) * (-1302.271) [-1302.382] (-1302.329) (-1303.691) -- 0:00:07
903000 -- (-1301.027) (-1299.968) [-1304.645] (-1301.863) * (-1301.838) [-1299.687] (-1299.864) (-1303.338) -- 0:00:07
903500 -- (-1300.136) (-1304.573) [-1305.915] (-1302.405) * [-1300.626] (-1300.597) (-1300.594) (-1302.544) -- 0:00:07
904000 -- (-1299.769) (-1302.034) [-1301.471] (-1302.199) * (-1300.764) [-1302.531] (-1299.917) (-1304.190) -- 0:00:07
904500 -- (-1301.031) (-1300.635) (-1301.962) [-1300.049] * (-1303.029) (-1302.179) [-1299.615] (-1306.476) -- 0:00:07
905000 -- (-1300.181) [-1304.706] (-1302.799) (-1301.621) * [-1302.280] (-1301.124) (-1303.100) (-1304.623) -- 0:00:07
Average standard deviation of split frequencies: 0.008117
905500 -- (-1300.460) (-1302.549) [-1301.431] (-1303.532) * [-1301.756] (-1305.606) (-1303.269) (-1303.474) -- 0:00:07
906000 -- (-1301.676) (-1300.206) (-1302.074) [-1299.815] * (-1301.297) (-1302.486) [-1301.251] (-1303.992) -- 0:00:07
906500 -- (-1302.531) (-1300.886) [-1301.042] (-1303.558) * (-1300.944) (-1300.830) (-1302.561) [-1301.216] -- 0:00:07
907000 -- [-1301.345] (-1303.404) (-1300.615) (-1300.961) * (-1301.837) (-1300.778) (-1301.383) [-1302.283] -- 0:00:07
907500 -- [-1302.025] (-1302.740) (-1300.475) (-1301.834) * [-1302.888] (-1302.114) (-1301.558) (-1302.578) -- 0:00:07
908000 -- (-1301.380) (-1299.676) (-1300.422) [-1302.630] * (-1302.910) (-1302.555) (-1300.595) [-1302.336] -- 0:00:06
908500 -- (-1303.217) (-1299.617) [-1302.291] (-1300.956) * (-1304.718) (-1302.606) (-1300.471) [-1303.483] -- 0:00:06
909000 -- (-1301.265) [-1303.273] (-1301.573) (-1302.760) * (-1305.142) (-1300.230) (-1300.561) [-1299.978] -- 0:00:06
909500 -- (-1303.313) (-1305.158) [-1300.732] (-1301.289) * (-1301.723) [-1305.995] (-1301.275) (-1307.334) -- 0:00:06
910000 -- (-1301.328) [-1300.818] (-1299.849) (-1301.295) * (-1301.711) (-1306.838) [-1299.617] (-1307.009) -- 0:00:06
Average standard deviation of split frequencies: 0.008731
910500 -- (-1300.843) (-1301.794) [-1300.403] (-1301.956) * (-1309.517) (-1305.170) [-1301.179] (-1310.014) -- 0:00:06
911000 -- [-1300.552] (-1307.426) (-1302.663) (-1302.244) * (-1302.773) (-1303.534) [-1302.085] (-1308.733) -- 0:00:06
911500 -- (-1301.089) (-1302.425) [-1302.538] (-1301.821) * (-1304.271) [-1304.355] (-1302.268) (-1304.268) -- 0:00:06
912000 -- (-1302.648) (-1300.696) [-1301.330] (-1305.449) * (-1307.168) (-1299.641) [-1306.266] (-1307.909) -- 0:00:06
912500 -- [-1300.328] (-1301.176) (-1304.259) (-1301.401) * (-1301.973) (-1300.266) (-1301.831) [-1301.786] -- 0:00:06
913000 -- (-1301.629) [-1303.480] (-1301.770) (-1303.720) * (-1301.738) (-1299.745) (-1301.066) [-1301.135] -- 0:00:06
913500 -- [-1299.766] (-1301.357) (-1300.054) (-1301.887) * [-1303.330] (-1302.303) (-1300.145) (-1303.993) -- 0:00:06
914000 -- (-1302.338) (-1301.277) (-1304.107) [-1301.609] * (-1302.176) (-1301.053) [-1302.185] (-1302.786) -- 0:00:06
914500 -- (-1302.562) (-1303.585) (-1304.882) [-1299.872] * [-1305.360] (-1305.090) (-1302.429) (-1304.573) -- 0:00:06
915000 -- (-1301.740) (-1301.476) (-1301.084) [-1302.011] * (-1300.586) [-1300.913] (-1305.795) (-1300.669) -- 0:00:06
Average standard deviation of split frequencies: 0.008781
915500 -- (-1302.057) (-1301.865) (-1300.510) [-1301.293] * (-1303.239) [-1301.508] (-1299.818) (-1303.988) -- 0:00:06
916000 -- (-1301.549) (-1299.983) (-1303.342) [-1300.971] * (-1305.133) (-1304.058) [-1300.872] (-1300.688) -- 0:00:06
916500 -- (-1302.645) (-1300.654) [-1299.722] (-1300.086) * (-1301.719) (-1303.994) (-1299.854) [-1299.646] -- 0:00:06
917000 -- (-1303.154) [-1301.538] (-1300.093) (-1300.579) * (-1304.109) [-1301.139] (-1301.206) (-1302.679) -- 0:00:06
917500 -- (-1302.163) (-1301.437) (-1300.955) [-1301.477] * [-1307.347] (-1300.840) (-1301.296) (-1299.881) -- 0:00:06
918000 -- (-1304.213) (-1302.907) [-1302.676] (-1303.031) * [-1305.795] (-1299.943) (-1304.155) (-1303.127) -- 0:00:06
918500 -- [-1304.208] (-1301.947) (-1302.350) (-1308.598) * (-1302.837) (-1302.051) (-1303.781) [-1300.782] -- 0:00:06
919000 -- (-1300.572) (-1301.800) [-1301.040] (-1303.832) * (-1301.056) [-1300.232] (-1303.567) (-1301.137) -- 0:00:06
919500 -- [-1304.241] (-1306.092) (-1300.287) (-1304.034) * (-1300.671) (-1300.635) [-1302.025] (-1301.665) -- 0:00:06
920000 -- [-1301.887] (-1301.528) (-1300.836) (-1303.742) * (-1300.278) (-1300.754) [-1301.936] (-1301.498) -- 0:00:06
Average standard deviation of split frequencies: 0.008928
920500 -- (-1302.571) (-1302.887) (-1299.873) [-1304.041] * (-1301.296) (-1301.975) [-1300.498] (-1304.004) -- 0:00:06
921000 -- (-1302.533) (-1302.108) [-1301.385] (-1308.458) * (-1304.989) [-1300.461] (-1302.143) (-1303.117) -- 0:00:06
921500 -- (-1304.216) [-1302.745] (-1301.134) (-1301.111) * (-1303.153) (-1299.432) [-1304.489] (-1301.968) -- 0:00:05
922000 -- (-1307.204) (-1302.402) [-1302.234] (-1302.749) * (-1304.034) [-1300.151] (-1301.516) (-1300.677) -- 0:00:05
922500 -- (-1303.380) (-1301.234) [-1303.126] (-1302.322) * (-1301.659) [-1302.030] (-1300.815) (-1302.151) -- 0:00:05
