--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:40:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1058/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1301.04         -1306.00
2      -1301.12         -1305.73
--------------------------------------
TOTAL    -1301.08         -1305.87
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.889927    0.088753    0.393269    1.494053    0.856793   1342.80   1421.13    1.001
r(A<->C){all}   0.158725    0.017795    0.000237    0.428187    0.121053    156.31    248.07    1.000
r(A<->G){all}   0.174437    0.021423    0.000061    0.473855    0.135058    136.14    188.60    1.002
r(A<->T){all}   0.174185    0.021579    0.000139    0.477086    0.136118    197.38    228.67    1.000
r(C<->G){all}   0.173757    0.019647    0.000025    0.455298    0.136194    171.36    187.44    1.004
r(C<->T){all}   0.163110    0.019346    0.000120    0.437040    0.128977    205.78    220.53    1.013
r(G<->T){all}   0.155786    0.016999    0.000018    0.430003    0.122140    219.66    316.17    1.001
pi(A){all}      0.187895    0.000157    0.163266    0.212162    0.187467   1100.44   1160.04    1.000
pi(C){all}      0.305586    0.000225    0.277459    0.334987    0.305227   1274.51   1286.76    1.000
pi(G){all}      0.320912    0.000226    0.291273    0.349492    0.320503   1008.92   1097.89    1.001
pi(T){all}      0.185607    0.000155    0.159143    0.207983    0.185172   1231.94   1243.47    1.000
alpha{1,2}      0.405845    0.206631    0.000131    1.287060    0.253169   1137.49   1217.86    1.000
alpha{3}        0.458459    0.239353    0.000316    1.448357    0.298594   1379.71   1408.28    1.000
pinvar{all}     0.998445    0.000003    0.995200    1.000000    0.999000   1209.59   1280.16    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1235.589853
Model 2: PositiveSelection	-1235.589787
Model 0: one-ratio	-1235.589787
Model 7: beta	-1235.590049
Model 8: beta&w>1	-1235.589787


Model 0 vs 1	1.320000001214794E-4

Model 2 vs 1	1.320000001214794E-4

Model 8 vs 7	5.240000000412692E-4
>C1
VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
VARDGRGSTLNEALHTNooo
>C2
VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
VARDGRGSTLNEALHTNooo
>C3
VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
VARDGRGSTLNEALHTNooo
>C4
VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
VARDGRGSTLNEALHTNooo
>C5
LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C6
LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=323 

C1              ---VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
C2              ---VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
C3              ---VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
C4              ---VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
C5              LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
C6              LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
                   ***********************************************

C1              PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
C2              PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
C3              PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
C4              PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
C5              PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
C6              PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
                **************************************************

C1              APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
C2              APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
C3              APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
C4              APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
C5              APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
C6              APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
                **************************************************

C1              FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
C2              FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
C3              FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
C4              FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
C5              FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
C6              FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
                **************************************************

C1              VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
C2              VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
C3              VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
C4              VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
C5              VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
C6              VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
                **************************************************

C1              ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
C2              ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
C3              ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
C4              ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
C5              ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
C6              ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
                **************************************************

C1              VEVVARDGRGSTLNEALHTNooo
C2              VEVVARDGRGSTLNEALHTNooo
C3              VEVVARDGRGSTLNEALHTNooo
C4              VEVVARDGRGSTLNEALHTNooo
C5              VEVVARDGRGSTLNEALHTN---
C6              VEVVARDGRGSTLNEALHTN---
                ********************   




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  320 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  320 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9664]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [9664]--->[9656]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.513 Mb, Max= 30.887 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
C2              VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
C3              VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
C4              VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
C5              VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
C6              VTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDVPYE
                **************************************************

C1              LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
C2              LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
C3              LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
C4              LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
C5              LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
C6              LAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLVAPH
                **************************************************

C1              GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
C2              GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
C3              GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
C4              GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
C5              GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
C6              GLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDKFPR
                **************************************************

C1              MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
C2              MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
C3              MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
C4              MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
C5              MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
C6              MVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
                **************************************************

C1              RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
C2              RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
C3              RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
C4              RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
C5              RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
C6              RISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
                **************************************************

C1              GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
C2              GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
C3              GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
C4              GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
C5              GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
C6              GDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGAVEV
                **************************************************

C1              VARDGRGSTLNEALHTN
C2              VARDGRGSTLNEALHTN
C3              VARDGRGSTLNEALHTN
C4              VARDGRGSTLNEALHTN
C5              VARDGRGSTLNEALHTN
C6              VARDGRGSTLNEALHTN
                *****************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
C2              ---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
C3              ---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
C4              ---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
C5              CTGACCGCCGTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
C6              CTGACCGCCGTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
                         *****************************************

C1              GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
C2              GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
C3              GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
C4              GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
C5              GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
C6              GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
                **************************************************

C1              TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
C2              TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
C3              TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
C4              TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
C5              TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
C6              TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
                **************************************************

C1              CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
C2              CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
C3              CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
C4              CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
C5              CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
C6              CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
                **************************************************

C1              GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
C2              GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
C3              GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
C4              GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
C5              GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
C6              GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
                **************************************************

C1              ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
C2              ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
C3              ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
C4              ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
C5              ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
C6              ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
                **************************************************

C1              GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
C2              GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
C3              GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
C4              GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
C5              GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
C6              GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
                **************************************************

C1              GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
C2              GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
C3              GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
C4              GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
C5              GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
C6              GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
                **************************************************

C1              GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
C2              GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
C3              GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
C4              GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
C5              GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
C6              GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
                **************************************************

C1              TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
C2              TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
C3              TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
C4              TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
C5              TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
C6              TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
                **************************************************

C1              CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
C2              CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
C3              CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
C4              CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
C5              CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
C6              CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
                **************************************************

C1              TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
C2              TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
C3              TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
C4              TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
C5              TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
C6              TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
                **************************************************

C1              GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
C2              GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
C3              GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
C4              GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
C5              GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
C6              GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
                **************************************************

C1              CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
C2              CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
C3              CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
C4              CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
C5              CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
C6              CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
                **************************************************

C1              TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
C2              TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
C3              TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
C4              TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
C5              TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
C6              TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
                **************************************************

C1              ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
C2              ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
C3              ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
C4              ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
C5              ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
C6              ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
                **************************************************

C1              CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
C2              CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
C3              CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
C4              CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
C5              CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
C6              CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
                **************************************************

C1              TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
C2              TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
C3              TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
C4              TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
C5              TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
C6              TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
                **************************************************

C1              GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
C2              GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
C3              GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
C4              GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
C5              GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
C6              GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
                **************************************************

C1              GCACACTAAC---------
C2              GCACACTAAC---------
C3              GCACACTAAC---------
C4              GCACACTAAC---------
C5              GCACACTAAC---------
C6              GCACACTAAC---------
                **********         



>C1
---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C2
---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C3
---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C4
---------GTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C5
CTGACCGCCGTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C6
CTGACCGCCGTGACAGGAACTGCAGGTGGGGTTGGCATCGGGCTGGCGAC
GCTGGCCGCCGACGGATCGATCCTCGACACCTGGTTTCCCGCACCGAAAC
TGACCGAATCGGGCACCAGCGTCACCTCGCAACTGGCGATGTCCGACGTT
CCCTACGAGCTGGCCGTACTTACCGGCCGCGATGACGACCGTGGCACTGA
GACCATCGCGGTCCGCACGGTCATCGGCTCATTGGACGAAGTCGCCGCCG
ACGCTTACGACGCCTACCTACGGTTACATATGCTGTCACACCGGCTGGTG
GCACCGCACGGGCTGAACGCCGACGGCTTGTTCGGAGTATTGACCAATGT
GGTTTGGACTAGTAGGGGACCCTGCGCAATCGACGGTTTCGACACCGTCC
GGGCACAGCTGCGTCGCCACGGACCGGTCACCATCTATGGCGTCGACAAA
TTCCCCAGGATGGTCGACTATGTCGTCCCCACCGGAGTGCGCATCGCCAA
CGCCGACCGAGTGCGGCTAGGCGCCCACTTAGCGCCTGGCACCACCGTGA
TGCACGAGGGCTTTGTCAACTACAATGCCGGTACCCTGGGCGCATCGATG
GTGGAGGGCCGCATCTCAGCGGGGGTGGTGGTGGGCGAAGGCTCTCACGT
CGGGGGTGGAGCGTCGATCATGGGTACCCTGTCCGGCGGTGGCACACAGG
TCATTTCCATAGGCAAGCGGTGTCTGCTCGGAGCCAACTCAGGTCTGGGT
ATCTCATTGGGCGACGACTGCATCGTTGAGGCCGGCTTATATGTCACTAC
CGGCACCAAGGTCAATACGCCAGAAGGCAAATCGGTTAAGGCTCGTGCGC
TCTCCGGCGGTAGCAACCTGTTGTTCCGACGCAATTCGGTAACAGGGGCG
GTCGAGGTGGTAGCCCGCGACGGTAGGGGGAGCACGCTCAACGAAGCCTT
GCACACTAAC---------
>C1
oooVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C2
oooVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C3
oooVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C4
oooVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C5
LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN
>C6
LTAVTGTAGGVGIGLATLAADGSILDTWFPAPKLTESGTSVTSQLAMSDV
PYELAVLTGRDDDRGTETIAVRTVIGSLDEVAADAYDAYLRLHMLSHRLV
APHGLNADGLFGVLTNVVWTSRGPCAIDGFDTVRAQLRRHGPVTIYGVDK
FPRMVDYVVPTGVRIANADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASM
VEGRISAGVVVGEGSHVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLG
ISLGDDCIVEAGLYVTTGTKVNTPEGKSVKARALSGGSNLLFRRNSVTGA
VEVVARDGRGSTLNEALHTN


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 969 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579855112
      Setting output file names to "/data/6res/ML1058/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1260811340
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5095584338
      Seed = 854024468
      Swapseed = 1579855112
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 8 unique site patterns
      Division 2 has 7 unique site patterns
      Division 3 has 7 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2143.376146 -- -24.965149
         Chain 2 -- -2144.131849 -- -24.965149
         Chain 3 -- -2144.131728 -- -24.965149
         Chain 4 -- -2143.376269 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2142.578565 -- -24.965149
         Chain 2 -- -2144.845443 -- -24.965149
         Chain 3 -- -2143.376269 -- -24.965149
         Chain 4 -- -2144.845443 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2143.376] (-2144.132) (-2144.132) (-2143.376) * [-2142.579] (-2144.845) (-2143.376) (-2144.845) 
        500 -- (-1335.516) (-1312.212) (-1313.558) [-1326.867] * (-1346.036) (-1329.783) (-1313.549) [-1309.603] -- 0:00:00
       1000 -- (-1311.763) [-1309.948] (-1307.031) (-1322.090) * (-1317.229) (-1331.141) (-1313.781) [-1308.669] -- 0:16:39
       1500 -- (-1305.596) (-1314.941) (-1306.442) [-1308.465] * [-1307.394] (-1310.824) (-1310.649) (-1313.627) -- 0:11:05
       2000 -- (-1307.724) (-1316.723) (-1306.937) [-1312.163] * (-1305.285) [-1309.466] (-1307.984) (-1311.995) -- 0:08:19
       2500 -- (-1305.561) [-1308.938] (-1312.894) (-1305.076) * [-1311.443] (-1308.528) (-1310.618) (-1313.830) -- 0:06:39
       3000 -- (-1310.926) [-1314.097] (-1318.387) (-1313.590) * (-1319.687) [-1305.857] (-1314.635) (-1311.325) -- 0:05:32
       3500 -- [-1305.906] (-1309.653) (-1308.920) (-1313.433) * (-1307.740) (-1311.647) [-1312.778] (-1316.275) -- 0:04:44
       4000 -- (-1307.272) [-1309.471] (-1310.720) (-1311.480) * [-1307.999] (-1316.167) (-1309.163) (-1306.573) -- 0:04:09
       4500 -- (-1313.319) (-1309.234) (-1318.915) [-1309.134] * [-1307.617] (-1308.136) (-1320.747) (-1305.302) -- 0:03:41
       5000 -- (-1310.421) [-1311.945] (-1315.591) (-1312.390) * (-1310.147) (-1313.806) (-1311.188) [-1307.829] -- 0:03:19

      Average standard deviation of split frequencies: 0.097274

       5500 -- (-1309.463) [-1314.624] (-1309.470) (-1310.237) * (-1309.647) [-1306.718] (-1317.291) (-1306.502) -- 0:03:00
       6000 -- (-1313.656) (-1309.784) (-1314.155) [-1307.423] * (-1310.785) (-1320.363) [-1303.209] (-1307.562) -- 0:02:45
       6500 -- (-1306.387) (-1313.188) (-1312.470) [-1301.000] * [-1303.511] (-1309.745) (-1313.242) (-1309.583) -- 0:02:32
       7000 -- (-1317.468) (-1314.653) [-1312.480] (-1300.962) * (-1301.644) [-1312.021] (-1311.411) (-1306.788) -- 0:02:21
       7500 -- [-1310.048] (-1316.493) (-1311.551) (-1300.907) * (-1301.010) (-1317.310) [-1313.266] (-1307.238) -- 0:02:12
       8000 -- (-1308.715) (-1311.842) [-1310.296] (-1301.097) * (-1302.491) (-1305.541) (-1310.431) [-1308.590] -- 0:02:04
       8500 -- (-1309.498) (-1310.124) [-1309.606] (-1299.631) * [-1299.912] (-1310.981) (-1306.797) (-1313.451) -- 0:01:56
       9000 -- (-1310.790) [-1313.854] (-1315.939) (-1300.079) * (-1301.850) [-1309.728] (-1307.187) (-1310.408) -- 0:01:50
       9500 -- (-1311.929) (-1313.955) [-1308.109] (-1303.617) * (-1302.755) [-1309.114] (-1314.089) (-1311.036) -- 0:01:44
      10000 -- (-1313.336) (-1317.165) (-1312.656) [-1304.130] * (-1303.399) [-1309.882] (-1310.463) (-1308.159) -- 0:01:39

      Average standard deviation of split frequencies: 0.090598

      10500 -- (-1311.635) (-1316.162) [-1314.486] (-1304.307) * (-1303.594) (-1310.133) [-1305.709] (-1310.301) -- 0:01:34
      11000 -- (-1309.077) (-1312.242) [-1315.647] (-1306.004) * (-1306.896) (-1315.809) (-1318.304) [-1310.334] -- 0:01:29
      11500 -- (-1309.634) (-1314.566) [-1311.724] (-1302.472) * (-1304.533) (-1313.527) (-1308.450) [-1316.463] -- 0:01:25
      12000 -- (-1309.865) (-1314.034) [-1307.696] (-1306.968) * (-1300.998) (-1306.624) [-1313.762] (-1317.485) -- 0:02:44
      12500 -- (-1318.857) (-1306.746) (-1317.336) [-1300.386] * (-1300.887) [-1308.691] (-1312.540) (-1309.251) -- 0:02:38
      13000 -- (-1311.061) (-1317.721) [-1309.736] (-1300.583) * [-1301.323] (-1321.615) (-1307.921) (-1308.084) -- 0:02:31
      13500 -- (-1321.822) (-1308.206) (-1305.617) [-1301.169] * [-1304.047] (-1316.541) (-1316.608) (-1314.558) -- 0:02:26
      14000 -- (-1311.443) (-1309.234) [-1314.948] (-1300.664) * [-1301.724] (-1308.422) (-1312.671) (-1312.234) -- 0:02:20
      14500 -- (-1310.830) (-1311.768) (-1308.155) [-1302.262] * (-1300.361) [-1311.329] (-1318.939) (-1305.862) -- 0:02:15
      15000 -- (-1320.221) [-1306.613] (-1311.799) (-1300.928) * (-1299.730) [-1307.536] (-1310.313) (-1312.673) -- 0:02:11