923000 -- (-1302.519) (-1303.909) (-1299.598) [-1305.327] * [-1303.461] (-1304.905) (-1301.417) (-1300.337) -- 0:00:05
923500 -- (-1301.763) (-1302.871) (-1299.959) [-1307.631] * (-1302.059) (-1302.831) (-1300.924) [-1301.230] -- 0:00:05
924000 -- (-1302.176) (-1302.804) (-1300.246) [-1303.418] * (-1302.225) (-1301.093) [-1302.619] (-1300.148) -- 0:00:05
924500 -- (-1301.978) (-1303.084) [-1300.773] (-1303.588) * (-1302.813) [-1303.019] (-1302.184) (-1300.912) -- 0:00:05
925000 -- [-1301.596] (-1302.152) (-1301.194) (-1303.486) * (-1301.510) [-1300.309] (-1302.223) (-1309.697) -- 0:00:05
Average standard deviation of split frequencies: 0.008877
925500 -- (-1301.346) [-1301.340] (-1301.795) (-1302.182) * (-1300.743) (-1300.155) [-1304.316] (-1304.827) -- 0:00:05
926000 -- (-1302.366) (-1304.189) (-1301.168) [-1304.236] * [-1301.049] (-1301.868) (-1300.628) (-1303.072) -- 0:00:05
926500 -- (-1307.557) [-1305.516] (-1304.063) (-1303.432) * (-1300.693) (-1305.439) [-1302.300] (-1301.891) -- 0:00:05
927000 -- (-1302.069) (-1299.920) (-1301.316) [-1302.092] * (-1305.581) (-1304.837) (-1302.829) [-1301.411] -- 0:00:05
927500 -- [-1301.959] (-1302.521) (-1306.082) (-1303.544) * (-1300.936) (-1301.353) (-1300.502) [-1300.809] -- 0:00:05
928000 -- (-1303.102) (-1300.996) (-1306.647) [-1302.448] * (-1302.633) [-1301.225] (-1301.797) (-1302.103) -- 0:00:05
928500 -- (-1302.888) [-1301.003] (-1302.013) (-1304.020) * (-1303.329) (-1303.277) (-1302.038) [-1302.237] -- 0:00:05
929000 -- (-1302.860) (-1305.409) [-1300.702] (-1301.584) * (-1302.775) (-1302.423) (-1301.404) [-1302.453] -- 0:00:05
929500 -- (-1300.606) (-1300.907) [-1300.124] (-1301.216) * (-1301.766) (-1306.278) (-1301.802) [-1300.759] -- 0:00:05
930000 -- (-1302.274) (-1300.249) [-1300.575] (-1300.857) * (-1301.397) (-1302.048) (-1300.341) [-1305.665] -- 0:00:05
Average standard deviation of split frequencies: 0.008927
930500 -- (-1300.514) (-1303.932) [-1304.279] (-1301.576) * [-1302.822] (-1304.681) (-1300.942) (-1302.385) -- 0:00:05
931000 -- (-1301.302) (-1300.153) (-1302.798) [-1301.046] * (-1300.907) [-1300.669] (-1301.237) (-1301.064) -- 0:00:05
931500 -- (-1303.611) [-1299.781] (-1302.475) (-1301.902) * [-1301.071] (-1303.182) (-1302.777) (-1300.886) -- 0:00:05
932000 -- [-1300.340] (-1301.709) (-1303.593) (-1301.964) * (-1301.241) (-1304.642) [-1300.373] (-1301.002) -- 0:00:05
932500 -- (-1301.004) (-1301.994) (-1301.769) [-1300.777] * (-1305.873) (-1301.694) (-1301.198) [-1300.757] -- 0:00:05
933000 -- [-1300.616] (-1304.765) (-1302.231) (-1300.315) * (-1303.791) [-1300.671] (-1300.525) (-1301.255) -- 0:00:05
933500 -- (-1300.051) (-1305.291) (-1301.200) [-1301.076] * (-1303.170) (-1300.008) (-1304.336) [-1300.591] -- 0:00:05
934000 -- [-1301.770] (-1303.525) (-1299.986) (-1301.477) * (-1300.401) [-1299.944] (-1301.335) (-1301.978) -- 0:00:05
934500 -- (-1306.790) (-1302.772) [-1301.154] (-1301.350) * (-1304.529) (-1303.065) [-1302.258] (-1299.672) -- 0:00:04
935000 -- (-1303.383) [-1305.672] (-1301.931) (-1302.986) * [-1302.387] (-1303.831) (-1300.616) (-1300.847) -- 0:00:04
Average standard deviation of split frequencies: 0.008877
935500 -- (-1304.354) [-1303.518] (-1307.889) (-1301.902) * (-1303.515) [-1303.085] (-1301.946) (-1300.875) -- 0:00:04
936000 -- (-1301.417) (-1300.574) [-1300.673] (-1303.216) * [-1300.412] (-1302.011) (-1304.132) (-1300.907) -- 0:00:04
936500 -- [-1304.873] (-1301.382) (-1303.551) (-1303.491) * [-1299.920] (-1302.794) (-1304.846) (-1302.515) -- 0:00:04
937000 -- (-1304.139) (-1306.882) (-1301.440) [-1300.254] * (-1303.474) (-1303.696) (-1300.343) [-1303.203] -- 0:00:04
937500 -- (-1303.124) [-1300.965] (-1302.800) (-1303.542) * (-1301.685) [-1300.704] (-1300.721) (-1303.738) -- 0:00:04
938000 -- (-1302.199) (-1301.129) (-1300.036) [-1303.237] * (-1301.378) (-1302.196) [-1302.042] (-1303.423) -- 0:00:04
938500 -- (-1304.559) [-1301.159] (-1302.422) (-1301.004) * (-1305.201) (-1306.187) [-1302.975] (-1302.176) -- 0:00:04
939000 -- (-1301.305) [-1300.934] (-1302.463) (-1303.722) * [-1299.722] (-1301.318) (-1299.913) (-1301.727) -- 0:00:04
939500 -- [-1301.728] (-1302.951) (-1300.470) (-1300.004) * (-1305.371) (-1302.016) [-1301.613] (-1300.593) -- 0:00:04
940000 -- [-1301.528] (-1300.632) (-1301.715) (-1301.044) * (-1303.068) [-1300.135] (-1300.666) (-1301.828) -- 0:00:04
Average standard deviation of split frequencies: 0.009334
940500 -- (-1300.150) (-1303.009) (-1300.803) [-1303.374] * (-1305.173) [-1300.217] (-1300.471) (-1302.833) -- 0:00:04
941000 -- (-1300.741) (-1301.963) [-1300.794] (-1303.407) * [-1304.065] (-1299.785) (-1300.192) (-1304.003) -- 0:00:04
941500 -- [-1304.330] (-1301.899) (-1302.115) (-1304.602) * (-1304.707) [-1299.763] (-1301.082) (-1303.308) -- 0:00:04
942000 -- (-1306.398) (-1299.921) [-1303.092] (-1301.738) * (-1302.296) [-1300.900] (-1302.238) (-1304.265) -- 0:00:04
942500 -- (-1305.744) (-1301.087) (-1301.622) [-1300.780] * (-1299.976) (-1301.295) [-1300.897] (-1302.617) -- 0:00:04