      Average standard deviation of split frequencies: 0.049105

      15500 -- (-1312.006) (-1305.555) [-1311.995] (-1301.646) * (-1300.392) [-1309.944] (-1312.889) (-1310.540) -- 0:02:07
      16000 -- (-1307.937) [-1310.520] (-1308.607) (-1300.976) * (-1299.556) [-1311.589] (-1308.340) (-1307.028) -- 0:02:03
      16500 -- [-1309.090] (-1310.830) (-1309.733) (-1306.635) * [-1300.121] (-1308.913) (-1318.164) (-1308.530) -- 0:01:59
      17000 -- [-1310.450] (-1313.380) (-1312.605) (-1301.751) * (-1302.138) (-1311.099) (-1313.593) [-1308.762] -- 0:01:55
      17500 -- (-1313.083) [-1309.213] (-1321.746) (-1301.590) * (-1306.415) [-1313.886] (-1314.084) (-1306.644) -- 0:01:52
      18000 -- (-1311.507) (-1309.490) [-1313.387] (-1300.328) * (-1303.250) [-1311.803] (-1305.160) (-1318.659) -- 0:01:49
      18500 -- [-1307.099] (-1309.334) (-1309.983) (-1301.017) * (-1301.636) [-1305.592] (-1311.393) (-1307.403) -- 0:01:46
      19000 -- [-1311.962] (-1309.634) (-1321.316) (-1300.184) * (-1304.344) [-1308.525] (-1314.224) (-1310.615) -- 0:01:43
      19500 -- [-1311.111] (-1311.015) (-1315.099) (-1300.188) * (-1304.476) (-1314.729) (-1314.135) [-1312.819] -- 0:01:40
      20000 -- [-1306.863] (-1309.081) (-1323.219) (-1303.107) * (-1301.834) (-1308.269) [-1306.346] (-1305.862) -- 0:01:38

      Average standard deviation of split frequencies: 0.050689

      20500 -- [-1308.343] (-1320.797) (-1308.263) (-1302.670) * (-1300.832) (-1319.763) (-1307.655) [-1314.408] -- 0:01:35
      21000 -- (-1306.480) [-1311.489] (-1302.610) (-1302.783) * (-1301.296) [-1309.139] (-1310.109) (-1311.638) -- 0:01:33
      21500 -- (-1317.956) [-1305.406] (-1302.840) (-1301.349) * (-1304.857) [-1316.079] (-1314.129) (-1308.782) -- 0:01:31
      22000 -- [-1308.473] (-1311.498) (-1307.000) (-1301.480) * (-1302.768) (-1309.770) (-1303.631) [-1312.044] -- 0:01:28
      22500 -- [-1310.835] (-1307.075) (-1304.003) (-1301.277) * (-1302.032) (-1308.379) (-1304.724) [-1312.591] -- 0:01:26
      23000 -- (-1312.592) [-1310.136] (-1301.185) (-1305.586) * (-1301.230) [-1312.571] (-1300.801) (-1312.249) -- 0:01:24
      23500 -- (-1312.189) [-1304.323] (-1306.062) (-1304.009) * (-1300.182) (-1315.088) (-1301.405) [-1309.790] -- 0:01:23
      24000 -- (-1311.406) [-1308.295] (-1300.986) (-1308.002) * (-1301.497) (-1322.251) [-1303.417] (-1317.171) -- 0:01:21
      24500 -- (-1309.204) [-1313.038] (-1303.048) (-1307.901) * (-1300.725) (-1310.370) [-1303.148] (-1308.839) -- 0:01:59
      25000 -- (-1310.026) [-1311.816] (-1306.741) (-1304.790) * [-1301.880] (-1310.117) (-1299.766) (-1312.681) -- 0:01:57

      Average standard deviation of split frequencies: 0.039558

      25500 -- (-1312.654) [-1315.126] (-1303.848) (-1304.408) * (-1300.774) (-1305.861) [-1301.001] (-1313.290) -- 0:01:54
      26000 -- [-1313.274] (-1309.903) (-1300.935) (-1304.582) * [-1300.618] (-1309.357) (-1304.848) (-1313.650) -- 0:01:52
      26500 -- (-1314.445) (-1312.568) (-1301.124) [-1305.108] * (-1301.198) (-1302.930) [-1300.020] (-1312.068) -- 0:01:50
      27000 -- [-1308.433] (-1313.801) (-1301.981) (-1302.131) * (-1300.684) [-1302.333] (-1301.814) (-1310.805) -- 0:01:48
      27500 -- (-1302.783) [-1316.475] (-1300.925) (-1302.873) * (-1301.438) (-1304.369) (-1301.813) [-1315.625] -- 0:01:46
      28000 -- (-1306.163) [-1308.535] (-1300.597) (-1300.864) * (-1300.315) (-1303.295) (-1302.713) [-1308.155] -- 0:01:44
      28500 -- (-1305.060) [-1306.577] (-1301.767) (-1300.755) * (-1300.580) (-1301.225) [-1302.744] (-1315.178) -- 0:01:42
      29000 -- (-1304.803) (-1307.976) [-1301.932] (-1300.910) * [-1300.687] (-1300.529) (-1301.438) (-1315.333) -- 0:01:40
      29500 -- (-1306.095) [-1309.964] (-1301.517) (-1303.677) * [-1301.228] (-1302.635) (-1301.265) (-1311.268) -- 0:01:38
      30000 -- (-1302.587) (-1310.601) [-1301.907] (-1305.666) * [-1299.751] (-1302.440) (-1301.265) (-1310.309) -- 0:01:37

      Average standard deviation of split frequencies: 0.053802

      30500 -- (-1304.556) (-1323.322) (-1303.465) [-1301.441] * (-1300.352) (-1300.125) (-1310.450) [-1316.121] -- 0:01:35
      31000 -- (-1304.171) [-1307.423] (-1301.354) (-1301.277) * (-1299.922) [-1300.435] (-1303.593) (-1314.205) -- 0:01:33
      31500 -- (-1305.721) (-1318.782) (-1301.248) [-1300.607] * [-1300.196] (-1300.030) (-1300.371) (-1303.809) -- 0:01:32
      32000 -- (-1304.849) [-1302.511] (-1303.727) (-1302.583) * [-1300.587] (-1300.053) (-1303.284) (-1312.583) -- 0:01:30
      32500 -- (-1308.183) [-1299.704] (-1303.714) (-1303.547) * (-1300.767) (-1301.248) (-1301.765) [-1306.854] -- 0:01:29
      33000 -- (-1303.767) [-1300.650] (-1302.519) (-1303.176) * (-1306.297) [-1302.632] (-1301.798) (-1310.533) -- 0:01:27
      33500 -- (-1303.254) (-1300.918) (-1304.722) [-1299.994] * [-1299.761] (-1301.401) (-1300.855) (-1310.677) -- 0:01:26
      34000 -- (-1303.906) [-1302.394] (-1304.735) (-1300.100) * (-1301.121) [-1300.382] (-1301.767) (-1310.106) -- 0:01:25
      34500 -- (-1304.534) [-1301.540] (-1304.006) (-1305.071) * (-1300.670) (-1303.249) [-1301.321] (-1314.782) -- 0:01:23
      35000 -- (-1306.304) [-1301.056] (-1303.651) (-1300.848) * (-1300.769) (-1306.828) (-1303.122) [-1305.161] -- 0:01:22

      Average standard deviation of split frequencies: 0.054249

      35500 -- (-1303.372) [-1302.914] (-1303.908) (-1300.143) * (-1304.518) (-1302.116) [-1302.744] (-1318.829) -- 0:01:21
      36000 -- [-1304.271] (-1303.982) (-1300.743) (-1301.850) * [-1299.856] (-1301.396) (-1302.544) (-1314.385) -- 0:01:20
      36500 -- [-1302.306] (-1303.979) (-1300.961) (-1305.238) * (-1303.250) (-1301.719) [-1307.127] (-1312.180) -- 0:01:45
      37000 -- (-1301.222) [-1300.420] (-1300.038) (-1300.196) * (-1303.028) (-1302.745) [-1305.020] (-1309.891) -- 0:01:44
      37500 -- (-1302.187) (-1300.824) [-1302.766] (-1299.869) * [-1302.201] (-1304.124) (-1300.839) (-1306.884) -- 0:01:42
      38000 -- (-1301.380) (-1302.965) (-1305.608) [-1301.961] * [-1301.382] (-1303.576) (-1303.650) (-1306.329) -- 0:01:41
      38500 -- (-1302.551) (-1300.906) (-1302.958) [-1300.577] * (-1302.690) [-1303.170] (-1301.284) (-1302.210) -- 0:01:39
      39000 -- (-1302.074) [-1303.279] (-1301.617) (-1304.584) * (-1302.259) [-1302.341] (-1302.604) (-1303.051) -- 0:01:38
      39500 -- [-1302.644] (-1301.095) (-1299.987) (-1302.807) * (-1301.503) [-1300.984] (-1301.953) (-1310.675) -- 0:01:37
      40000 -- (-1300.285) [-1301.459] (-1301.083) (-1305.710) * (-1300.798) (-1305.181) [-1300.427] (-1314.916) -- 0:01:36

      Average standard deviation of split frequencies: 0.043608

      40500 -- (-1300.707) [-1303.025] (-1302.091) (-1300.293) * (-1301.243) (-1306.714) [-1302.406] (-1310.847) -- 0:01:34
      41000 -- [-1302.564] (-1300.753) (-1300.288) (-1300.734) * (-1300.544) (-1305.279) (-1300.785) [-1305.994] -- 0:01:33
      41500 -- (-1301.717) (-1301.609) [-1299.792] (-1300.368) * (-1300.634) (-1304.350) [-1300.959] (-1308.490) -- 0:01:32
      42000 -- (-1306.551) (-1301.648) [-1301.434] (-1299.565) * [-1299.681] (-1310.155) (-1300.260) (-1313.577) -- 0:01:31
      42500 -- (-1300.300) (-1300.967) (-1299.876) [-1299.980] * [-1299.540] (-1306.141) (-1302.319) (-1314.053) -- 0:01:30
      43000 -- (-1303.922) (-1301.793) [-1300.310] (-1299.631) * (-1300.202) [-1306.071] (-1303.079) (-1311.340) -- 0:01:29
      43500 -- (-1301.300) [-1301.069] (-1299.657) (-1301.808) * [-1301.801] (-1303.146) (-1302.905) (-1313.266) -- 0:01:27
      44000 -- (-1301.399) (-1300.398) (-1300.623) [-1299.692] * (-1303.421) (-1300.655) (-1301.338) [-1312.098] -- 0:01:26
      44500 -- [-1301.311] (-1302.971) (-1300.670) (-1299.791) * (-1301.686) [-1301.969] (-1301.266) (-1318.936) -- 0:01:25
      45000 -- (-1300.720) (-1303.148) [-1300.449] (-1301.851) * (-1302.803) (-1300.120) (-1299.686) [-1316.927] -- 0:01:24

      Average standard deviation of split frequencies: 0.038197

      45500 -- (-1300.200) [-1304.684] (-1301.841) (-1300.069) * (-1302.083) [-1299.942] (-1302.304) (-1310.503) -- 0:01:23
      46000 -- (-1301.029) (-1303.056) (-1301.387) [-1299.612] * (-1302.372) [-1300.082] (-1301.689) (-1309.956) -- 0:01:22
      46500 -- [-1300.959] (-1302.635) (-1302.984) (-1299.763) * [-1301.903] (-1303.915) (-1301.152) (-1315.307) -- 0:01:22
      47000 -- [-1301.253] (-1305.162) (-1306.011) (-1300.333) * (-1303.640) [-1300.995] (-1305.021) (-1312.474) -- 0:01:21
      47500 -- (-1304.017) (-1304.732) (-1305.606) [-1300.561] * (-1304.181) [-1300.609] (-1303.957) (-1314.079) -- 0:01:20
      48000 -- (-1303.566) [-1302.380] (-1306.223) (-1303.695) * (-1302.971) (-1300.195) (-1301.008) [-1308.407] -- 0:01:19
      48500 -- (-1301.456) [-1302.835] (-1307.437) (-1301.317) * (-1303.424) (-1303.308) [-1304.902] (-1314.122) -- 0:01:18
      49000 -- (-1303.048) (-1304.148) [-1300.559] (-1300.709) * (-1300.656) (-1301.963) [-1303.016] (-1313.164) -- 0:01:37
      49500 -- (-1302.291) [-1302.437] (-1302.648) (-1303.149) * (-1303.256) (-1302.725) [-1302.489] (-1309.423) -- 0:01:36
      50000 -- (-1301.859) [-1301.968] (-1302.598) (-1302.430) * [-1301.721] (-1300.661) (-1302.690) (-1325.144) -- 0:01:35

      Average standard deviation of split frequencies: 0.042976

      50500 -- (-1304.699) [-1300.865] (-1301.562) (-1304.085) * (-1304.022) (-1300.420) [-1302.336] (-1308.767) -- 0:01:34
      51000 -- (-1302.921) (-1300.884) [-1300.730] (-1302.679) * (-1303.501) [-1300.464] (-1306.273) (-1310.716) -- 0:01:33
      51500 -- (-1301.703) (-1306.321) [-1301.701] (-1301.438) * [-1300.397] (-1300.160) (-1305.183) (-1309.954) -- 0:01:32
      52000 -- (-1301.494) [-1308.187] (-1301.740) (-1302.420) * [-1302.711] (-1301.003) (-1303.144) (-1311.705) -- 0:01:31
      52500 -- (-1303.691) (-1302.350) (-1301.844) [-1303.936] * [-1302.665] (-1300.131) (-1300.609) (-1308.880) -- 0:01:30
      53000 -- (-1303.854) (-1305.181) [-1301.391] (-1303.777) * (-1302.566) (-1301.549) [-1300.934] (-1309.291) -- 0:01:29
      53500 -- (-1302.956) (-1303.933) [-1302.185] (-1304.161) * (-1304.773) (-1301.870) (-1302.276) [-1312.574] -- 0:01:28
      54000 -- [-1301.743] (-1299.825) (-1300.511) (-1302.105) * (-1300.984) (-1301.982) [-1303.367] (-1303.069) -- 0:01:27
      54500 -- [-1302.894] (-1300.665) (-1301.900) (-1303.116) * (-1302.615) (-1307.061) [-1302.100] (-1302.589) -- 0:01:26
      55000 -- (-1299.859) [-1299.952] (-1300.066) (-1303.233) * (-1302.017) (-1306.073) [-1302.365] (-1303.686) -- 0:01:25