943000 -- (-1308.275) [-1301.689] (-1302.668) (-1301.473) * (-1300.207) (-1301.929) [-1302.452] (-1303.579) -- 0:00:04
943500 -- [-1301.560] (-1299.590) (-1302.507) (-1302.039) * (-1301.864) (-1302.960) [-1301.343] (-1303.055) -- 0:00:04
944000 -- (-1304.030) [-1300.282] (-1301.787) (-1300.470) * (-1302.141) [-1300.346] (-1303.939) (-1307.412) -- 0:00:04
944500 -- (-1303.002) (-1301.204) [-1304.734] (-1302.429) * (-1301.517) (-1300.707) (-1301.034) [-1300.002] -- 0:00:04
945000 -- (-1303.513) (-1301.626) (-1301.135) [-1302.909] * [-1302.744] (-1300.089) (-1306.254) (-1301.272) -- 0:00:04
Average standard deviation of split frequencies: 0.009312
945500 -- (-1300.055) [-1302.364] (-1301.528) (-1304.873) * [-1302.139] (-1300.410) (-1300.909) (-1301.863) -- 0:00:04
946000 -- (-1300.655) (-1302.413) (-1300.971) [-1301.804] * (-1299.778) (-1300.197) (-1306.149) [-1302.357] -- 0:00:04
946500 -- (-1300.414) (-1302.250) [-1300.331] (-1305.172) * (-1300.589) [-1299.752] (-1304.032) (-1299.820) -- 0:00:04
947000 -- [-1301.712] (-1301.613) (-1300.043) (-1302.994) * (-1300.157) (-1301.934) (-1301.460) [-1301.531] -- 0:00:04
947500 -- (-1300.485) (-1300.257) (-1299.985) [-1300.227] * (-1303.747) (-1301.195) [-1300.769] (-1300.974) -- 0:00:03
948000 -- (-1301.917) (-1300.327) (-1300.563) [-1301.789] * (-1303.592) [-1302.172] (-1300.350) (-1303.367) -- 0:00:03
948500 -- (-1300.627) (-1300.421) (-1302.868) [-1300.696] * (-1301.738) [-1300.281] (-1302.440) (-1301.962) -- 0:00:03
949000 -- (-1300.089) (-1301.352) [-1302.520] (-1301.079) * (-1301.973) [-1300.034] (-1306.271) (-1301.570) -- 0:00:03
949500 -- (-1299.895) (-1303.847) (-1302.328) [-1302.613] * [-1303.754] (-1300.632) (-1303.348) (-1300.238) -- 0:00:03
950000 -- (-1300.657) (-1301.487) (-1300.031) [-1303.768] * (-1302.956) (-1299.619) [-1301.664] (-1301.838) -- 0:00:03
Average standard deviation of split frequencies: 0.009452
950500 -- (-1300.091) (-1306.998) (-1300.923) [-1303.040] * (-1305.202) [-1299.755] (-1303.754) (-1301.809) -- 0:00:03
951000 -- (-1301.386) (-1304.390) [-1299.895] (-1304.852) * [-1301.439] (-1301.298) (-1301.108) (-1310.405) -- 0:00:03
951500 -- (-1303.223) [-1303.368] (-1299.676) (-1300.720) * (-1305.524) (-1300.056) (-1302.602) [-1302.968] -- 0:00:03
952000 -- (-1303.278) (-1301.460) [-1300.714] (-1300.782) * (-1304.331) (-1302.110) [-1300.754] (-1300.896) -- 0:00:03
952500 -- (-1300.735) (-1300.042) [-1303.772] (-1302.954) * (-1305.245) (-1300.626) (-1301.941) [-1301.143] -- 0:00:03
953000 -- (-1302.695) (-1300.029) (-1300.379) [-1303.298] * (-1303.942) (-1303.082) (-1301.828) [-1303.256] -- 0:00:03
953500 -- (-1303.307) [-1299.710] (-1301.120) (-1300.399) * (-1299.887) (-1300.185) (-1301.976) [-1301.730] -- 0:00:03
954000 -- (-1302.221) (-1306.391) (-1301.979) [-1302.820] * (-1300.429) [-1300.760] (-1299.741) (-1304.548) -- 0:00:03
954500 -- (-1301.702) (-1304.937) (-1303.094) [-1300.421] * (-1300.958) [-1299.696] (-1299.980) (-1301.959) -- 0:00:03
955000 -- (-1301.883) (-1300.625) [-1300.772] (-1303.503) * (-1300.959) [-1299.753] (-1302.090) (-1301.946) -- 0:00:03
Average standard deviation of split frequencies: 0.009400
955500 -- (-1306.239) [-1302.265] (-1300.898) (-1301.930) * (-1301.263) [-1301.816] (-1302.007) (-1307.259) -- 0:00:03
956000 -- (-1302.665) [-1301.589] (-1304.892) (-1306.416) * (-1301.413) [-1300.705] (-1304.852) (-1306.801) -- 0:00:03
956500 -- (-1301.870) (-1303.198) [-1303.065] (-1302.744) * (-1302.932) [-1300.243] (-1301.067) (-1301.330) -- 0:00:03
957000 -- (-1303.253) [-1300.000] (-1302.367) (-1299.638) * (-1302.426) [-1299.933] (-1304.349) (-1305.074) -- 0:00:03
957500 -- (-1303.189) (-1300.100) (-1302.111) [-1299.739] * (-1302.119) (-1300.646) [-1303.659] (-1309.582) -- 0:00:03
958000 -- (-1305.567) [-1301.128] (-1303.588) (-1300.665) * [-1304.322] (-1300.652) (-1305.261) (-1305.548) -- 0:00:03
958500 -- (-1304.508) (-1299.742) (-1305.282) [-1303.005] * (-1307.280) [-1302.047] (-1301.748) (-1306.023) -- 0:00:03
959000 -- (-1301.570) [-1300.298] (-1300.321) (-1301.442) * (-1306.371) (-1301.118) (-1300.144) [-1300.683] -- 0:00:03
959500 -- (-1307.977) (-1299.949) [-1299.993] (-1301.298) * (-1305.307) (-1301.913) [-1300.690] (-1300.854) -- 0:00:03
960000 -- (-1303.685) (-1302.834) (-1300.286) [-1300.474] * (-1303.074) [-1300.649] (-1300.942) (-1301.808) -- 0:00:03
Average standard deviation of split frequencies: 0.009231
960500 -- (-1302.275) (-1302.826) [-1301.375] (-1301.809) * (-1300.691) (-1310.006) (-1300.835) [-1300.764] -- 0:00:03
961000 -- (-1301.632) (-1304.230) [-1301.130] (-1300.042) * (-1302.646) (-1299.988) (-1299.963) [-1299.358] -- 0:00:02
961500 -- [-1302.473] (-1306.194) (-1300.415) (-1302.015) * (-1302.013) (-1301.472) [-1299.619] (-1300.340) -- 0:00:02
962000 -- [-1304.037] (-1306.793) (-1300.089) (-1302.934) * (-1302.376) (-1304.509) [-1300.571] (-1306.424) -- 0:00:02
962500 -- (-1305.615) [-1302.338] (-1300.760) (-1302.025) * (-1301.055) (-1301.913) (-1299.733) [-1301.248] -- 0:00:02