      Average standard deviation of split frequencies: 0.041669

      55500 -- (-1300.452) (-1299.847) (-1300.054) [-1302.130] * [-1299.795] (-1301.301) (-1301.581) (-1305.777) -- 0:01:25
      56000 -- (-1300.449) (-1300.663) [-1302.384] (-1300.779) * (-1300.014) [-1300.830] (-1301.587) (-1306.734) -- 0:01:24
      56500 -- (-1300.589) (-1302.234) [-1301.268] (-1299.496) * (-1301.154) [-1300.807] (-1301.477) (-1305.233) -- 0:01:23
      57000 -- (-1300.082) [-1301.765] (-1303.404) (-1299.601) * (-1303.648) [-1300.992] (-1301.790) (-1302.887) -- 0:01:22
      57500 -- (-1302.436) (-1301.770) (-1303.374) [-1300.247] * [-1303.958] (-1300.225) (-1301.147) (-1302.598) -- 0:01:21
      58000 -- (-1302.911) (-1301.825) (-1303.238) [-1300.424] * (-1307.927) [-1300.707] (-1301.052) (-1304.696) -- 0:01:21
      58500 -- (-1301.901) [-1300.200] (-1303.122) (-1301.604) * (-1305.908) (-1299.706) (-1302.209) [-1302.076] -- 0:01:20
      59000 -- (-1300.028) [-1300.408] (-1300.054) (-1303.525) * (-1301.399) [-1300.020] (-1302.944) (-1305.298) -- 0:01:19
      59500 -- (-1302.829) (-1301.796) (-1302.102) [-1301.136] * (-1301.269) (-1299.999) [-1302.680] (-1306.173) -- 0:01:19
      60000 -- (-1301.228) (-1300.265) [-1302.835] (-1301.588) * [-1301.223] (-1303.355) (-1303.348) (-1308.465) -- 0:01:18

      Average standard deviation of split frequencies: 0.029446

      60500 -- (-1302.213) (-1304.570) [-1300.941] (-1304.688) * (-1303.338) (-1302.999) (-1301.528) [-1300.368] -- 0:01:17
      61000 -- (-1302.580) [-1303.516] (-1304.636) (-1305.961) * (-1306.353) (-1301.130) (-1302.150) [-1300.974] -- 0:01:16
      61500 -- (-1300.568) (-1300.999) (-1300.984) [-1302.835] * (-1306.756) (-1301.418) [-1299.997] (-1300.777) -- 0:01:31
      62000 -- (-1300.878) (-1301.966) (-1302.878) [-1301.306] * [-1304.063] (-1302.478) (-1300.290) (-1300.604) -- 0:01:30
      62500 -- (-1303.700) [-1305.051] (-1302.589) (-1303.835) * (-1305.016) (-1301.900) [-1304.266] (-1306.431) -- 0:01:30
      63000 -- (-1300.806) [-1302.763] (-1300.856) (-1301.430) * [-1303.484] (-1301.891) (-1304.097) (-1302.402) -- 0:01:29
      63500 -- (-1301.529) (-1300.835) (-1299.912) [-1301.097] * (-1302.499) (-1303.034) (-1304.554) [-1302.684] -- 0:01:28
      64000 -- [-1303.357] (-1302.481) (-1300.195) (-1300.732) * (-1303.291) [-1302.745] (-1301.409) (-1303.286) -- 0:01:27
      64500 -- (-1300.822) (-1302.158) (-1300.236) [-1301.625] * (-1301.985) (-1302.040) [-1301.471] (-1303.081) -- 0:01:27
      65000 -- [-1300.493] (-1303.332) (-1301.450) (-1301.543) * (-1301.901) (-1301.532) [-1304.878] (-1300.866) -- 0:01:26

      Average standard deviation of split frequencies: 0.031070

      65500 -- (-1299.744) [-1301.455] (-1300.119) (-1301.329) * (-1300.401) (-1302.064) (-1303.590) [-1303.412] -- 0:01:25
      66000 -- (-1302.469) (-1303.175) [-1300.497] (-1303.539) * (-1301.615) [-1302.586] (-1303.699) (-1300.526) -- 0:01:24
      66500 -- [-1303.985] (-1301.965) (-1301.925) (-1302.132) * (-1302.676) (-1300.929) (-1301.343) [-1302.115] -- 0:01:24
      67000 -- (-1302.744) [-1302.799] (-1300.234) (-1302.803) * (-1302.639) [-1299.968] (-1301.191) (-1300.727) -- 0:01:23
      67500 -- (-1300.986) [-1302.981] (-1301.326) (-1303.219) * [-1301.462] (-1302.595) (-1300.539) (-1301.465) -- 0:01:22
      68000 -- (-1300.237) (-1301.781) [-1302.077] (-1302.073) * (-1305.554) (-1301.659) (-1300.434) [-1299.708] -- 0:01:22
      68500 -- [-1299.744] (-1300.143) (-1302.391) (-1306.581) * [-1301.104] (-1300.681) (-1301.318) (-1299.997) -- 0:01:21
      69000 -- [-1299.462] (-1303.992) (-1306.882) (-1305.312) * (-1302.801) (-1301.142) (-1299.725) [-1301.090] -- 0:01:20
      69500 -- (-1300.591) (-1302.135) [-1301.313] (-1305.708) * (-1305.834) (-1300.842) (-1300.834) [-1300.379] -- 0:01:20
      70000 -- (-1300.064) [-1301.645] (-1300.971) (-1306.993) * (-1304.827) [-1304.183] (-1303.947) (-1300.748) -- 0:01:19

      Average standard deviation of split frequencies: 0.030352

      70500 -- (-1306.318) (-1300.300) [-1300.223] (-1300.737) * (-1304.540) (-1308.098) (-1304.894) [-1300.583] -- 0:01:19
      71000 -- (-1302.281) [-1301.243] (-1302.759) (-1300.776) * (-1303.712) (-1302.967) [-1304.059] (-1300.143) -- 0:01:18
      71500 -- (-1300.306) [-1301.597] (-1301.191) (-1303.625) * (-1303.593) [-1300.043] (-1302.902) (-1301.367) -- 0:01:17
      72000 -- [-1300.624] (-1302.257) (-1302.027) (-1303.499) * [-1301.566] (-1299.782) (-1301.747) (-1300.299) -- 0:01:17
      72500 -- (-1302.052) (-1301.868) (-1302.235) [-1304.612] * (-1304.941) [-1301.271] (-1305.785) (-1301.272) -- 0:01:16
      73000 -- [-1299.960] (-1300.754) (-1302.252) (-1304.950) * [-1303.437] (-1302.206) (-1299.976) (-1301.629) -- 0:01:16
      73500 -- (-1300.741) [-1301.510] (-1302.117) (-1302.056) * (-1301.345) [-1300.327] (-1299.604) (-1303.544) -- 0:01:15
      74000 -- [-1300.581] (-1300.545) (-1299.860) (-1302.015) * [-1302.030] (-1303.213) (-1302.666) (-1301.868) -- 0:01:27
      74500 -- (-1301.158) (-1301.664) [-1300.264] (-1301.521) * [-1300.818] (-1304.203) (-1300.256) (-1302.074) -- 0:01:26
      75000 -- [-1300.018] (-1301.887) (-1300.377) (-1299.948) * (-1302.165) (-1301.818) [-1302.473] (-1302.330) -- 0:01:26

      Average standard deviation of split frequencies: 0.031666

      75500 -- (-1304.049) [-1301.656] (-1305.679) (-1300.925) * (-1305.662) [-1300.010] (-1299.882) (-1300.187) -- 0:01:25
      76000 -- (-1304.701) (-1300.136) (-1308.083) [-1300.449] * (-1301.430) [-1300.915] (-1299.987) (-1301.828) -- 0:01:25
      76500 -- (-1300.997) [-1300.265] (-1301.153) (-1300.207) * (-1301.566) (-1302.145) (-1300.453) [-1301.385] -- 0:01:24
      77000 -- (-1301.088) [-1300.845] (-1304.066) (-1300.149) * (-1301.997) (-1306.465) (-1301.183) [-1300.428] -- 0:01:23
      77500 -- (-1301.031) (-1300.375) [-1302.052] (-1301.883) * (-1303.310) [-1302.927] (-1301.833) (-1303.339) -- 0:01:23
      78000 -- [-1303.007] (-1302.962) (-1300.850) (-1301.386) * (-1302.400) [-1307.462] (-1300.752) (-1301.771) -- 0:01:22
      78500 -- (-1304.903) (-1302.225) (-1300.698) [-1302.568] * [-1303.846] (-1307.957) (-1299.575) (-1301.371) -- 0:01:22
      79000 -- [-1303.410] (-1306.540) (-1300.424) (-1302.231) * (-1303.146) (-1302.863) (-1303.194) [-1300.024] -- 0:01:21
      79500 -- (-1302.566) (-1306.448) (-1301.306) [-1302.028] * (-1303.838) (-1303.514) (-1304.056) [-1300.241] -- 0:01:21
      80000 -- (-1302.055) [-1301.832] (-1300.615) (-1302.465) * (-1303.431) [-1301.488] (-1304.151) (-1299.868) -- 0:01:20

      Average standard deviation of split frequencies: 0.031849

      80500 -- (-1300.712) [-1301.688] (-1300.611) (-1302.924) * (-1300.041) (-1301.576) [-1301.562] (-1300.608) -- 0:01:19
      81000 -- (-1303.364) [-1302.241] (-1300.556) (-1300.983) * (-1300.045) (-1301.149) (-1302.551) [-1301.887] -- 0:01:19
      81500 -- (-1301.723) (-1301.430) (-1303.755) [-1302.102] * (-1299.998) (-1302.726) [-1301.955] (-1302.582) -- 0:01:18
      82000 -- (-1300.200) (-1303.436) (-1305.770) [-1302.722] * (-1300.302) (-1302.635) [-1299.628] (-1303.972) -- 0:01:18
      82500 -- [-1303.792] (-1302.284) (-1301.711) (-1300.318) * (-1300.146) (-1302.964) [-1302.202] (-1300.881) -- 0:01:17
      83000 -- (-1307.093) (-1301.977) (-1302.994) [-1300.128] * (-1301.964) (-1301.176) [-1302.344] (-1300.133) -- 0:01:17
      83500 -- (-1303.482) [-1301.188] (-1303.824) (-1302.024) * (-1301.656) (-1301.735) (-1302.019) [-1301.784] -- 0:01:16
      84000 -- (-1301.056) (-1301.249) (-1304.759) [-1299.833] * [-1300.091] (-1305.350) (-1300.695) (-1302.520) -- 0:01:16
      84500 -- [-1300.892] (-1300.554) (-1305.693) (-1302.580) * (-1300.094) (-1300.617) [-1300.451] (-1300.156) -- 0:01:15
      85000 -- (-1302.220) (-1300.750) [-1301.613] (-1302.167) * (-1304.403) [-1300.554] (-1304.676) (-1300.691) -- 0:01:15

      Average standard deviation of split frequencies: 0.030422

      85500 -- (-1302.513) (-1301.980) (-1301.162) [-1303.642] * [-1304.204] (-1300.347) (-1300.369) (-1300.633) -- 0:01:14
      86000 -- (-1301.853) (-1302.579) [-1301.561] (-1303.637) * (-1301.667) [-1300.168] (-1301.173) (-1302.029) -- 0:01:14
      86500 -- (-1302.261) [-1300.214] (-1303.311) (-1301.912) * (-1300.622) (-1300.235) [-1301.989] (-1301.564) -- 0:01:13
      87000 -- [-1306.849] (-1300.629) (-1301.600) (-1303.135) * (-1300.749) (-1300.061) (-1302.956) [-1300.128] -- 0:01:13
      87500 -- (-1310.685) (-1301.235) (-1301.614) [-1301.841] * [-1300.506] (-1302.485) (-1302.575) (-1300.363) -- 0:01:23
      88000 -- (-1307.521) (-1301.037) (-1304.863) [-1300.905] * (-1302.620) (-1308.899) (-1302.487) [-1301.611] -- 0:01:22
      88500 -- [-1304.007] (-1301.014) (-1303.695) (-1305.031) * (-1300.038) (-1303.100) (-1302.296) [-1304.021] -- 0:01:22
      89000 -- [-1305.131] (-1301.663) (-1301.788) (-1303.722) * (-1301.027) (-1301.500) (-1301.134) [-1303.860] -- 0:01:21
      89500 -- (-1304.225) (-1305.657) (-1306.179) [-1300.620] * (-1300.701) (-1302.779) [-1300.593] (-1301.923) -- 0:01:21
      90000 -- (-1302.266) (-1302.161) (-1302.539) [-1301.556] * (-1300.536) (-1302.121) (-1300.757) [-1302.848] -- 0:01:20

      Average standard deviation of split frequencies: 0.032017

      90500 -- (-1301.728) [-1303.231] (-1302.795) (-1302.110) * (-1300.606) (-1307.625) [-1300.726] (-1302.390) -- 0:01:20
      91000 -- [-1300.663] (-1301.201) (-1300.002) (-1302.214) * (-1302.022) (-1302.555) [-1300.923] (-1300.997) -- 0:01:19
      91500 -- [-1301.360] (-1301.529) (-1301.296) (-1301.717) * [-1302.481] (-1304.501) (-1300.822) (-1301.930) -- 0:01:19
      92000 -- (-1304.170) (-1301.464) (-1301.496) [-1306.272] * (-1302.292) (-1307.525) [-1301.309] (-1301.636) -- 0:01:18
      92500 -- (-1302.648) (-1303.832) [-1304.623] (-1307.664) * (-1300.775) (-1301.084) [-1303.817] (-1300.849) -- 0:01:18
      93000 -- (-1300.567) (-1304.928) (-1300.583) [-1307.340] * (-1304.752) (-1304.449) (-1301.506) [-1300.980] -- 0:01:18
      93500 -- (-1305.003) (-1302.813) (-1303.136) [-1301.397] * [-1302.809] (-1305.048) (-1304.797) (-1302.005) -- 0:01:17
      94000 -- (-1303.952) (-1302.160) [-1303.743] (-1302.046) * [-1301.563] (-1302.041) (-1300.440) (-1302.001) -- 0:01:17
      94500 -- (-1303.033) (-1303.106) [-1301.247] (-1301.201) * [-1300.403] (-1301.252) (-1300.139) (-1303.162) -- 0:01:16
      95000 -- (-1301.746) [-1305.245] (-1301.607) (-1300.008) * (-1304.165) [-1300.227] (-1300.221) (-1304.286) -- 0:01:16

      Average standard deviation of split frequencies: 0.026103

      95500 -- (-1300.471) (-1301.944) (-1302.052) [-1306.628] * [-1302.864] (-1302.422) (-1300.651) (-1303.034) -- 0:01:15
      96000 -- (-1299.905) (-1301.653) [-1301.760] (-1303.470) * [-1300.518] (-1303.960) (-1300.653) (-1304.024) -- 0:01:15
      96500 -- (-1300.929) [-1301.577] (-1303.486) (-1299.508) * (-1300.703) (-1307.585) (-1301.143) [-1302.448] -- 0:01:14
      97000 -- [-1301.606] (-1302.299) (-1306.644) (-1302.905) * [-1300.752] (-1303.890) (-1302.998) (-1301.728) -- 0:01:14
      97500 -- (-1300.199) (-1302.729) [-1302.880] (-1304.300) * (-1300.693) (-1300.631) (-1300.505) [-1300.653] -- 0:01:14
      98000 -- (-1304.579) (-1301.046) (-1303.779) [-1304.341] * (-1304.197) (-1301.478) [-1299.801] (-1303.104) -- 0:01:13
      98500 -- (-1300.769) (-1301.898) (-1308.188) [-1301.967] * (-1300.599) [-1300.286] (-1299.692) (-1302.845) -- 0:01:13
      99000 -- [-1299.767] (-1302.284) (-1307.143) (-1303.690) * [-1301.933] (-1302.929) (-1301.646) (-1302.083) -- 0:01:12
      99500 -- (-1300.401) (-1301.793) (-1303.692) [-1306.337] * [-1300.608] (-1303.309) (-1301.277) (-1301.642) -- 0:01:21
      100000 -- (-1303.344) [-1300.862] (-1304.907) (-1304.555) * (-1305.620) (-1302.361) (-1299.918) [-1300.215] -- 0:01:21

      Average standard deviation of split frequencies: 0.019833

      100500 -- (-1301.588) [-1300.722] (-1305.105) (-1305.763) * (-1300.705) [-1303.311] (-1300.208) (-1304.198) -- 0:01:20
      101000 -- [-1301.092] (-1301.253) (-1301.911) (-1302.276) * (-1302.431) [-1304.607] (-1306.452) (-1301.777) -- 0:01:20
      101500 -- (-1300.019) [-1304.799] (-1302.284) (-1301.021) * [-1301.142] (-1301.710) (-1306.050) (-1301.353) -- 0:01:19
      102000 -- (-1301.174) (-1302.260) [-1302.293] (-1300.572) * (-1301.319) [-1301.333] (-1307.789) (-1299.713) -- 0:01:19
      102500 -- [-1304.174] (-1300.957) (-1302.221) (-1300.687) * [-1301.055] (-1303.166) (-1306.574) (-1299.711) -- 0:01:18
      103000 -- (-1301.980) (-1301.279) (-1305.876) [-1300.628] * (-1300.172) (-1303.060) [-1303.118] (-1300.876) -- 0:01:18
      103500 -- (-1302.364) (-1303.631) (-1306.381) [-1303.112] * [-1302.291] (-1302.539) (-1303.197) (-1300.094) -- 0:01:17
      104000 -- (-1300.723) [-1302.872] (-1301.119) (-1303.434) * (-1300.424) [-1302.277] (-1303.999) (-1300.542) -- 0:01:17
      104500 -- [-1302.736] (-1302.984) (-1301.674) (-1302.401) * (-1303.432) [-1301.481] (-1307.726) (-1301.973) -- 0:01:17
      105000 -- (-1302.432) (-1300.684) (-1300.314) [-1303.342] * [-1301.622] (-1300.472) (-1307.426) (-1302.696) -- 0:01:16

      Average standard deviation of split frequencies: 0.020364

      105500 -- (-1303.072) [-1302.232] (-1301.683) (-1304.043) * (-1299.530) (-1301.926) (-1307.416) [-1301.390] -- 0:01:16
      106000 -- (-1303.181) (-1306.749) [-1302.260] (-1308.005) * (-1299.767) (-1301.927) (-1302.008) [-1299.576] -- 0:01:15
      106500 -- (-1302.128) (-1305.652) (-1299.790) [-1304.624] * (-1300.014) [-1303.850] (-1301.229) (-1300.588) -- 0:01:15
      107000 -- (-1307.094) (-1302.215) [-1300.072] (-1302.086) * (-1301.003) (-1307.051) (-1300.474) [-1300.601] -- 0:01:15
      107500 -- (-1301.725) [-1301.697] (-1300.368) (-1301.344) * [-1301.634] (-1301.648) (-1301.316) (-1300.577) -- 0:01:14
      108000 -- (-1301.855) (-1301.675) (-1301.028) [-1301.503] * (-1302.688) (-1302.910) [-1300.333] (-1303.250) -- 0:01:14
      108500 -- (-1303.180) (-1302.429) [-1300.979] (-1301.954) * [-1301.207] (-1303.973) (-1301.206) (-1301.242) -- 0:01:13
      109000 -- (-1304.085) [-1303.249] (-1299.464) (-1302.948) * (-1300.421) (-1301.056) (-1301.744) [-1302.466] -- 0:01:13
      109500 -- (-1301.092) [-1302.148] (-1299.464) (-1302.424) * (-1300.032) (-1304.814) [-1302.480] (-1304.486) -- 0:01:13
      110000 -- (-1300.893) (-1302.538) [-1300.241] (-1301.004) * [-1300.505] (-1302.229) (-1300.070) (-1304.844) -- 0:01:12

      Average standard deviation of split frequencies: 0.019405

      110500 -- (-1303.638) (-1302.724) (-1301.755) [-1300.384] * (-1301.464) (-1303.012) (-1299.878) [-1300.669] -- 0:01:12
      111000 -- [-1302.560] (-1302.395) (-1302.449) (-1302.414) * (-1301.136) (-1303.284) [-1300.294] (-1301.179) -- 0:01:12
      111500 -- (-1308.007) (-1299.916) (-1306.587) [-1300.321] * (-1300.891) (-1302.755) (-1299.576) [-1300.876] -- 0:01:11
      112000 -- (-1301.860) (-1301.423) (-1305.433) [-1303.227] * (-1300.410) (-1303.537) (-1299.643) [-1300.341] -- 0:01:11
      112500 -- (-1300.251) (-1305.045) (-1302.792) [-1300.895] * (-1301.037) [-1300.501] (-1302.882) (-1300.358) -- 0:01:18
      113000 -- (-1302.194) (-1304.159) [-1302.270] (-1301.762) * (-1301.283) [-1300.442] (-1302.773) (-1300.624) -- 0:01:18
      113500 -- [-1302.920] (-1303.412) (-1305.100) (-1301.468) * (-1300.831) [-1300.654] (-1300.409) (-1302.722) -- 0:01:18
      114000 -- (-1306.957) (-1303.935) (-1308.284) [-1299.671] * (-1301.348) [-1303.292] (-1301.962) (-1301.828) -- 0:01:17
      114500 -- [-1303.848] (-1301.058) (-1300.478) (-1299.662) * (-1301.488) (-1301.133) (-1300.064) [-1303.286] -- 0:01:17
      115000 -- (-1303.936) [-1300.501] (-1300.791) (-1299.806) * (-1301.080) (-1301.777) (-1300.323) [-1302.827] -- 0:01:16

      Average standard deviation of split frequencies: 0.022125

      115500 -- (-1301.869) [-1300.882] (-1301.549) (-1299.720) * (-1302.125) (-1300.594) [-1301.512] (-1300.610) -- 0:01:16
      116000 -- (-1304.744) [-1300.783] (-1303.409) (-1299.691) * (-1301.148) (-1300.409) (-1304.128) [-1301.251] -- 0:01:16
      116500 -- [-1301.350] (-1301.613) (-1303.218) (-1300.609) * (-1307.053) (-1300.256) (-1302.814) [-1300.200] -- 0:01:15
      117000 -- (-1301.702) (-1301.964) [-1301.093] (-1301.832) * (-1300.166) (-1302.075) (-1302.554) [-1300.910] -- 0:01:15
      117500 -- (-1301.724) (-1301.444) (-1299.961) [-1303.759] * (-1300.111) (-1301.224) (-1301.505) [-1300.325] -- 0:01:15
      118000 -- [-1302.111] (-1300.574) (-1300.395) (-1302.171) * (-1299.773) (-1300.190) (-1301.756) [-1299.944] -- 0:01:14
      118500 -- (-1301.220) (-1300.718) (-1303.604) [-1304.572] * (-1305.053) (-1301.473) [-1301.818] (-1302.094) -- 0:01:14
      119000 -- (-1302.975) [-1301.101] (-1301.688) (-1302.554) * (-1300.733) [-1301.869] (-1304.176) (-1302.723) -- 0:01:14
      119500 -- (-1301.758) (-1300.169) (-1306.061) [-1301.080] * (-1300.350) [-1304.182] (-1302.689) (-1301.747) -- 0:01:13
      120000 -- (-1299.555) (-1302.475) [-1302.868] (-1303.607) * (-1301.192) (-1301.449) (-1302.897) [-1305.760] -- 0:01:13

      Average standard deviation of split frequencies: 0.023851

      120500 -- (-1299.999) (-1302.175) (-1301.066) [-1303.306] * (-1300.724) [-1301.088] (-1302.565) (-1302.573) -- 0:01:12
      121000 -- (-1303.920) (-1301.437) (-1300.059) [-1300.977] * (-1303.182) (-1303.406) (-1304.696) [-1301.126] -- 0:01:12
      121500 -- (-1301.434) (-1302.745) (-1301.490) [-1303.386] * (-1303.366) (-1306.061) (-1304.145) [-1300.187] -- 0:01:12
      122000 -- [-1301.810] (-1303.596) (-1302.016) (-1304.988) * (-1303.663) [-1301.258] (-1302.051) (-1300.271) -- 0:01:11
      122500 -- (-1301.326) (-1302.239) [-1304.412] (-1302.919) * (-1303.060) (-1301.147) [-1301.058] (-1305.444) -- 0:01:11
      123000 -- (-1300.239) (-1304.593) (-1300.901) [-1301.958] * [-1307.449] (-1301.253) (-1301.497) (-1305.752) -- 0:01:11
      123500 -- (-1300.090) (-1304.006) (-1303.180) [-1300.650] * (-1306.836) (-1300.759) [-1300.158] (-1307.052) -- 0:01:10
      124000 -- (-1299.869) (-1306.613) [-1302.235] (-1302.350) * (-1305.526) (-1300.993) (-1300.191) [-1304.320] -- 0:01:10
      124500 -- (-1307.179) (-1306.968) [-1300.528] (-1300.230) * (-1301.211) [-1301.736] (-1300.468) (-1305.622) -- 0:01:10
      125000 -- (-1305.858) (-1304.050) [-1300.114] (-1302.495) * (-1301.464) [-1300.015] (-1300.560) (-1304.337) -- 0:01:17

      Average standard deviation of split frequencies: 0.022054

      125500 -- [-1303.916] (-1304.243) (-1302.587) (-1301.403) * (-1302.121) (-1302.297) [-1300.541] (-1310.048) -- 0:01:16
      126000 -- (-1305.299) (-1302.399) (-1303.321) [-1301.962] * (-1300.631) (-1302.392) [-1300.221] (-1307.973) -- 0:01:16
      126500 -- (-1302.490) (-1305.868) (-1300.070) [-1300.238] * (-1303.307) (-1303.400) [-1300.060] (-1302.340) -- 0:01:15
      127000 -- (-1305.533) (-1304.342) [-1302.872] (-1303.497) * [-1304.299] (-1302.587) (-1303.459) (-1299.905) -- 0:01:15
      127500 -- (-1300.515) (-1301.922) (-1302.996) [-1303.238] * [-1301.972] (-1300.286) (-1301.010) (-1300.062) -- 0:01:15
      128000 -- (-1300.516) (-1306.718) (-1302.098) [-1302.664] * [-1301.348] (-1302.583) (-1303.745) (-1300.633) -- 0:01:14
      128500 -- (-1300.817) (-1307.312) [-1301.092] (-1301.154) * (-1301.102) (-1303.859) (-1300.374) [-1301.164] -- 0:01:14
      129000 -- (-1299.915) (-1303.470) [-1299.956] (-1302.922) * (-1300.486) [-1300.196] (-1306.240) (-1302.618) -- 0:01:14
      129500 -- [-1302.941] (-1302.948) (-1302.651) (-1301.502) * (-1307.984) [-1302.126] (-1304.161) (-1305.859) -- 0:01:13
      130000 -- (-1300.810) (-1302.151) (-1303.194) [-1302.166] * (-1301.712) (-1300.556) (-1304.428) [-1305.674] -- 0:01:13

      Average standard deviation of split frequencies: 0.023450

      130500 -- [-1301.511] (-1301.249) (-1301.136) (-1302.979) * (-1304.971) (-1302.100) [-1303.410] (-1302.674) -- 0:01:13
      131000 -- [-1302.350] (-1300.600) (-1309.909) (-1302.984) * (-1303.703) (-1303.845) [-1304.079] (-1303.548) -- 0:01:12
      131500 -- [-1303.061] (-1300.580) (-1308.617) (-1300.292) * (-1302.017) (-1300.628) (-1303.181) [-1306.827] -- 0:01:12
      132000 -- (-1303.614) [-1300.224] (-1305.811) (-1300.242) * [-1300.960] (-1301.187) (-1302.262) (-1307.300) -- 0:01:12
      132500 -- (-1302.388) [-1301.143] (-1302.576) (-1300.054) * (-1301.348) [-1299.513] (-1303.453) (-1306.446) -- 0:01:12
      133000 -- (-1304.486) [-1300.332] (-1304.435) (-1300.057) * [-1304.248] (-1304.704) (-1301.162) (-1300.361) -- 0:01:11
      133500 -- (-1300.594) (-1301.039) (-1302.769) [-1300.817] * (-1301.676) (-1303.018) [-1301.609] (-1300.560) -- 0:01:11
      134000 -- (-1301.100) (-1300.381) (-1303.096) [-1301.012] * (-1300.448) (-1301.255) (-1301.713) [-1300.152] -- 0:01:11
      134500 -- [-1302.696] (-1302.416) (-1303.162) (-1301.311) * [-1300.222] (-1300.178) (-1303.683) (-1302.130) -- 0:01:10
      135000 -- (-1304.329) (-1303.804) (-1303.874) [-1300.008] * (-1301.737) (-1302.120) [-1302.117] (-1302.128) -- 0:01:10

      Average standard deviation of split frequencies: 0.020980

      135500 -- [-1302.041] (-1304.158) (-1301.952) (-1300.040) * (-1301.159) (-1302.310) (-1302.496) [-1304.398] -- 0:01:10
      136000 -- (-1301.850) (-1301.097) [-1301.384] (-1299.849) * (-1303.427) (-1301.975) (-1307.119) [-1301.304] -- 0:01:09
      136500 -- (-1301.573) (-1302.056) [-1304.681] (-1300.736) * (-1303.524) [-1302.594] (-1307.941) (-1303.952) -- 0:01:09
      137000 -- (-1301.998) [-1300.742] (-1301.127) (-1301.035) * (-1302.873) (-1303.303) (-1302.803) [-1303.373] -- 0:01:09
      137500 -- (-1305.126) (-1302.255) (-1302.427) [-1301.035] * (-1302.455) [-1304.572] (-1301.816) (-1301.896) -- 0:01:09
      138000 -- (-1304.985) [-1302.621] (-1302.711) (-1300.570) * (-1301.708) (-1305.047) (-1300.373) [-1300.473] -- 0:01:08
      138500 -- (-1303.346) [-1301.978] (-1301.616) (-1302.324) * [-1304.184] (-1304.780) (-1302.576) (-1302.206) -- 0:01:14
      139000 -- (-1301.994) (-1303.039) [-1300.419] (-1300.526) * (-1301.896) (-1305.460) [-1301.592] (-1299.653) -- 0:01:14
      139500 -- [-1302.921] (-1300.957) (-1302.762) (-1303.146) * (-1303.630) [-1301.667] (-1301.850) (-1300.373) -- 0:01:14
      140000 -- [-1301.645] (-1300.015) (-1303.012) (-1303.060) * [-1302.567] (-1302.439) (-1301.057) (-1300.579) -- 0:01:13

      Average standard deviation of split frequencies: 0.019578

      140500 -- (-1303.607) (-1302.199) (-1303.448) [-1300.217] * (-1303.254) (-1301.436) [-1303.794] (-1301.265) -- 0:01:13
      141000 -- (-1301.055) [-1301.128] (-1302.436) (-1300.511) * (-1305.830) [-1301.490] (-1302.657) (-1302.746) -- 0:01:13
      141500 -- (-1300.193) [-1299.711] (-1300.658) (-1302.537) * [-1304.924] (-1301.630) (-1309.001) (-1304.773) -- 0:01:12
      142000 -- (-1301.464) (-1301.826) [-1302.124] (-1303.066) * (-1303.021) (-1301.547) [-1301.581] (-1300.323) -- 0:01:12
      142500 -- (-1300.992) (-1300.544) [-1299.746] (-1301.073) * (-1304.166) (-1301.480) (-1302.422) [-1300.319] -- 0:01:12
      143000 -- (-1301.467) [-1303.216] (-1303.541) (-1300.927) * (-1300.858) (-1303.299) [-1303.232] (-1300.725) -- 0:01:11
      143500 -- (-1300.819) (-1300.442) [-1303.114] (-1302.958) * (-1300.880) (-1302.071) [-1302.217] (-1300.128) -- 0:01:11
      144000 -- (-1302.757) (-1303.000) (-1300.160) [-1303.523] * (-1306.279) (-1304.313) (-1301.411) [-1301.548] -- 0:01:11
      144500 -- [-1301.498] (-1304.556) (-1301.449) (-1303.127) * (-1304.894) (-1301.777) (-1303.754) [-1302.003] -- 0:01:11
      145000 -- (-1305.069) (-1304.678) [-1301.204] (-1301.764) * (-1302.052) [-1303.431] (-1301.258) (-1301.812) -- 0:01:10