963000 -- (-1301.554) (-1301.692) (-1302.805) [-1304.679] * [-1302.412] (-1301.672) (-1300.091) (-1302.962) -- 0:00:02
963500 -- (-1303.362) (-1300.357) (-1304.568) [-1301.676] * (-1308.232) (-1302.177) (-1300.986) [-1301.332] -- 0:00:02
964000 -- [-1300.608] (-1303.749) (-1306.400) (-1301.047) * (-1309.117) [-1301.551] (-1302.256) (-1302.316) -- 0:00:02
964500 -- (-1303.523) (-1303.719) (-1306.508) [-1300.818] * (-1309.765) (-1300.992) [-1303.144] (-1301.153) -- 0:00:02
965000 -- (-1301.472) (-1300.520) [-1300.477] (-1301.739) * (-1305.644) [-1301.797] (-1304.940) (-1304.302) -- 0:00:02
Average standard deviation of split frequencies: 0.009394
965500 -- (-1303.461) (-1303.714) [-1300.588] (-1307.000) * (-1301.339) (-1302.971) (-1302.596) [-1307.218] -- 0:00:02
966000 -- (-1302.987) (-1303.573) [-1300.291] (-1301.661) * (-1301.265) (-1302.919) (-1306.133) [-1300.172] -- 0:00:02
966500 -- (-1300.546) [-1302.984] (-1300.702) (-1309.656) * (-1300.244) (-1302.949) (-1306.148) [-1300.374] -- 0:00:02
967000 -- (-1300.856) (-1302.002) (-1302.806) [-1300.378] * (-1300.066) [-1300.900] (-1302.869) (-1299.754) -- 0:00:02
967500 -- (-1301.678) [-1301.687] (-1304.897) (-1300.539) * (-1303.391) [-1301.752] (-1309.197) (-1300.031) -- 0:00:02
968000 -- (-1301.097) (-1301.126) [-1307.533] (-1300.376) * (-1301.637) (-1300.976) (-1300.489) [-1299.977] -- 0:00:02
968500 -- (-1303.097) (-1301.584) [-1301.453] (-1300.372) * [-1302.369] (-1302.178) (-1302.161) (-1302.149) -- 0:00:02
969000 -- (-1301.758) (-1303.828) [-1304.832] (-1300.705) * (-1306.685) (-1301.290) [-1304.464] (-1304.821) -- 0:00:02
969500 -- (-1304.083) (-1301.082) [-1300.221] (-1300.608) * (-1302.045) (-1307.539) (-1302.837) [-1303.803] -- 0:00:02
970000 -- [-1300.133] (-1300.950) (-1300.450) (-1303.955) * [-1302.600] (-1304.992) (-1304.493) (-1302.495) -- 0:00:02
Average standard deviation of split frequencies: 0.009167
970500 -- [-1300.915] (-1300.535) (-1299.968) (-1300.448) * (-1304.014) (-1303.880) (-1304.073) [-1307.340] -- 0:00:02
971000 -- (-1300.254) (-1300.430) (-1301.134) [-1302.213] * [-1300.123] (-1301.603) (-1303.129) (-1303.612) -- 0:00:02
971500 -- (-1303.544) (-1304.920) (-1301.901) [-1300.450] * (-1302.494) [-1301.703] (-1300.133) (-1302.311) -- 0:00:02
972000 -- (-1304.181) [-1301.261] (-1302.411) (-1300.264) * (-1302.336) (-1300.744) [-1301.425] (-1301.742) -- 0:00:02
972500 -- (-1301.419) [-1302.331] (-1302.586) (-1300.716) * (-1300.693) (-1302.646) (-1302.209) [-1300.560] -- 0:00:02
973000 -- (-1300.583) [-1301.685] (-1302.956) (-1301.700) * [-1300.916] (-1303.147) (-1303.937) (-1300.321) -- 0:00:02
973500 -- (-1301.551) [-1304.265] (-1301.133) (-1301.267) * (-1300.223) (-1301.151) (-1309.372) [-1300.796] -- 0:00:02
974000 -- (-1302.370) (-1303.764) (-1306.415) [-1304.236] * [-1299.769] (-1302.198) (-1310.281) (-1300.771) -- 0:00:01
974500 -- [-1303.046] (-1301.951) (-1300.963) (-1301.316) * [-1302.105] (-1300.682) (-1302.365) (-1300.911) -- 0:00:01
975000 -- (-1302.612) (-1307.564) (-1303.826) [-1301.291] * (-1302.991) [-1304.162] (-1303.968) (-1306.281) -- 0:00:01
Average standard deviation of split frequencies: 0.009086
975500 -- (-1303.703) (-1302.126) [-1301.969] (-1301.104) * (-1304.245) [-1302.448] (-1302.474) (-1304.299) -- 0:00:01
976000 -- [-1301.841] (-1302.837) (-1300.560) (-1299.925) * (-1301.289) [-1302.967] (-1301.993) (-1306.521) -- 0:00:01
976500 -- (-1301.889) [-1304.020] (-1304.926) (-1303.490) * (-1301.332) (-1300.907) (-1304.550) [-1300.446] -- 0:00:01
977000 -- (-1303.324) (-1304.373) [-1300.991] (-1305.342) * (-1303.773) (-1301.299) [-1303.251] (-1299.816) -- 0:00:01
977500 -- (-1304.749) [-1302.849] (-1301.452) (-1299.911) * (-1300.423) [-1303.118] (-1301.587) (-1300.226) -- 0:00:01
978000 -- (-1304.081) [-1300.916] (-1300.910) (-1301.411) * (-1302.747) [-1301.275] (-1300.902) (-1303.519) -- 0:00:01
978500 -- (-1303.303) (-1301.989) [-1300.272] (-1303.003) * (-1307.127) (-1299.495) (-1300.374) [-1303.696] -- 0:00:01
979000 -- (-1305.813) (-1302.273) [-1301.186] (-1300.461) * [-1300.568] (-1307.666) (-1304.663) (-1300.821) -- 0:00:01
979500 -- (-1302.879) (-1302.920) (-1300.842) [-1300.107] * (-1300.419) (-1304.650) (-1301.660) [-1300.128] -- 0:00:01
980000 -- (-1301.642) (-1302.847) [-1301.779] (-1300.186) * (-1303.188) [-1303.912] (-1300.977) (-1300.628) -- 0:00:01
Average standard deviation of split frequencies: 0.009283
980500 -- (-1300.525) (-1301.248) [-1301.214] (-1301.210) * (-1300.525) (-1303.708) [-1301.001] (-1300.630) -- 0:00:01
981000 -- (-1300.190) (-1301.281) [-1303.929] (-1304.083) * (-1303.283) (-1304.300) (-1303.627) [-1301.748] -- 0:00:01
981500 -- [-1301.216] (-1302.306) (-1303.561) (-1306.443) * (-1300.219) (-1303.277) [-1304.010] (-1302.026) -- 0:00:01
982000 -- [-1301.931] (-1303.355) (-1302.113) (-1302.519) * (-1300.244) (-1301.428) (-1301.501) [-1305.695] -- 0:00:01
982500 -- (-1301.243) (-1303.879) [-1301.301] (-1302.630) * (-1300.721) [-1300.474] (-1300.023) (-1302.229) -- 0:00:01
983000 -- (-1302.039) (-1302.571) (-1302.768) [-1302.706] * (-1300.890) [-1302.744] (-1301.080) (-1302.514) -- 0:00:01
983500 -- (-1304.619) (-1301.017) [-1302.736] (-1301.144) * (-1299.900) (-1301.653) [-1302.303] (-1301.188) -- 0:00:01
984000 -- [-1301.661] (-1301.123) (-1307.478) (-1301.055) * (-1304.606) (-1302.482) [-1302.525] (-1301.304) -- 0:00:01
984500 -- (-1312.106) (-1301.321) (-1302.158) [-1302.855] * (-1304.283) [-1302.086] (-1300.890) (-1302.189) -- 0:00:01
985000 -- [-1300.599] (-1301.855) (-1301.390) (-1300.716) * (-1301.579) (-1303.546) (-1301.581) [-1301.517] -- 0:00:01
Average standard deviation of split frequencies: 0.009144
985500 -- (-1302.786) [-1300.983] (-1301.260) (-1300.323) * (-1301.527) (-1304.743) (-1301.565) [-1300.974] -- 0:00:01
986000 -- [-1302.621] (-1300.724) (-1304.953) (-1300.023) * (-1301.168) (-1299.802) [-1303.911] (-1306.604) -- 0:00:01
986500 -- (-1305.395) (-1302.888) [-1301.217] (-1300.074) * (-1304.235) (-1299.940) (-1301.211) [-1301.181] -- 0:00:01
987000 -- [-1308.408] (-1302.193) (-1301.466) (-1300.250) * (-1302.243) (-1303.850) (-1304.694) [-1301.347] -- 0:00:00
987500 -- (-1305.065) (-1302.123) (-1299.957) [-1301.328] * [-1304.415] (-1301.543) (-1302.676) (-1300.701) -- 0:00:00
988000 -- (-1302.823) [-1301.234] (-1304.509) (-1301.792) * [-1300.827] (-1303.300) (-1301.700) (-1300.558) -- 0:00:00
988500 -- (-1300.784) [-1302.336] (-1301.188) (-1300.690) * (-1303.087) (-1305.954) [-1302.115] (-1299.505) -- 0:00:00
989000 -- (-1302.344) (-1301.399) (-1300.379) [-1304.628] * (-1304.030) (-1301.200) [-1302.055] (-1300.355) -- 0:00:00
989500 -- (-1300.468) (-1300.350) [-1301.343] (-1303.534) * (-1303.128) [-1300.333] (-1301.385) (-1302.167) -- 0:00:00
990000 -- [-1300.724] (-1302.639) (-1302.332) (-1301.109) * (-1302.102) (-1301.386) [-1301.901] (-1300.917) -- 0:00:00
Average standard deviation of split frequencies: 0.008952
990500 -- (-1302.245) (-1303.584) [-1300.529] (-1301.901) * (-1303.824) (-1301.280) (-1301.621) [-1300.975] -- 0:00:00
991000 -- (-1301.508) [-1300.737] (-1301.376) (-1303.042) * (-1301.772) [-1299.938] (-1302.032) (-1300.155) -- 0:00:00
991500 -- (-1302.544) [-1300.234] (-1299.760) (-1302.669) * (-1301.715) (-1300.036) [-1300.314] (-1299.666) -- 0:00:00
992000 -- [-1299.935] (-1300.865) (-1301.884) (-1301.793) * (-1301.028) [-1300.894] (-1300.658) (-1305.531) -- 0:00:00
992500 -- (-1301.945) (-1301.149) (-1304.180) [-1301.214] * (-1304.360) (-1302.024) (-1306.413) [-1302.330] -- 0:00:00
993000 -- (-1302.594) [-1299.926] (-1302.757) (-1300.447) * (-1299.791) (-1301.298) [-1301.774] (-1305.154) -- 0:00:00
993500 -- (-1301.501) (-1302.478) [-1303.379] (-1302.141) * [-1299.703] (-1300.792) (-1304.099) (-1303.707) -- 0:00:00
994000 -- (-1301.821) [-1302.231] (-1301.879) (-1302.704) * (-1302.200) [-1300.745] (-1303.766) (-1301.774) -- 0:00:00
994500 -- (-1300.764) [-1300.911] (-1302.512) (-1302.463) * (-1301.818) [-1302.985] (-1302.797) (-1305.856) -- 0:00:00
995000 -- (-1301.332) (-1304.084) [-1301.334] (-1304.020) * (-1301.129) (-1302.236) (-1301.306) [-1301.635] -- 0:00:00
Average standard deviation of split frequencies: 0.008866
995500 -- (-1301.149) [-1300.762] (-1301.122) (-1300.935) * (-1300.210) [-1301.697] (-1303.313) (-1300.409) -- 0:00:00
996000 -- (-1303.721) (-1303.314) [-1303.387] (-1302.836) * (-1305.618) (-1305.011) (-1302.766) [-1302.006] -- 0:00:00
996500 -- (-1301.547) (-1304.252) (-1302.700) [-1300.631] * (-1301.783) (-1305.086) (-1306.919) [-1303.987] -- 0:00:00
997000 -- (-1302.129) (-1301.541) [-1300.041] (-1300.710) * (-1300.903) (-1301.068) [-1302.872] (-1301.348) -- 0:00:00
997500 -- (-1304.042) (-1302.186) (-1301.860) [-1301.281] * (-1302.795) (-1301.244) (-1305.530) [-1300.532] -- 0:00:00
998000 -- (-1301.694) (-1300.981) (-1299.625) [-1300.458] * (-1301.202) [-1306.929] (-1300.399) (-1301.074) -- 0:00:00
998500 -- (-1300.898) (-1302.750) [-1300.527] (-1300.970) * (-1302.351) (-1306.385) [-1301.654] (-1300.170) -- 0:00:00
999000 -- (-1301.826) (-1301.142) [-1301.595] (-1302.298) * (-1302.134) (-1299.960) [-1300.738] (-1302.862) -- 0:00:00
999500 -- (-1302.240) [-1303.323] (-1300.350) (-1303.796) * (-1300.565) (-1301.378) [-1302.018] (-1302.402) -- 0:00:00
1000000 -- (-1301.430) (-1300.747) [-1301.309] (-1303.636) * (-1303.414) (-1305.921) (-1301.086) [-1302.019] -- 0:00:00
Average standard deviation of split frequencies: 0.008699
Analysis completed in 1 mins 16 seconds
Analysis used 74.26 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1299.34
Likelihood of best state for "cold" chain of run 2 was -1299.34
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 63 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.0 % ( 33 %) Dirichlet(Pi{all})
27.9 % ( 27 %) Slider(Pi{all})
78.6 % ( 57 %) Multiplier(Alpha{1,2})
77.7 % ( 44 %) Multiplier(Alpha{3})
17.5 % ( 28 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.2 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
25.6 % ( 26 %) Dirichlet(Pi{all})