      Average standard deviation of split frequencies: 0.020053

      145500 -- (-1306.078) (-1303.924) (-1300.697) [-1301.930] * [-1301.222] (-1304.207) (-1303.372) (-1303.258) -- 0:01:10
      146000 -- (-1302.983) [-1300.853] (-1301.805) (-1303.600) * (-1303.201) (-1302.928) (-1302.700) [-1301.493] -- 0:01:10
      146500 -- (-1301.876) (-1303.245) (-1305.010) [-1302.311] * (-1303.330) (-1301.226) [-1300.078] (-1304.328) -- 0:01:09
      147000 -- (-1304.559) (-1303.266) [-1300.566] (-1303.943) * (-1303.013) (-1305.177) (-1300.268) [-1303.872] -- 0:01:09
      147500 -- (-1304.321) (-1302.560) [-1302.119] (-1302.023) * [-1303.102] (-1303.018) (-1299.653) (-1301.254) -- 0:01:09
      148000 -- (-1303.667) (-1306.626) (-1302.652) [-1301.071] * (-1304.192) (-1304.998) [-1299.557] (-1299.687) -- 0:01:09
      148500 -- (-1302.452) (-1305.673) [-1304.840] (-1303.102) * (-1303.706) [-1303.302] (-1300.092) (-1299.687) -- 0:01:08
      149000 -- (-1300.674) (-1302.664) [-1301.149] (-1300.894) * (-1303.651) (-1302.854) [-1304.102] (-1303.417) -- 0:01:08
      149500 -- (-1303.871) [-1302.525] (-1304.022) (-1302.124) * (-1303.370) (-1301.454) (-1307.119) [-1301.758] -- 0:01:08
      150000 -- (-1300.983) (-1303.184) [-1307.858] (-1301.059) * (-1301.874) (-1300.668) (-1303.435) [-1301.624] -- 0:01:08

      Average standard deviation of split frequencies: 0.018303

      150500 -- (-1302.010) (-1306.477) (-1303.623) [-1299.853] * [-1300.398] (-1303.038) (-1303.439) (-1300.555) -- 0:01:07
      151000 -- [-1302.166] (-1309.466) (-1301.201) (-1302.939) * (-1301.064) (-1306.376) (-1303.764) [-1300.839] -- 0:01:07
      151500 -- [-1300.842] (-1305.308) (-1300.074) (-1300.881) * [-1309.745] (-1306.518) (-1301.669) (-1302.139) -- 0:01:07
      152000 -- [-1300.485] (-1302.286) (-1300.643) (-1303.794) * [-1301.167] (-1301.778) (-1303.496) (-1302.146) -- 0:01:12
      152500 -- (-1302.051) [-1300.205] (-1300.357) (-1302.186) * (-1301.821) (-1304.095) (-1301.505) [-1300.601] -- 0:01:12
      153000 -- (-1299.453) (-1307.419) (-1300.923) [-1303.712] * (-1301.061) (-1302.070) (-1301.921) [-1300.604] -- 0:01:11
      153500 -- [-1300.536] (-1302.625) (-1300.254) (-1300.288) * (-1301.419) (-1304.084) [-1300.659] (-1300.989) -- 0:01:11
      154000 -- (-1301.572) [-1301.859] (-1300.480) (-1302.553) * (-1301.540) (-1306.392) (-1300.257) [-1300.053] -- 0:01:11
      154500 -- [-1299.517] (-1301.399) (-1301.818) (-1304.560) * (-1303.896) (-1303.116) (-1305.326) [-1302.439] -- 0:01:11
      155000 -- (-1300.167) [-1299.637] (-1301.290) (-1309.887) * (-1303.069) (-1300.592) [-1302.393] (-1303.055) -- 0:01:10

      Average standard deviation of split frequencies: 0.018282

      155500 -- (-1299.632) [-1303.831] (-1301.477) (-1306.966) * (-1300.055) (-1301.476) (-1301.244) [-1302.185] -- 0:01:10
      156000 -- (-1300.638) [-1302.504] (-1301.578) (-1303.204) * [-1299.743] (-1301.073) (-1299.982) (-1300.769) -- 0:01:10
      156500 -- (-1300.876) (-1301.092) [-1301.959] (-1301.683) * [-1301.649] (-1300.546) (-1300.325) (-1303.034) -- 0:01:10
      157000 -- (-1300.668) (-1303.072) [-1303.016] (-1302.023) * (-1301.760) (-1300.251) [-1301.232] (-1307.075) -- 0:01:09
      157500 -- (-1301.122) (-1304.467) [-1303.777] (-1302.802) * (-1299.950) (-1303.306) (-1301.624) [-1302.375] -- 0:01:09
      158000 -- (-1301.223) (-1302.759) [-1303.347] (-1302.225) * (-1301.530) [-1300.455] (-1303.680) (-1302.464) -- 0:01:09
      158500 -- (-1301.709) (-1301.933) (-1302.208) [-1303.528] * [-1300.895] (-1300.819) (-1302.659) (-1302.650) -- 0:01:09
      159000 -- (-1301.538) (-1306.619) (-1302.122) [-1300.183] * (-1300.895) [-1302.461] (-1302.004) (-1301.027) -- 0:01:08
      159500 -- (-1300.821) [-1303.172] (-1301.994) (-1300.201) * (-1301.843) (-1302.243) (-1305.226) [-1302.405] -- 0:01:08
      160000 -- (-1301.542) [-1302.367] (-1301.284) (-1304.493) * (-1301.333) (-1303.612) [-1304.775] (-1303.007) -- 0:01:08

      Average standard deviation of split frequencies: 0.017458

      160500 -- (-1301.182) (-1302.034) (-1300.325) [-1305.396] * (-1301.523) (-1303.426) [-1300.573] (-1300.390) -- 0:01:07
      161000 -- [-1301.556] (-1305.188) (-1302.409) (-1302.886) * (-1299.361) (-1302.114) [-1300.545] (-1301.891) -- 0:01:07
      161500 -- [-1301.248] (-1304.199) (-1301.805) (-1309.035) * (-1300.757) [-1301.951] (-1300.602) (-1301.638) -- 0:01:07
      162000 -- (-1302.326) [-1300.653] (-1300.517) (-1309.992) * (-1300.609) (-1301.941) [-1300.886] (-1301.309) -- 0:01:07
      162500 -- (-1300.436) (-1301.277) (-1302.337) [-1304.579] * (-1299.731) [-1299.991] (-1305.453) (-1299.895) -- 0:01:07
      163000 -- (-1301.255) (-1302.568) [-1301.563] (-1303.186) * (-1303.323) (-1303.514) [-1301.155] (-1300.214) -- 0:01:06
      163500 -- (-1301.232) (-1303.988) [-1301.251] (-1300.758) * [-1302.500] (-1301.245) (-1300.253) (-1300.006) -- 0:01:06
      164000 -- [-1300.721] (-1301.852) (-1304.320) (-1301.036) * (-1300.726) (-1301.842) [-1303.018] (-1303.487) -- 0:01:06
      164500 -- (-1304.988) (-1300.001) (-1305.121) [-1301.569] * (-1301.795) (-1300.668) (-1302.813) [-1305.101] -- 0:01:06
      165000 -- (-1303.070) [-1300.869] (-1306.094) (-1303.784) * (-1301.453) [-1301.827] (-1302.399) (-1304.324) -- 0:01:05

      Average standard deviation of split frequencies: 0.016471

      165500 -- (-1302.993) [-1300.987] (-1302.572) (-1305.270) * [-1301.578] (-1301.309) (-1302.558) (-1300.136) -- 0:01:10
      166000 -- [-1301.250] (-1301.336) (-1301.653) (-1305.445) * (-1300.450) [-1301.221] (-1302.080) (-1299.567) -- 0:01:10
      166500 -- [-1300.104] (-1304.239) (-1303.883) (-1300.887) * (-1300.933) (-1302.481) (-1301.118) [-1300.137] -- 0:01:10
      167000 -- (-1304.556) [-1304.239] (-1301.659) (-1300.062) * (-1301.320) (-1301.532) [-1304.602] (-1301.586) -- 0:01:09
      167500 -- (-1301.331) (-1311.559) (-1303.857) [-1299.947] * (-1301.763) (-1308.888) [-1304.920] (-1301.398) -- 0:01:09
      168000 -- (-1301.638) (-1309.032) (-1301.910) [-1299.960] * [-1302.040] (-1305.486) (-1303.329) (-1304.436) -- 0:01:09
      168500 -- (-1301.464) (-1300.184) (-1302.186) [-1300.606] * (-1300.556) [-1300.242] (-1300.985) (-1302.729) -- 0:01:09
      169000 -- (-1302.133) [-1301.393] (-1301.319) (-1300.894) * (-1300.737) [-1299.885] (-1302.534) (-1303.195) -- 0:01:08
      169500 -- (-1303.748) (-1300.903) (-1301.566) [-1302.562] * (-1303.579) (-1301.845) (-1301.991) [-1303.199] -- 0:01:08
      170000 -- [-1300.752] (-1301.657) (-1300.999) (-1302.968) * (-1302.516) (-1301.916) [-1302.711] (-1302.215) -- 0:01:08

      Average standard deviation of split frequencies: 0.016711

      170500 -- (-1303.803) (-1302.533) (-1301.198) [-1303.044] * [-1302.883] (-1303.420) (-1302.358) (-1303.170) -- 0:01:08
      171000 -- (-1301.398) (-1300.818) (-1301.197) [-1305.351] * [-1301.702] (-1299.892) (-1301.477) (-1305.501) -- 0:01:07
      171500 -- (-1300.396) (-1302.561) [-1301.532] (-1307.554) * [-1304.681] (-1301.559) (-1300.706) (-1303.517) -- 0:01:07
      172000 -- (-1301.618) (-1303.105) [-1299.731] (-1299.895) * [-1300.719] (-1301.655) (-1300.614) (-1302.783) -- 0:01:07
      172500 -- [-1299.794] (-1306.617) (-1300.393) (-1302.263) * (-1301.778) (-1305.642) [-1301.483] (-1306.423) -- 0:01:07
      173000 -- (-1300.541) [-1304.539] (-1301.454) (-1301.445) * [-1299.563] (-1302.678) (-1301.475) (-1304.939) -- 0:01:06
      173500 -- (-1300.801) (-1301.986) [-1301.481] (-1300.649) * (-1299.948) (-1305.623) (-1301.220) [-1302.040] -- 0:01:06
      174000 -- (-1300.575) (-1302.567) (-1300.345) [-1302.521] * (-1300.304) (-1301.521) [-1302.207] (-1301.750) -- 0:01:06
      174500 -- (-1300.574) [-1300.220] (-1302.345) (-1301.570) * [-1300.687] (-1300.777) (-1304.378) (-1302.267) -- 0:01:06
      175000 -- (-1303.739) (-1301.280) [-1302.712] (-1301.362) * (-1301.167) [-1303.887] (-1302.079) (-1301.165) -- 0:01:06

      Average standard deviation of split frequencies: 0.015225

      175500 -- [-1303.230] (-1300.255) (-1300.921) (-1301.658) * (-1301.102) [-1301.295] (-1302.049) (-1300.592) -- 0:01:05
      176000 -- (-1301.375) [-1300.795] (-1300.361) (-1300.708) * [-1300.145] (-1300.203) (-1307.322) (-1301.464) -- 0:01:05
      176500 -- (-1303.405) (-1300.795) [-1300.852] (-1300.708) * (-1300.085) (-1300.925) [-1303.193] (-1300.636) -- 0:01:05
      177000 -- (-1302.015) [-1303.693] (-1301.441) (-1302.644) * (-1300.770) (-1301.356) [-1301.246] (-1301.247) -- 0:01:05
      177500 -- [-1301.930] (-1303.742) (-1301.378) (-1302.558) * (-1300.911) (-1300.667) [-1301.238] (-1300.585) -- 0:01:04
      178000 -- (-1302.626) (-1303.544) (-1303.777) [-1303.911] * [-1300.522] (-1301.808) (-1300.733) (-1302.289) -- 0:01:04
      178500 -- (-1300.989) (-1301.415) (-1303.021) [-1300.867] * (-1300.673) (-1300.534) (-1300.850) [-1304.018] -- 0:01:04
      179000 -- (-1303.376) [-1301.255] (-1300.462) (-1303.137) * (-1301.918) [-1302.264] (-1300.759) (-1303.425) -- 0:01:08
      179500 -- (-1305.853) (-1299.990) [-1300.964] (-1302.610) * [-1301.211] (-1302.537) (-1300.182) (-1301.190) -- 0:01:08
      180000 -- [-1302.209] (-1301.065) (-1303.160) (-1302.380) * (-1301.212) (-1301.818) [-1299.509] (-1302.399) -- 0:01:08

      Average standard deviation of split frequencies: 0.016830

      180500 -- (-1302.890) (-1300.853) (-1306.752) [-1301.973] * (-1300.584) (-1305.772) (-1299.968) [-1301.663] -- 0:01:08
      181000 -- (-1302.796) [-1302.701] (-1299.929) (-1307.322) * (-1300.294) (-1309.314) (-1301.763) [-1302.446] -- 0:01:07
      181500 -- [-1301.169] (-1303.221) (-1304.016) (-1300.063) * (-1299.752) [-1305.708] (-1302.481) (-1301.416) -- 0:01:07
      182000 -- (-1300.951) (-1301.482) (-1303.115) [-1300.261] * [-1299.644] (-1304.650) (-1301.844) (-1302.667) -- 0:01:07
      182500 -- (-1300.433) (-1300.249) (-1301.971) [-1303.412] * (-1300.581) (-1302.500) (-1303.963) [-1301.063] -- 0:01:07
      183000 -- (-1300.181) (-1300.599) [-1301.321] (-1303.150) * [-1300.000] (-1303.346) (-1301.102) (-1300.680) -- 0:01:06
      183500 -- (-1302.803) [-1302.290] (-1301.942) (-1301.883) * (-1302.471) (-1305.551) (-1302.298) [-1299.745] -- 0:01:06
      184000 -- [-1301.014] (-1304.050) (-1301.054) (-1303.135) * (-1306.142) (-1306.104) [-1301.237] (-1299.940) -- 0:01:06
      184500 -- [-1302.498] (-1302.392) (-1301.964) (-1301.792) * [-1301.235] (-1305.349) (-1302.341) (-1301.081) -- 0:01:06
      185000 -- (-1301.689) (-1303.695) [-1300.463] (-1302.405) * (-1300.004) (-1302.734) (-1305.133) [-1302.217] -- 0:01:06