27.6 % ( 26 %) Slider(Pi{all})
78.8 % ( 52 %) Multiplier(Alpha{1,2})
77.8 % ( 40 %) Multiplier(Alpha{3})
17.9 % ( 29 %) Slider(Pinvar{all})
98.5 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 30 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166925 0.82 0.67
3 | 165762 167029 0.84
4 | 166611 166778 166895
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167108 0.82 0.67
3 | 166656 166274 0.84
4 | 166905 166180 166877
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1301.02
| 1 2 2 |
| 1 |
| 1 1 1 2 |
| 1 112 1 1|
| 1 2 1 2 211 |
| 2 1 1 2 1 1 21 * 1 * 21 1 2 |
| 2 11 1 2 1 2 1 1 1 121 1 1 |
| 1 2 21 1 2 2 2212 2 2 11 2|
|2 1 21 2 1 22 2 2 2 22 1 2 |
| 21 22 2 2 2 1 21 1 11 |
| 2 11 1 2 2 |
|1 * 2 2 2 2 1 2 1 2 |
| 2 2 2 |
| |
| 1 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1302.67
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1301.04 -1306.00
2 -1301.12 -1305.73
--------------------------------------
TOTAL -1301.08 -1305.87
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889927 0.088753 0.393269 1.494053 0.856793 1342.80 1421.13 1.001
r(A<->C){all} 0.158725 0.017795 0.000237 0.428187 0.121053 156.31 248.07 1.000
r(A<->G){all} 0.174437 0.021423 0.000061 0.473855 0.135058 136.14 188.60 1.002
r(A<->T){all} 0.174185 0.021579 0.000139 0.477086 0.136118 197.38 228.67 1.000
r(C<->G){all} 0.173757 0.019647 0.000025 0.455298 0.136194 171.36 187.44 1.004
r(C<->T){all} 0.163110 0.019346 0.000120 0.437040 0.128977 205.78 220.53 1.013
r(G<->T){all} 0.155786 0.016999 0.000018 0.430003 0.122140 219.66 316.17 1.001
pi(A){all} 0.187895 0.000157 0.163266 0.212162 0.187467 1100.44 1160.04 1.000
pi(C){all} 0.305586 0.000225 0.277459 0.334987 0.305227 1274.51 1286.76 1.000
pi(G){all} 0.320912 0.000226 0.291273 0.349492 0.320503 1008.92 1097.89 1.001
pi(T){all} 0.185607 0.000155 0.159143 0.207983 0.185172 1231.94 1243.47 1.000
alpha{1,2} 0.405845 0.206631 0.000131 1.287060 0.253169 1137.49 1217.86 1.000
alpha{3} 0.458459 0.239353 0.000316 1.448357 0.298594 1379.71 1408.28 1.000
pinvar{all} 0.998445 0.000003 0.995200 1.000000 0.999000 1209.59 1280.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- ....**
9 -- .*..*.
10 -- ...*.*
11 -- .*...*
12 -- .*.*..
13 -- ...**.
14 -- ..*.*.
15 -- .*.***
16 -- .**.**
17 -- ..****
18 -- ..*..*
19 -- .**...
20 -- ..**..
21 -- .***.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 451 0.150233 0.007066 0.145237 0.155230 2
8 445 0.148235 0.025910 0.129913 0.166556 2
9 442 0.147235 0.007537 0.141905 0.152565 2
10 439 0.146236 0.004240 0.143238 0.149234 2
11 437 0.145570 0.005182 0.141905 0.149234 2
12 437 0.145570 0.002355 0.143904 0.147235 2
13 435 0.144903 0.011777 0.136576 0.153231 2
14 434 0.144570 0.011306 0.136576 0.152565 2
15 429 0.142905 0.000471 0.142572 0.143238 2
16 428 0.142572 0.009422 0.135909 0.149234 2
17 425 0.141572 0.001413 0.140573 0.142572 2
18 423 0.140906 0.011777 0.132578 0.149234 2
19 421 0.140240 0.008009 0.134577 0.145903 2
20 406 0.135243 0.019786 0.121252 0.149234 2
21 401 0.133578 0.004240 0.130580 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099554 0.009938 0.000012 0.294350 0.070388 1.000 2
length{all}[2] 0.100438 0.009576 0.000023 0.292109 0.069909 1.000 2
length{all}[3] 0.096111 0.008558 0.000036 0.285069 0.067545 1.000 2
length{all}[4] 0.099930 0.010037 0.000017 0.297162 0.069090 1.000 2
length{all}[5] 0.100508 0.009941 0.000201 0.298516 0.070458 1.000 2
length{all}[6] 0.096698 0.009542 0.000029 0.290301 0.064679 1.000 2
length{all}[7] 0.097761 0.010966 0.000030 0.285072 0.069048 0.998 2
length{all}[8] 0.093568 0.008816 0.000073 0.287755 0.064966 1.003 2
length{all}[9] 0.095589 0.008695 0.000038 0.288625 0.066835 1.002 2
length{all}[10] 0.091508 0.007752 0.000308 0.269486 0.065663 0.998 2
length{all}[11] 0.098959 0.009728 0.000132 0.291208 0.068941 1.000 2
length{all}[12] 0.099564 0.011032 0.000209 0.326986 0.065835 1.000 2
length{all}[13] 0.093494 0.008593 0.000063 0.269682 0.065490 1.001 2
length{all}[14] 0.092019 0.008596 0.000015 0.277751 0.063609 0.998 2
length{all}[15] 0.094974 0.008344 0.000005 0.286602 0.064050 0.999 2
length{all}[16] 0.103406 0.009235 0.000052 0.297554 0.077123 1.009 2
length{all}[17] 0.099520 0.010025 0.000045 0.268346 0.067908 0.998 2
length{all}[18] 0.101546 0.010388 0.000375 0.296860 0.077152 1.000 2
length{all}[19] 0.098108 0.008795 0.000123 0.298900 0.069938 1.005 2
length{all}[20] 0.102018 0.008948 0.000649 0.310242 0.069575 1.002 2
length{all}[21] 0.100904 0.010693 0.000057 0.310632 0.068369 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008699
Maximum standard deviation of split frequencies = 0.025910
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 969
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
18 ambiguity characters in seq. 1
18 ambiguity characters in seq. 2
18 ambiguity characters in seq. 3
18 ambiguity characters in seq. 4
9 ambiguity characters in seq. 5
9 ambiguity characters in seq. 6
6 sites are removed. 1 2 3 321 322 323
Sequences read..