      Average standard deviation of split frequencies: 0.016776

      185500 -- (-1303.947) (-1300.392) [-1303.414] (-1300.448) * (-1300.762) (-1310.975) [-1300.699] (-1300.354) -- 0:01:05
      186000 -- (-1302.637) [-1301.849] (-1304.652) (-1303.766) * (-1303.932) [-1300.478] (-1300.923) (-1305.372) -- 0:01:05
      186500 -- (-1302.163) (-1300.780) [-1299.859] (-1300.519) * (-1303.089) (-1302.871) [-1300.516] (-1308.096) -- 0:01:05
      187000 -- (-1302.281) [-1302.909] (-1300.752) (-1302.789) * (-1305.675) (-1301.390) (-1302.974) [-1302.303] -- 0:01:05
      187500 -- (-1300.978) (-1303.317) [-1300.577] (-1302.637) * (-1302.214) [-1303.467] (-1302.411) (-1304.315) -- 0:01:05
      188000 -- (-1301.116) (-1302.320) (-1302.015) [-1300.507] * (-1302.970) [-1304.550] (-1306.518) (-1304.320) -- 0:01:04
      188500 -- (-1301.100) (-1300.507) (-1301.732) [-1300.500] * (-1303.394) (-1302.181) [-1301.895] (-1303.277) -- 0:01:04
      189000 -- (-1300.580) (-1300.373) [-1301.654] (-1302.153) * [-1304.608] (-1300.939) (-1300.133) (-1302.851) -- 0:01:04
      189500 -- (-1304.186) [-1300.315] (-1300.867) (-1301.866) * (-1302.991) (-1300.895) (-1300.060) [-1304.264] -- 0:01:04
      190000 -- [-1305.105] (-1302.984) (-1301.793) (-1301.766) * (-1302.997) [-1301.434] (-1299.831) (-1303.674) -- 0:01:03

      Average standard deviation of split frequencies: 0.017827

      190500 -- (-1300.201) (-1303.212) [-1300.678] (-1302.596) * (-1307.252) [-1302.888] (-1301.738) (-1301.114) -- 0:01:03
      191000 -- [-1299.530] (-1303.733) (-1302.861) (-1300.231) * (-1305.079) (-1302.430) (-1306.643) [-1302.491] -- 0:01:03
      191500 -- (-1302.587) (-1302.566) [-1305.338] (-1301.044) * (-1300.569) [-1302.249] (-1300.286) (-1301.042) -- 0:01:03
      192000 -- [-1305.282] (-1302.453) (-1305.500) (-1301.696) * (-1300.205) [-1301.637] (-1301.189) (-1301.589) -- 0:01:07
      192500 -- (-1307.965) [-1299.958] (-1307.415) (-1304.967) * (-1301.807) (-1302.818) (-1299.919) [-1302.779] -- 0:01:07
      193000 -- (-1303.138) (-1307.365) (-1303.469) [-1306.715] * (-1300.558) (-1299.955) (-1301.457) [-1304.326] -- 0:01:06
      193500 -- (-1301.527) (-1302.778) [-1305.117] (-1300.516) * (-1300.578) (-1301.223) (-1303.381) [-1302.741] -- 0:01:06
      194000 -- (-1300.949) [-1301.100] (-1303.357) (-1300.542) * (-1302.382) (-1301.519) (-1306.516) [-1303.861] -- 0:01:06
      194500 -- (-1300.559) (-1305.692) (-1306.366) [-1300.855] * (-1303.540) [-1307.969] (-1303.271) (-1301.602) -- 0:01:06
      195000 -- (-1306.338) (-1303.175) (-1300.828) [-1300.834] * (-1301.378) [-1304.581] (-1301.962) (-1303.328) -- 0:01:06

      Average standard deviation of split frequencies: 0.014965

      195500 -- (-1300.584) (-1304.583) (-1301.179) [-1300.419] * (-1302.503) (-1303.194) [-1301.057] (-1302.094) -- 0:01:05
      196000 -- (-1302.250) (-1305.094) (-1300.662) [-1300.075] * (-1303.286) (-1304.550) (-1300.559) [-1301.498] -- 0:01:05
      196500 -- (-1300.031) [-1302.509] (-1301.156) (-1301.322) * (-1305.511) (-1301.448) (-1300.207) [-1302.227] -- 0:01:05
      197000 -- (-1302.732) [-1300.913] (-1300.449) (-1299.983) * (-1303.438) (-1299.877) [-1304.111] (-1301.213) -- 0:01:05
      197500 -- (-1301.384) (-1300.803) [-1300.694] (-1302.088) * (-1304.526) (-1299.531) (-1301.380) [-1302.224] -- 0:01:05
      198000 -- (-1302.412) [-1300.709] (-1300.696) (-1303.649) * (-1305.484) (-1301.285) (-1300.379) [-1300.092] -- 0:01:04
      198500 -- (-1303.674) [-1300.746] (-1300.971) (-1301.377) * (-1304.839) (-1302.859) [-1304.486] (-1300.003) -- 0:01:04
      199000 -- (-1301.674) [-1302.486] (-1301.497) (-1300.467) * [-1300.300] (-1304.254) (-1300.946) (-1300.916) -- 0:01:04
      199500 -- [-1300.597] (-1301.492) (-1300.169) (-1303.048) * [-1300.675] (-1303.106) (-1300.412) (-1301.491) -- 0:01:04
      200000 -- [-1302.090] (-1302.736) (-1303.660) (-1302.357) * [-1299.834] (-1304.086) (-1300.910) (-1305.660) -- 0:01:04

      Average standard deviation of split frequencies: 0.014878

      200500 -- (-1301.748) (-1301.448) [-1306.155] (-1305.441) * (-1300.960) (-1301.183) (-1302.206) [-1301.582] -- 0:01:03
      201000 -- (-1306.112) (-1301.860) (-1306.413) [-1301.812] * (-1302.343) [-1300.823] (-1302.702) (-1302.214) -- 0:01:03
      201500 -- [-1303.615] (-1301.808) (-1302.519) (-1304.166) * [-1303.220] (-1302.821) (-1302.884) (-1303.872) -- 0:01:03
      202000 -- (-1304.596) [-1301.133] (-1306.887) (-1303.130) * (-1302.357) (-1302.942) [-1304.610] (-1300.956) -- 0:01:03
      202500 -- [-1305.336] (-1305.732) (-1305.128) (-1306.445) * (-1300.117) (-1300.333) (-1304.593) [-1299.853] -- 0:01:03
      203000 -- [-1304.848] (-1301.790) (-1307.198) (-1301.346) * (-1307.331) [-1300.283] (-1301.525) (-1300.311) -- 0:01:02
      203500 -- (-1302.082) (-1301.135) (-1303.285) [-1300.765] * (-1302.030) [-1300.150] (-1301.127) (-1302.830) -- 0:01:02
      204000 -- (-1301.053) (-1301.928) [-1305.043] (-1301.765) * (-1302.084) (-1302.578) [-1300.348] (-1301.826) -- 0:01:02
      204500 -- (-1301.257) (-1300.743) (-1301.772) [-1300.759] * [-1300.297] (-1301.777) (-1301.792) (-1301.188) -- 0:01:02
      205000 -- (-1302.723) (-1302.116) [-1300.421] (-1300.869) * (-1301.893) (-1303.531) [-1300.175] (-1300.954) -- 0:01:02

      Average standard deviation of split frequencies: 0.014573

      205500 -- (-1300.755) (-1302.993) [-1301.180] (-1302.199) * (-1301.222) (-1301.342) [-1300.018] (-1300.743) -- 0:01:05
      206000 -- (-1301.011) (-1301.823) (-1301.202) [-1302.198] * (-1301.456) (-1301.648) [-1301.999] (-1302.545) -- 0:01:05
      206500 -- (-1301.394) (-1303.138) [-1301.296] (-1302.775) * [-1302.483] (-1305.924) (-1301.701) (-1304.220) -- 0:01:05
      207000 -- (-1300.908) (-1302.787) [-1302.007] (-1304.897) * (-1304.124) (-1303.461) [-1300.960] (-1302.565) -- 0:01:05
      207500 -- (-1302.109) (-1304.631) (-1306.184) [-1300.453] * (-1303.487) [-1305.760] (-1302.031) (-1303.627) -- 0:01:04
      208000 -- (-1302.916) [-1300.486] (-1306.416) (-1301.469) * (-1302.059) [-1300.011] (-1303.201) (-1303.035) -- 0:01:04
      208500 -- (-1300.907) (-1300.379) (-1302.999) [-1301.369] * (-1301.116) [-1300.825] (-1301.389) (-1303.466) -- 0:01:04
      209000 -- (-1304.867) [-1300.660] (-1302.951) (-1301.059) * (-1300.025) (-1310.333) [-1301.652] (-1306.725) -- 0:01:04
      209500 -- (-1305.586) (-1302.212) [-1302.051] (-1301.333) * [-1299.974] (-1309.802) (-1300.820) (-1303.494) -- 0:01:04
      210000 -- (-1302.879) (-1303.974) (-1300.745) [-1301.346] * (-1301.330) [-1303.212] (-1305.015) (-1305.698) -- 0:01:03

      Average standard deviation of split frequencies: 0.014839

      210500 -- (-1304.942) [-1299.945] (-1302.600) (-1300.990) * [-1301.350] (-1300.930) (-1301.974) (-1306.338) -- 0:01:03
      211000 -- (-1302.253) (-1299.887) [-1303.753] (-1302.748) * (-1302.533) (-1303.459) [-1300.512] (-1302.940) -- 0:01:03
      211500 -- [-1302.515] (-1299.876) (-1301.225) (-1301.127) * (-1302.668) (-1302.288) [-1304.358] (-1300.023) -- 0:01:03
      212000 -- [-1300.081] (-1305.394) (-1301.251) (-1300.319) * (-1304.800) (-1302.677) (-1304.455) [-1301.014] -- 0:01:03
      212500 -- [-1300.286] (-1301.320) (-1300.603) (-1302.383) * [-1302.134] (-1304.832) (-1304.841) (-1300.412) -- 0:01:03
      213000 -- (-1303.318) (-1300.485) (-1300.809) [-1301.021] * [-1307.410] (-1302.266) (-1301.530) (-1301.885) -- 0:01:02
      213500 -- (-1303.217) [-1302.583] (-1300.969) (-1300.820) * [-1303.240] (-1304.006) (-1303.211) (-1300.702) -- 0:01:02
      214000 -- (-1300.351) (-1302.414) (-1301.556) [-1306.765] * (-1301.287) [-1303.483] (-1304.178) (-1301.808) -- 0:01:02
      214500 -- (-1300.579) (-1301.003) (-1301.191) [-1305.340] * [-1299.736] (-1302.029) (-1305.270) (-1301.801) -- 0:01:02
      215000 -- [-1301.496] (-1301.123) (-1302.941) (-1301.529) * [-1299.724] (-1302.082) (-1303.276) (-1300.901) -- 0:01:02

      Average standard deviation of split frequencies: 0.015507

      215500 -- (-1302.189) [-1303.190] (-1303.382) (-1301.372) * [-1302.936] (-1301.932) (-1303.322) (-1301.856) -- 0:01:01
      216000 -- (-1302.055) [-1300.503] (-1305.370) (-1302.169) * (-1300.739) [-1300.912] (-1312.031) (-1301.020) -- 0:01:01
      216500 -- [-1303.222] (-1306.920) (-1305.277) (-1300.964) * (-1300.285) [-1300.888] (-1303.341) (-1301.731) -- 0:01:01
      217000 -- (-1301.826) (-1303.757) (-1300.588) [-1300.241] * [-1300.373] (-1301.112) (-1300.903) (-1302.639) -- 0:01:01
      217500 -- (-1301.879) (-1303.932) (-1301.458) [-1300.212] * [-1302.227] (-1302.273) (-1300.395) (-1302.091) -- 0:01:01
      218000 -- (-1299.807) (-1300.908) (-1303.182) [-1300.556] * (-1308.680) (-1300.439) [-1299.726] (-1304.512) -- 0:01:00
      218500 -- (-1303.669) (-1302.348) [-1301.269] (-1300.870) * (-1300.378) (-1300.421) [-1301.383] (-1302.885) -- 0:01:04
      219000 -- (-1302.961) [-1300.399] (-1302.029) (-1300.184) * (-1303.272) (-1301.375) [-1302.909] (-1308.551) -- 0:01:04
      219500 -- (-1299.613) (-1300.474) [-1304.549] (-1306.823) * (-1308.202) (-1304.106) (-1301.082) [-1305.882] -- 0:01:04
      220000 -- (-1302.063) [-1300.041] (-1303.354) (-1303.475) * (-1305.616) (-1301.412) (-1302.795) [-1306.400] -- 0:01:03

      Average standard deviation of split frequencies: 0.014954

      220500 -- (-1300.019) [-1300.947] (-1302.530) (-1302.390) * (-1300.253) (-1302.745) [-1302.858] (-1303.156) -- 0:01:03
      221000 -- (-1299.899) (-1301.188) (-1307.930) [-1299.517] * (-1301.397) [-1300.759] (-1305.418) (-1304.591) -- 0:01:03
      221500 -- (-1300.427) [-1303.249] (-1303.476) (-1304.778) * (-1300.675) (-1299.724) [-1300.308] (-1300.424) -- 0:01:03
      222000 -- [-1301.082] (-1302.014) (-1305.012) (-1301.393) * (-1303.345) [-1299.743] (-1299.809) (-1301.193) -- 0:01:03
      222500 -- (-1301.371) (-1301.944) [-1301.975] (-1302.134) * [-1300.331] (-1302.234) (-1299.856) (-1305.245) -- 0:01:02
      223000 -- (-1300.528) (-1300.824) [-1302.510] (-1301.171) * [-1300.095] (-1303.897) (-1300.836) (-1301.970) -- 0:01:02
      223500 -- (-1305.737) [-1300.955] (-1302.002) (-1303.493) * [-1300.554] (-1304.260) (-1301.858) (-1303.058) -- 0:01:02
      224000 -- (-1303.363) (-1301.938) (-1303.161) [-1301.168] * [-1300.040] (-1303.988) (-1301.624) (-1304.290) -- 0:01:02
      224500 -- (-1303.592) (-1302.470) (-1299.592) [-1303.773] * (-1300.288) [-1303.940] (-1302.950) (-1303.718) -- 0:01:02
      225000 -- (-1300.909) [-1301.199] (-1300.795) (-1302.247) * [-1300.892] (-1302.238) (-1303.570) (-1303.209) -- 0:01:02

      Average standard deviation of split frequencies: 0.015699

      225500 -- (-1302.121) (-1302.026) [-1300.371] (-1301.743) * (-1300.262) (-1302.787) [-1305.115] (-1301.363) -- 0:01:01
      226000 -- [-1300.075] (-1302.898) (-1300.009) (-1301.792) * (-1300.172) (-1308.313) (-1302.203) [-1300.039] -- 0:01:01
      226500 -- (-1300.184) [-1301.296] (-1300.821) (-1303.824) * [-1303.331] (-1303.711) (-1300.401) (-1300.124) -- 0:01:01
      227000 -- (-1301.989) (-1303.029) [-1299.641] (-1301.140) * (-1300.681) (-1303.459) [-1300.446] (-1300.588) -- 0:01:01
      227500 -- (-1301.819) (-1301.819) (-1302.410) [-1301.033] * (-1301.287) (-1303.249) [-1300.392] (-1300.627) -- 0:01:01
      228000 -- [-1301.589] (-1300.312) (-1300.853) (-1299.828) * [-1300.195] (-1304.838) (-1300.867) (-1300.463) -- 0:01:00
      228500 -- [-1300.569] (-1300.069) (-1308.701) (-1303.962) * (-1300.238) (-1307.892) [-1300.864] (-1304.956) -- 0:01:00
      229000 -- (-1302.082) (-1304.967) [-1302.895] (-1301.818) * [-1300.228] (-1302.798) (-1302.863) (-1300.496) -- 0:01:00
      229500 -- (-1302.445) (-1307.080) [-1302.631] (-1301.986) * (-1300.340) (-1303.851) (-1302.234) [-1300.589] -- 0:01:00
      230000 -- (-1302.141) (-1304.394) [-1300.009] (-1304.747) * (-1301.320) [-1303.991] (-1302.456) (-1302.698) -- 0:01:00

      Average standard deviation of split frequencies: 0.016962

      230500 -- (-1304.895) (-1303.043) (-1300.177) [-1301.572] * (-1302.016) (-1300.687) (-1301.997) [-1300.870] -- 0:01:00
      231000 -- (-1302.856) (-1301.028) [-1301.317] (-1300.563) * [-1307.781] (-1304.437) (-1301.856) (-1302.188) -- 0:00:59
      231500 -- [-1301.259] (-1300.075) (-1302.294) (-1300.085) * (-1302.427) [-1299.718] (-1303.193) (-1301.671) -- 0:00:59
      232000 -- (-1300.454) (-1300.985) (-1301.239) [-1300.127] * (-1302.964) (-1299.876) [-1302.866] (-1301.871) -- 0:01:02
      232500 -- (-1302.160) [-1301.500] (-1305.130) (-1305.588) * [-1302.454] (-1300.054) (-1301.771) (-1300.775) -- 0:01:02
      233000 -- [-1301.737] (-1301.631) (-1304.511) (-1302.942) * [-1304.870] (-1299.693) (-1300.826) (-1300.777) -- 0:01:02
      233500 -- (-1302.010) [-1304.457] (-1303.754) (-1301.894) * (-1300.872) [-1300.686] (-1302.237) (-1300.510) -- 0:01:02
      234000 -- (-1301.885) [-1301.586] (-1306.459) (-1303.900) * [-1302.984] (-1300.501) (-1300.741) (-1301.754) -- 0:01:02
      234500 -- (-1302.553) (-1304.345) [-1301.851] (-1301.945) * [-1303.060] (-1300.502) (-1304.949) (-1300.550) -- 0:01:02
      235000 -- (-1300.672) (-1300.953) [-1300.394] (-1301.785) * (-1304.082) (-1301.854) [-1304.744] (-1300.275) -- 0:01:01

      Average standard deviation of split frequencies: 0.015664

      235500 -- (-1302.661) (-1301.842) [-1302.125] (-1300.130) * [-1304.490] (-1304.289) (-1301.204) (-1300.635) -- 0:01:01
      236000 -- [-1301.893] (-1305.432) (-1299.601) (-1300.324) * (-1302.050) (-1301.269) [-1299.946] (-1301.899) -- 0:01:01
      236500 -- (-1301.924) (-1302.942) (-1301.157) [-1300.091] * [-1302.277] (-1304.744) (-1299.518) (-1309.706) -- 0:01:01
      237000 -- [-1303.614] (-1302.579) (-1299.645) (-1300.042) * (-1302.813) (-1305.607) (-1302.153) [-1303.192] -- 0:01:01
      237500 -- [-1302.527] (-1304.868) (-1300.109) (-1301.264) * (-1302.495) (-1301.550) (-1302.539) [-1303.190] -- 0:01:01
      238000 -- (-1304.311) (-1302.424) (-1300.594) [-1299.864] * (-1303.588) (-1301.185) [-1300.814] (-1304.910) -- 0:01:00
      238500 -- (-1301.941) (-1303.052) (-1301.169) [-1299.612] * (-1304.238) [-1301.241] (-1301.797) (-1304.882) -- 0:01:00
      239000 -- [-1302.041] (-1301.455) (-1302.516) (-1303.270) * (-1305.160) (-1301.093) (-1304.630) [-1304.165] -- 0:01:00
      239500 -- [-1302.470] (-1302.215) (-1305.916) (-1304.053) * [-1299.892] (-1302.101) (-1303.070) (-1304.202) -- 0:01:00
      240000 -- (-1304.459) (-1302.718) [-1300.598] (-1303.720) * (-1300.977) [-1302.013] (-1303.367) (-1303.896) -- 0:01:00

      Average standard deviation of split frequencies: 0.012841

      240500 -- (-1304.555) (-1303.556) [-1299.711] (-1303.358) * (-1305.436) (-1305.094) (-1301.252) [-1300.275] -- 0:01:00
      241000 -- (-1302.076) (-1303.338) [-1299.990] (-1301.990) * (-1301.521) (-1302.269) [-1301.351] (-1301.532) -- 0:00:59
      241500 -- (-1301.603) [-1302.070] (-1301.721) (-1305.507) * (-1302.450) [-1304.827] (-1302.749) (-1300.367) -- 0:00:59
      242000 -- [-1301.935] (-1303.210) (-1304.648) (-1302.231) * [-1301.777] (-1301.661) (-1301.522) (-1300.201) -- 0:00:59
      242500 -- (-1300.942) (-1302.690) [-1303.781] (-1299.760) * [-1301.824] (-1302.678) (-1302.873) (-1300.611) -- 0:00:59
      243000 -- (-1300.637) (-1301.603) [-1303.233] (-1302.867) * (-1301.695) (-1301.609) (-1302.790) [-1300.371] -- 0:00:59
      243500 -- (-1300.019) (-1300.520) [-1301.338] (-1301.733) * [-1301.386] (-1303.434) (-1305.216) (-1303.041) -- 0:00:59
      244000 -- (-1300.581) [-1301.711] (-1303.065) (-1301.193) * (-1302.676) [-1301.352] (-1300.582) (-1302.642) -- 0:00:58
      244500 -- (-1303.064) [-1300.584] (-1302.628) (-1303.199) * [-1302.871] (-1306.517) (-1302.369) (-1303.836) -- 0:00:58
      245000 -- [-1301.451] (-1300.527) (-1301.632) (-1302.075) * [-1301.563] (-1301.903) (-1302.572) (-1303.638) -- 0:00:58

      Average standard deviation of split frequencies: 0.013095

      245500 -- (-1305.115) [-1300.195] (-1302.429) (-1301.651) * [-1300.388] (-1299.879) (-1302.750) (-1303.026) -- 0:01:01
      246000 -- [-1300.739] (-1303.407) (-1300.124) (-1301.586) * (-1301.317) [-1301.776] (-1301.419) (-1303.097) -- 0:01:01
      246500 -- [-1301.127] (-1301.200) (-1300.893) (-1302.481) * (-1301.003) [-1300.379] (-1301.112) (-1302.886) -- 0:01:01
      247000 -- (-1301.099) (-1300.336) [-1301.324] (-1301.159) * [-1299.886] (-1302.965) (-1300.390) (-1301.573) -- 0:01:00
      247500 -- (-1303.725) [-1300.450] (-1300.890) (-1302.973) * [-1300.662] (-1306.024) (-1303.378) (-1300.932) -- 0:01:00
      248000 -- (-1302.548) (-1300.389) (-1301.685) [-1302.722] * (-1301.410) (-1304.217) (-1304.551) [-1300.941] -- 0:01:00
      248500 -- (-1301.473) (-1300.370) [-1304.201] (-1302.259) * (-1300.627) (-1301.731) [-1300.193] (-1301.752) -- 0:01:00
      249000 -- (-1300.838) (-1302.050) (-1302.474) [-1300.990] * (-1302.807) [-1301.602] (-1301.800) (-1302.593) -- 0:01:00
      249500 -- (-1304.765) [-1302.775] (-1302.406) (-1300.200) * (-1300.158) [-1303.956] (-1302.729) (-1302.133) -- 0:01:00
      250000 -- (-1307.326) [-1301.916] (-1303.186) (-1299.522) * (-1299.661) (-1302.042) [-1301.892] (-1305.742) -- 0:01:00

      Average standard deviation of split frequencies: 0.014160

      250500 -- (-1304.283) [-1301.946] (-1303.985) (-1299.652) * (-1299.872) (-1299.892) (-1303.875) [-1303.667] -- 0:00:59
      251000 -- (-1302.764) (-1301.447) (-1302.907) [-1301.409] * (-1299.709) (-1301.628) [-1301.897] (-1307.454) -- 0:00:59
      251500 -- [-1299.513] (-1301.663) (-1302.830) (-1302.969) * (-1301.018) [-1302.396] (-1303.123) (-1302.263) -- 0:00:59
      252000 -- (-1300.058) (-1302.923) [-1303.686] (-1302.258) * [-1305.010] (-1299.940) (-1304.794) (-1301.862) -- 0:00:59
      252500 -- [-1301.509] (-1300.517) (-1300.425) (-1300.293) * (-1306.081) (-1300.778) (-1302.720) [-1303.573] -- 0:00:59
      253000 -- (-1300.481) (-1301.101) [-1299.925] (-1300.616) * [-1306.373] (-1302.707) (-1304.283) (-1304.546) -- 0:00:59
      253500 -- (-1301.881) (-1300.416) [-1300.666] (-1302.381) * (-1302.090) (-1300.354) [-1301.511] (-1300.853) -- 0:00:58
      254000 -- (-1300.549) (-1303.790) [-1300.010] (-1299.663) * (-1301.870) [-1300.102] (-1304.810) (-1302.204) -- 0:00:58
      254500 -- (-1301.027) [-1304.765] (-1300.512) (-1304.642) * (-1300.856) (-1301.467) [-1300.936] (-1302.658) -- 0:00:58
      255000 -- (-1300.899) [-1313.138] (-1301.480) (-1310.137) * (-1304.497) (-1300.947) (-1300.500) [-1302.969] -- 0:00:58

      Average standard deviation of split frequencies: 0.014840

      255500 -- (-1300.899) (-1304.462) [-1300.653] (-1306.282) * (-1300.687) (-1302.040) (-1302.204) [-1300.954] -- 0:00:58
      256000 -- (-1300.730) [-1304.098] (-1300.720) (-1301.768) * (-1299.885) (-1300.812) [-1301.849] (-1303.418) -- 0:00:58
      256500 -- (-1301.945) (-1301.963) (-1301.701) [-1300.411] * (-1303.507) [-1301.565] (-1302.673) (-1304.720) -- 0:00:57
      257000 -- [-1300.009] (-1302.972) (-1301.379) (-1303.430) * [-1302.863] (-1299.983) (-1301.392) (-1302.588) -- 0:00:57
      257500 -- (-1299.860) (-1306.167) (-1301.020) [-1303.410] * (-1304.849) [-1300.617] (-1301.744) (-1305.223) -- 0:00:57
      258000 -- [-1299.801] (-1300.803) (-1300.920) (-1301.440) * (-1301.536) [-1300.678] (-1301.127) (-1301.046) -- 0:00:57
      258500 -- (-1300.494) [-1301.210] (-1304.790) (-1301.772) * (-1301.845) (-1310.914) [-1300.221] (-1301.173) -- 0:00:57
      259000 -- (-1300.193) [-1301.764] (-1303.212) (-1301.802) * (-1301.881) (-1303.145) [-1301.653] (-1303.801) -- 0:01:00
      259500 -- (-1303.127) (-1301.291) [-1301.833] (-1302.075) * (-1302.688) (-1302.549) [-1301.455] (-1305.439) -- 0:00:59
      260000 -- (-1305.273) (-1302.992) [-1303.559] (-1301.369) * (-1303.666) (-1302.828) [-1302.726] (-1301.803) -- 0:00:59

      Average standard deviation of split frequencies: 0.016063

      260500 -- (-1300.975) (-1301.332) (-1304.137) [-1302.028] * (-1302.490) (-1300.584) (-1302.673) [-1300.115] -- 0:00:59
      261000 -- (-1301.245) (-1300.472) [-1304.614] (-1301.141) * (-1303.425) [-1302.072] (-1303.301) (-1301.139) -- 0:00:59
      261500 -- [-1301.642] (-1300.509) (-1306.260) (-1303.484) * (-1299.989) (-1301.030) [-1300.509] (-1306.404) -- 0:00:59
      262000 -- (-1303.857) (-1301.450) [-1302.259] (-1302.161) * [-1300.559] (-1299.505) (-1300.929) (-1305.555) -- 0:00:59
      262500 -- (-1304.698) (-1301.437) (-1303.322) [-1300.548] * (-1304.029) (-1300.484) [-1301.500] (-1303.540) -- 0:00:59
      263000 -- (-1300.171) (-1303.375) [-1303.730] (-1300.501) * (-1302.682) (-1303.537) [-1300.909] (-1299.644) -- 0:00:58
      263500 -- [-1300.068] (-1302.145) (-1300.476) (-1301.608) * (-1302.653) (-1301.306) [-1301.373] (-1299.837) -- 0:00:58
      264000 -- (-1300.652) (-1301.396) (-1301.201) [-1301.084] * (-1302.335) [-1304.413] (-1300.959) (-1303.006) -- 0:00:58
      264500 -- [-1301.756] (-1300.359) (-1306.569) (-1301.595) * [-1301.139] (-1302.686) (-1302.418) (-1302.185) -- 0:00:58
      265000 -- [-1301.533] (-1302.431) (-1305.894) (-1300.316) * (-1306.808) (-1306.786) (-1301.271) [-1302.198] -- 0:00:58

      Average standard deviation of split frequencies: 0.014907

      265500 -- (-1300.975) [-1303.099] (-1304.998) (-1301.957) * (-1301.893) (-1302.224) (-1300.631) [-1303.274] -- 0:00:58
      266000 -- (-1301.741) [-1302.490] (-1302.349) (-1304.425) * (-1300.374) [-1299.807] (-1305.960) (-1301.720) -- 0:00:57
      266500 -- (-1302.038) (-1303.298) (-1300.148) [-1306.423] * (-1302.737) (-1305.405) [-1301.891] (-1303.564) -- 0:00:57
      267000 -- (-1300.248) (-1300.347) (-1302.845) [-1300.883] * (-1302.405) [-1301.942] (-1302.753) (-1302.542) -- 0:00:57
      267500 -- [-1300.273] (-1300.983) (-1301.910) (-1303.888) * (-1301.034) (-1305.442) [-1300.143] (-1303.037) -- 0:00:57
      268000 -- [-1301.537] (-1303.394) (-1300.491) (-1299.674) * (-1312.527) (-1303.859) [-1303.311] (-1302.078) -- 0:00:57
      268500 -- (-1301.340) (-1302.510) [-1301.387] (-1299.755) * (-1301.037) (-1304.279) [-1303.173] (-1300.065) -- 0:00:57
      269000 -- (-1301.492) (-1301.682) (-1304.645) [-1303.794] * (-1300.836) (-1302.942) [-1303.488] (-1301.792) -- 0:00:57
      269500 -- (-1307.636) (-1303.611) (-1303.954) [-1301.857] * [-1300.912] (-1299.906) (-1307.439) (-1301.733) -- 0:00:56
      270000 -- (-1302.427) (-1301.551) (-1303.195) [-1300.862] * (-1300.401) [-1301.719] (-1303.883) (-1303.111) -- 0:00:56