Counting site patterns.. 0:00
Compressing, 60 patterns at 317 / 317 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 60 patterns at 317 / 317 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
58560 bytes for conP
5280 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.040916 0.038820 0.106533 0.056419 0.050049 0.086511 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1353.681271
Iterating by ming2
Initial: fx= 1353.681271
x= 0.04092 0.03882 0.10653 0.05642 0.05005 0.08651 0.30000 1.30000
1 h-m-p 0.0000 0.0001 758.6239 ++ 1281.626363 m 0.0001 13 | 1/8
2 h-m-p 0.0012 0.0058 58.4592 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 697.3211 ++ 1278.350561 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0099 37.1468 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 623.1013 ++ 1266.920496 m 0.0000 74 | 3/8
6 h-m-p 0.0005 0.0120 30.5965 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 539.7100 ++ 1260.933727 m 0.0000 105 | 4/8
8 h-m-p 0.0004 0.0158 23.2571 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 440.0330 ++ 1241.970831 m 0.0001 135 | 5/8
10 h-m-p 0.0021 0.0271 14.2347 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 312.4297 ++ 1235.589829 m 0.0001 167 | 6/8
12 h-m-p 0.1259 8.0000 0.0000 +++ 1235.589829 m 8.0000 179 | 6/8
13 h-m-p 0.5584 8.0000 0.0001 ++ 1235.589829 m 8.0000 192 | 6/8
14 h-m-p 0.0160 8.0000 0.9066 +++++ 1235.589803 m 8.0000 208 | 6/8
15 h-m-p 1.6000 8.0000 2.2435 ++ 1235.589793 m 8.0000 221 | 6/8
16 h-m-p 1.6000 8.0000 5.5709 ++ 1235.589789 m 8.0000 232 | 6/8
17 h-m-p 1.6000 8.0000 0.0248 ++ 1235.589789 m 8.0000 243 | 6/8
18 h-m-p 0.9944 8.0000 0.1994 -------Y 1235.589789 0 0.0000 263 | 6/8
19 h-m-p 0.0160 8.0000 109.1836 +++++ 1235.589787 m 8.0000 279 | 6/8
20 h-m-p 1.6000 8.0000 61.1788 -----------C 1235.589787 0 0.0000 301 | 6/8
21 h-m-p 0.7504 8.0000 0.0000 --Y 1235.589787 0 0.0117 314
Out..
lnL = -1235.589787
315 lfun, 315 eigenQcodon, 1890 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.047817 0.093427 0.057819 0.037250 0.017261 0.048355 740.081813 0.683944 0.106507
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.039859
np = 9
lnL0 = -1323.835058
Iterating by ming2
Initial: fx= 1323.835058
x= 0.04782 0.09343 0.05782 0.03725 0.01726 0.04836 740.08181 0.68394 0.10651
1 h-m-p 0.0000 0.0001 667.7362 ++ 1295.611878 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0004 304.3248 ++ 1267.148002 m 0.0004 26 | 2/9
3 h-m-p 0.0002 0.0009 71.1686 ++ 1263.011180 m 0.0009 38 | 3/9
4 h-m-p 0.0000 0.0001 617.1747 ++ 1243.992421 m 0.0001 50 | 4/9
5 h-m-p 0.0006 0.0029 15.2533 -----------.. | 4/9
6 h-m-p 0.0000 0.0000 536.1801 ++ 1238.091736 m 0.0000 83 | 5/9
7 h-m-p 0.0037 0.2960 2.4095 ------------.. | 5/9
8 h-m-p 0.0000 0.0000 445.2393 ++ 1237.863334 m 0.0000 117 | 6/9
9 h-m-p 0.0003 0.1436 4.8055 ----------.. | 6/9
10 h-m-p 0.0000 0.0000 314.0202 ++ 1235.589924 m 0.0000 149 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 ++ 1235.589924 m 8.0000 161 | 6/9
12 h-m-p 0.0000 0.0000 0.0001
h-m-p: 2.36510236e-15 1.18255118e-14 1.14952362e-04 1235.589924
.. | 6/9
13 h-m-p 0.0160 8.0000 0.0003 +++++ 1235.589923 m 8.0000 190 | 6/9
14 h-m-p 0.0092 3.7630 0.2213 +++++ 1235.589853 m 3.7630 208 | 7/9
15 h-m-p 1.6000 8.0000 0.0000 +Y 1235.589853 0 6.4000 224 | 7/9
16 h-m-p 0.0005 0.2351 2.2425 -Y 1235.589853 0 0.0000 239 | 7/9
17 h-m-p 1.6000 8.0000 0.0000 N 1235.589853 0 1.6000 251 | 7/9
18 h-m-p 0.0160 8.0000 0.0000 Y 1235.589853 0 0.0040 265
Out..
lnL = -1235.589853
266 lfun, 798 eigenQcodon, 3192 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.096989 0.079178 0.097643 0.091022 0.010507 0.024943 740.081812 0.996546 0.210165 0.483503 639.111329
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000224
np = 11
lnL0 = -1287.379699
Iterating by ming2
Initial: fx= 1287.379699
x= 0.09699 0.07918 0.09764 0.09102 0.01051 0.02494 740.08181 0.99655 0.21016 0.48350 639.11133
1 h-m-p 0.0000 0.0002 126.6753 +++ 1284.212775 m 0.0002 17 | 1/11
2 h-m-p 0.0005 0.0276 37.1539 +++ 1250.660332 m 0.0276 32 | 2/11
3 h-m-p 0.0000 0.0000 17716.0298 ++ 1250.480110 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0001 1870.0019 ++ 1248.592083 m 0.0001 60 | 4/11
5 h-m-p 0.0000 0.0000 5869.3252 ++ 1246.727464 m 0.0000 74 | 5/11
6 h-m-p 0.0002 0.0169 884.0030 ++YCYC 1240.835586 3 0.0025 94 | 5/11
7 h-m-p 0.0251 0.1256 3.6286 ++ 1239.549515 m 0.1256 108 | 6/11
8 h-m-p 0.3125 8.0000 0.8263 ---------------.. | 6/11
9 h-m-p 0.0000 0.0043 21.0842 +++++ 1235.589788 m 0.0043 157 | 7/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 1235.589788 m 8.0000 171 | 7/11
11 h-m-p 0.3701 8.0000 0.0000 +++ 1235.589788 m 8.0000 190 | 7/11
12 h-m-p 0.0160 8.0000 0.0421 +++++ 1235.589788 m 8.0000 211 | 7/11
13 h-m-p 0.2403 8.0000 1.4021 +++ 1235.589787 m 8.0000 230 | 7/11
14 h-m-p 1.6000 8.0000 2.8320 --------C 1235.589787 0 0.0000 252 | 7/11
15 h-m-p 1.6000 8.0000 0.0000 Y 1235.589787 0 0.4000 266 | 7/11
16 h-m-p 1.6000 8.0000 0.0000 -------Y 1235.589787 0 0.0000 291
Out..
lnL = -1235.589787
292 lfun, 1168 eigenQcodon, 5256 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1235.582393 S = -1235.582313 -0.000031
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 60 patterns 0:02
did 20 / 60 patterns 0:02
did 30 / 60 patterns 0:03
did 40 / 60 patterns 0:03
did 50 / 60 patterns 0:03
did 60 / 60 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080862 0.080551 0.075116 0.018006 0.085730 0.032803 740.108352 0.870281 1.628095
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.042289
np = 9
lnL0 = -1347.698231
Iterating by ming2
Initial: fx= 1347.698231
x= 0.08086 0.08055 0.07512 0.01801 0.08573 0.03280 740.10835 0.87028 1.62809
1 h-m-p 0.0000 0.0001 702.7335 ++ 1317.160436 m 0.0001 14 | 1/9
2 h-m-p 0.0009 0.0210 42.0270 +++ 1301.057799 m 0.0210 27 | 2/9
3 h-m-p 0.0002 0.0012 314.7827 ++ 1263.949060 m 0.0012 39 | 3/9
4 h-m-p 0.0000 0.0002 1028.9514 ++ 1257.122055 m 0.0002 51 | 4/9
5 h-m-p 0.0001 0.0003 1738.1716 ++ 1243.247096 m 0.0003 63 | 5/9
6 h-m-p 0.0004 0.0022 402.4693 +
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
+ 1242.023990 m 0.0022 75
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.169719e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
| 6/9
7 h-m-p 0.0295 3.2589 29.6795
QuantileBeta(0.15, 0.00500, 3.17525) = 7.652709e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51782) = 1.010107e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.35346) = 1.097647e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.31237) = 1.121930e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30210) = 1.128168e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29953) = 1.129738e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29889) = 1.130131e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29873) = 1.130230e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29869) = 1.130254e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130260e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.169719e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
| 6/9
8 h-m-p 0.0000 0.0001 312.9832
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
+ 1235.590049 m 0.0001 111
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.169719e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
| 7/9
9 h-m-p 0.0257 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
N 1235.590049 0 0.0064 123
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.130262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29868) = 1.169719e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29880) = 1.130186e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29855) = 1.130339e-160 2000 rounds
| 6/9
10 h-m-p 0.0160 8.0000 0.0063
QuantileBeta(0.15, 0.00500, 2.29877) = 1.134143e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29904) = 1.146676e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136098e-160 2000 rounds
C 1235.590049 0 0.0160 137
QuantileBeta(0.15, 0.00500, 2.29877) = 1.134143e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29877) = 1.134143e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29877) = 1.134143e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29877) = 1.134143e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29877) = 1.134143e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29877) = 1.134143e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29877) = 1.134143e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29877) = 1.134143e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29889) = 1.134067e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29864) = 1.134220e-160 2000 rounds
| 6/9
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29878) = 1.134900e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29884) = 1.137977e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29885) = 1.138737e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
N 1235.590049 0 4.0000 153
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29894) = 1.135959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29869) = 1.136112e-160 2000 rounds
| 6/9
12 h-m-p 0.5847 2.9237 0.0001
QuantileBeta(0.15, 0.00500, 2.29878) = 1.134879e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29880) = 1.135746e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.135963e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136018e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136031e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136035e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29894) = 1.135959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29869) = 1.136112e-160 2000 rounds
| 6/9
13 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29881) = 1.139148e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.137416e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136180e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136072e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136045e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136038e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29894) = 1.135959e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29869) = 1.136112e-160 2000 rounds
| 6/9
14 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29881) = 1.139148e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.137416e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136180e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136072e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136045e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136038e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
Out..
lnL = -1235.590049
235 lfun, 2585 eigenQcodon, 14100 P(t)
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29881) = 1.136036e-160 2000 rounds
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.098138 0.047474 0.105618 0.035190 0.024991 0.097116 740.108263 0.900000 0.313172 1.683545 586.785468
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000492
np = 11
lnL0 = -1265.723980
Iterating by ming2
Initial: fx= 1265.723980
x= 0.09814 0.04747 0.10562 0.03519 0.02499 0.09712 740.10826 0.90000 0.31317 1.68354 586.78547
1 h-m-p 0.0000 0.0004 244.7144 ++YCYYYCCC 1246.597023 7 0.0003 40 | 0/11
2 h-m-p 0.0002 0.0011 39.1765 ++ 1244.904770 m 0.0011 65 | 1/11
3 h-m-p 0.0000 0.0000 4156.9725 ++ 1244.072215 m 0.0000 90 | 2/11
4 h-m-p 0.0004 0.0021 56.3874 ++ 1239.633700 m 0.0021 114 | 3/11
5 h-m-p 0.0008 0.0041 6.3528 ++ 1239.393036 m 0.0041 137 | 4/11
6 h-m-p 0.0001 0.0005 60.5248 ++ 1237.804457 m 0.0005 159 | 5/11
7 h-m-p 0.0035 0.0256 8.6204 ++ 1237.127222 m 0.0256 180 | 6/11
8 h-m-p 0.0260 1.1249 1.5614 -------------.. | 6/11
9 h-m-p 0.0000 0.0001 135.3969 ++ 1235.589789 m 0.0001 230 | 7/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 1235.589789 m 8.0000 249 | 7/11
11 h-m-p 0.0160 8.0000 0.0049 +++++ 1235.589787 m 8.0000 270 | 7/11
12 h-m-p 1.6000 8.0000 0.0047 ++ 1235.589787 m 8.0000 288 | 7/11
13 h-m-p 1.6000 8.0000 0.0215 ++ 1235.589787 m 8.0000 306 | 7/11
14 h-m-p 1.6000 8.0000 0.0248 ++ 1235.589787 m 8.0000 324 | 7/11
15 h-m-p 1.6000 8.0000 0.0969 ++ 1235.589787 m 8.0000 342 | 7/11
16 h-m-p 1.1180 5.5898 0.1203 ++ 1235.589787 m 5.5898 360 | 8/11
17 h-m-p 0.6650 8.0000 0.8629 ---Y 1235.589787 0 0.0026 381 | 8/11
18 h-m-p 1.1344 8.0000 0.0020 --Y 1235.589787 0 0.0177 400 | 8/11
19 h-m-p 0.3640 8.0000 0.0001 Y 1235.589787 0 0.3640 417 | 8/11
20 h-m-p 1.6000 8.0000 0.0000 C 1235.589787 0 0.4000 434
Out..
lnL = -1235.589787
435 lfun, 5220 eigenQcodon, 28710 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1235.582346 S = -1235.582305 -0.000018
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 60 patterns 0:14
did 20 / 60 patterns 0:14
did 30 / 60 patterns 0:14
did 40 / 60 patterns 0:15
did 50 / 60 patterns 0:15
did 60 / 60 patterns 0:15
Time used: 0:15
CodeML output code: -1