      Average standard deviation of split frequencies: 0.015965

      270500 -- (-1302.380) (-1300.655) [-1301.817] (-1303.222) * (-1300.224) (-1305.044) [-1301.717] (-1300.998) -- 0:00:56
      271000 -- (-1302.037) [-1300.202] (-1300.828) (-1302.751) * (-1305.351) [-1303.996] (-1300.497) (-1315.240) -- 0:00:56
      271500 -- (-1301.431) (-1301.032) (-1300.419) [-1301.232] * (-1300.703) (-1302.338) (-1300.306) [-1302.830] -- 0:00:56
      272000 -- (-1301.097) (-1299.877) (-1300.983) [-1302.251] * [-1300.586] (-1300.339) (-1300.622) (-1302.523) -- 0:00:56
      272500 -- (-1305.086) (-1300.795) [-1301.917] (-1304.691) * (-1299.753) (-1300.731) (-1299.923) [-1301.724] -- 0:00:58
      273000 -- (-1308.497) (-1304.276) (-1301.931) [-1303.523] * (-1303.387) (-1304.259) (-1300.610) [-1301.892] -- 0:00:58
      273500 -- (-1305.017) [-1301.503] (-1300.966) (-1299.839) * (-1302.640) (-1302.899) (-1300.066) [-1302.475] -- 0:00:58
      274000 -- (-1301.438) (-1301.729) [-1300.233] (-1299.971) * (-1300.513) (-1303.932) [-1302.713] (-1300.923) -- 0:00:58
      274500 -- (-1300.363) (-1302.720) [-1302.614] (-1304.107) * [-1302.811] (-1300.831) (-1302.465) (-1301.207) -- 0:00:58
      275000 -- [-1299.966] (-1305.656) (-1300.703) (-1301.964) * (-1305.845) (-1303.562) (-1302.609) [-1304.151] -- 0:00:58

      Average standard deviation of split frequencies: 0.015673

      275500 -- (-1300.541) (-1302.815) (-1300.813) [-1302.930] * [-1303.592] (-1307.760) (-1301.992) (-1306.005) -- 0:00:57
      276000 -- (-1299.785) (-1302.444) [-1300.849] (-1304.953) * [-1301.199] (-1301.128) (-1305.643) (-1303.411) -- 0:00:57
      276500 -- (-1299.721) (-1300.121) [-1300.943] (-1302.762) * (-1301.683) (-1302.094) (-1302.947) [-1300.743] -- 0:00:57
      277000 -- (-1299.947) (-1301.499) (-1301.027) [-1302.396] * (-1302.311) (-1302.048) (-1302.637) [-1300.199] -- 0:00:57
      277500 -- (-1302.066) (-1301.997) (-1304.480) [-1302.153] * (-1301.919) (-1302.970) [-1302.156] (-1301.250) -- 0:00:57
      278000 -- [-1305.047] (-1302.891) (-1302.726) (-1302.367) * (-1302.328) [-1301.353] (-1302.749) (-1303.869) -- 0:00:57
      278500 -- (-1299.770) (-1300.826) [-1300.796] (-1303.537) * (-1302.592) (-1300.313) [-1303.829] (-1302.633) -- 0:00:56
      279000 -- [-1301.961] (-1300.669) (-1301.905) (-1300.627) * (-1303.712) [-1300.575] (-1305.922) (-1303.946) -- 0:00:56
      279500 -- [-1299.508] (-1301.940) (-1302.442) (-1301.577) * [-1300.536] (-1301.297) (-1306.349) (-1304.053) -- 0:00:56
      280000 -- (-1301.459) (-1305.026) [-1301.855] (-1302.940) * (-1300.125) (-1302.955) (-1305.151) [-1301.524] -- 0:00:56

      Average standard deviation of split frequencies: 0.015808

      280500 -- (-1303.654) [-1305.191] (-1299.694) (-1304.204) * (-1302.906) [-1300.428] (-1300.607) (-1302.040) -- 0:00:56
      281000 -- (-1302.833) [-1302.192] (-1303.912) (-1302.383) * (-1299.790) (-1300.449) [-1301.749] (-1302.617) -- 0:00:56
      281500 -- [-1302.318] (-1301.604) (-1301.884) (-1300.073) * (-1303.413) (-1301.264) [-1301.214] (-1304.123) -- 0:00:56
      282000 -- (-1301.768) (-1304.727) (-1301.934) [-1302.887] * (-1301.764) (-1303.092) [-1301.234] (-1303.816) -- 0:00:56
      282500 -- [-1301.584] (-1301.723) (-1300.262) (-1301.636) * (-1300.238) (-1303.992) [-1300.396] (-1305.272) -- 0:00:55
      283000 -- (-1300.316) [-1300.266] (-1301.415) (-1301.054) * (-1302.067) (-1301.883) [-1300.783] (-1304.198) -- 0:00:55
      283500 -- (-1300.202) (-1300.298) (-1300.151) [-1302.273] * [-1302.416] (-1302.986) (-1303.668) (-1300.901) -- 0:00:55
      284000 -- [-1301.560] (-1302.213) (-1300.086) (-1302.187) * (-1301.933) (-1301.212) [-1301.634] (-1300.681) -- 0:00:55
      284500 -- (-1301.688) [-1304.557] (-1300.958) (-1306.418) * [-1301.349] (-1301.786) (-1303.649) (-1300.273) -- 0:00:55
      285000 -- (-1302.544) (-1303.537) [-1299.863] (-1301.225) * [-1301.749] (-1299.940) (-1305.733) (-1302.781) -- 0:00:55

      Average standard deviation of split frequencies: 0.016222

      285500 -- (-1303.588) [-1302.630] (-1304.975) (-1300.337) * [-1301.562] (-1303.192) (-1302.614) (-1300.492) -- 0:00:57
      286000 -- (-1301.253) [-1303.400] (-1300.596) (-1302.609) * (-1300.482) (-1301.094) [-1304.180] (-1303.693) -- 0:00:57
      286500 -- (-1302.879) [-1301.279] (-1300.204) (-1300.554) * [-1301.441] (-1299.872) (-1305.511) (-1302.999) -- 0:00:57
      287000 -- (-1303.355) (-1302.969) [-1303.008] (-1300.015) * (-1307.866) (-1301.276) [-1301.289] (-1303.353) -- 0:00:57
      287500 -- [-1303.422] (-1300.222) (-1302.106) (-1302.704) * (-1302.959) (-1300.231) (-1303.281) [-1302.209] -- 0:00:57
      288000 -- [-1301.932] (-1300.261) (-1302.060) (-1302.005) * (-1300.057) [-1300.727] (-1300.260) (-1304.318) -- 0:00:56
      288500 -- [-1301.976] (-1301.203) (-1302.070) (-1304.350) * (-1300.617) [-1300.772] (-1301.816) (-1306.646) -- 0:00:56
      289000 -- [-1303.628] (-1301.570) (-1302.408) (-1302.422) * (-1300.403) (-1300.048) [-1300.935] (-1305.907) -- 0:00:56
      289500 -- (-1302.945) (-1300.253) (-1299.646) [-1303.259] * [-1301.639] (-1303.975) (-1300.221) (-1303.016) -- 0:00:56
      290000 -- (-1300.864) [-1299.761] (-1300.083) (-1303.635) * (-1308.578) [-1300.798] (-1300.361) (-1300.926) -- 0:00:56

      Average standard deviation of split frequencies: 0.013928

      290500 -- [-1301.385] (-1301.172) (-1299.475) (-1302.187) * [-1301.805] (-1301.642) (-1302.152) (-1301.029) -- 0:00:56
      291000 -- (-1301.328) [-1300.652] (-1299.475) (-1303.024) * (-1307.397) (-1301.597) (-1305.168) [-1301.814] -- 0:00:56
      291500 -- (-1301.340) [-1303.038] (-1299.475) (-1302.050) * (-1304.853) (-1301.097) (-1302.448) [-1301.143] -- 0:00:55
      292000 -- (-1302.156) [-1301.521] (-1300.515) (-1302.994) * [-1303.709] (-1301.106) (-1301.661) (-1300.580) -- 0:00:55
      292500 -- (-1302.351) (-1301.645) (-1299.543) [-1300.726] * (-1301.433) [-1304.251] (-1301.031) (-1305.347) -- 0:00:55
      293000 -- (-1299.908) (-1301.828) [-1299.898] (-1300.856) * (-1301.184) (-1303.649) (-1300.727) [-1306.689] -- 0:00:55
      293500 -- [-1301.400] (-1305.113) (-1305.540) (-1300.429) * (-1300.236) (-1305.969) (-1300.262) [-1304.188] -- 0:00:55
      294000 -- (-1300.057) (-1302.743) (-1301.561) [-1302.634] * (-1300.081) (-1302.498) (-1300.507) [-1299.952] -- 0:00:55
      294500 -- (-1301.374) [-1300.697] (-1302.252) (-1301.363) * [-1301.844] (-1302.015) (-1301.085) (-1301.508) -- 0:00:55
      295000 -- (-1302.295) (-1301.418) [-1301.116] (-1303.933) * (-1302.589) [-1301.518] (-1300.054) (-1302.927) -- 0:00:54

      Average standard deviation of split frequencies: 0.015041

      295500 -- (-1302.054) (-1303.387) [-1302.584] (-1303.021) * [-1301.157] (-1303.283) (-1303.934) (-1306.954) -- 0:00:54
      296000 -- [-1300.241] (-1300.995) (-1301.143) (-1304.461) * (-1300.575) (-1304.201) [-1301.670] (-1303.302) -- 0:00:54
      296500 -- (-1300.683) [-1301.410] (-1302.075) (-1301.768) * (-1301.890) (-1302.294) (-1300.659) [-1300.111] -- 0:00:54
      297000 -- [-1300.382] (-1301.338) (-1301.131) (-1301.751) * (-1303.547) (-1302.379) (-1301.395) [-1302.934] -- 0:00:54
      297500 -- (-1301.561) (-1303.609) (-1302.780) [-1300.863] * [-1301.997] (-1303.198) (-1301.395) (-1301.421) -- 0:00:54
      298000 -- (-1301.332) [-1300.848] (-1306.919) (-1302.164) * (-1301.079) (-1300.756) (-1302.057) [-1299.852] -- 0:00:54
      298500 -- [-1302.098] (-1301.868) (-1301.489) (-1303.403) * (-1301.317) [-1300.723] (-1301.422) (-1301.642) -- 0:00:54
      299000 -- (-1301.671) (-1301.615) (-1305.872) [-1301.235] * [-1301.396] (-1300.477) (-1302.305) (-1300.766) -- 0:00:56
      299500 -- (-1301.951) (-1300.746) [-1300.585] (-1302.786) * (-1305.517) (-1304.725) [-1300.646] (-1300.613) -- 0:00:56
      300000 -- [-1304.252] (-1301.886) (-1300.658) (-1303.956) * (-1302.557) (-1306.825) [-1301.411] (-1299.878) -- 0:00:56

      Average standard deviation of split frequencies: 0.013004

      300500 -- [-1302.711] (-1299.803) (-1299.528) (-1300.198) * (-1301.304) (-1301.566) [-1301.303] (-1299.891) -- 0:00:55
      301000 -- (-1301.520) (-1302.770) [-1304.922] (-1300.243) * [-1301.406] (-1301.396) (-1301.075) (-1301.543) -- 0:00:55
      301500 -- (-1301.963) [-1301.930] (-1303.298) (-1303.700) * [-1305.693] (-1301.936) (-1300.981) (-1303.010) -- 0:00:55
      302000 -- [-1300.701] (-1303.708) (-1303.517) (-1303.934) * (-1305.336) [-1301.051] (-1302.539) (-1303.175) -- 0:00:55
      302500 -- (-1303.148) (-1302.856) (-1302.762) [-1300.452] * [-1303.185] (-1303.086) (-1301.129) (-1301.619) -- 0:00:55
      303000 -- (-1303.342) [-1300.828] (-1302.008) (-1304.805) * (-1302.156) (-1302.830) [-1300.802] (-1301.902) -- 0:00:55
      303500 -- [-1303.836] (-1300.336) (-1303.756) (-1300.885) * [-1301.618] (-1301.855) (-1302.833) (-1303.371) -- 0:00:55
      304000 -- (-1303.601) (-1300.365) [-1304.114] (-1302.536) * (-1300.731) [-1299.969] (-1302.768) (-1303.252) -- 0:00:54
      304500 -- [-1301.265] (-1300.536) (-1301.534) (-1302.489) * (-1304.145) (-1301.169) (-1300.997) [-1301.957] -- 0:00:54
      305000 -- (-1300.209) (-1301.942) (-1300.667) [-1302.646] * (-1308.551) [-1301.132] (-1302.327) (-1300.517) -- 0:00:54

      Average standard deviation of split frequencies: 0.013608

      305500 -- [-1300.084] (-1300.871) (-1302.015) (-1302.112) * [-1312.567] (-1300.822) (-1300.241) (-1300.794) -- 0:00:54
      306000 -- [-1301.025] (-1301.044) (-1301.948) (-1301.614) * (-1309.988) (-1300.846) (-1300.201) [-1300.642] -- 0:00:54
      306500 -- (-1300.060) (-1300.983) (-1307.403) [-1301.139] * (-1306.164) (-1308.773) [-1303.600] (-1302.955) -- 0:00:54
      307000 -- [-1300.346] (-1307.714) (-1308.142) (-1303.990) * (-1306.004) (-1303.149) (-1303.458) [-1299.645] -- 0:00:54
      307500 -- (-1302.772) [-1305.332] (-1306.148) (-1303.354) * (-1304.759) (-1302.561) [-1302.459] (-1301.111) -- 0:00:54
      308000 -- [-1302.107] (-1302.496) (-1303.791) (-1305.373) * [-1301.909] (-1302.965) (-1307.754) (-1300.330) -- 0:00:53
      308500 -- [-1305.067] (-1302.985) (-1301.955) (-1302.722) * (-1299.913) (-1303.155) (-1304.755) [-1300.711] -- 0:00:53
      309000 -- (-1306.385) (-1300.244) (-1300.661) [-1299.755] * (-1301.262) [-1301.850] (-1301.374) (-1301.302) -- 0:00:53
      309500 -- (-1306.335) (-1302.285) (-1301.237) [-1303.316] * (-1301.275) [-1302.484] (-1301.319) (-1302.673) -- 0:00:53
      310000 -- [-1302.427] (-1303.538) (-1300.594) (-1302.975) * (-1300.696) [-1301.873] (-1303.707) (-1301.525) -- 0:00:53

      Average standard deviation of split frequencies: 0.012645

      310500 -- (-1302.723) (-1300.287) (-1300.948) [-1302.605] * (-1304.597) [-1303.038] (-1304.113) (-1300.891) -- 0:00:53
      311000 -- (-1302.377) [-1301.768] (-1302.247) (-1304.191) * (-1304.595) (-1301.130) [-1304.669] (-1303.347) -- 0:00:53
      311500 -- (-1302.406) (-1300.546) (-1300.991) [-1301.408] * [-1300.600] (-1300.604) (-1301.344) (-1302.577) -- 0:00:55
      312000 -- (-1303.566) (-1302.555) [-1302.811] (-1306.905) * (-1300.348) [-1301.297] (-1300.378) (-1300.912) -- 0:00:55
      312500 -- [-1301.018] (-1304.866) (-1301.565) (-1305.163) * [-1301.308] (-1301.894) (-1301.406) (-1303.371) -- 0:00:55
      313000 -- (-1300.510) (-1302.414) [-1302.116] (-1304.819) * [-1302.779] (-1300.904) (-1303.119) (-1302.891) -- 0:00:54
      313500 -- (-1303.915) [-1300.809] (-1304.474) (-1304.364) * [-1301.740] (-1302.413) (-1302.825) (-1302.272) -- 0:00:54
      314000 -- (-1305.161) (-1302.699) [-1304.161] (-1302.572) * [-1300.085] (-1301.446) (-1303.138) (-1301.154) -- 0:00:54
      314500 -- (-1301.974) [-1302.619] (-1303.669) (-1306.351) * (-1305.932) (-1304.102) (-1302.228) [-1299.826] -- 0:00:54
      315000 -- (-1299.988) (-1302.455) (-1300.697) [-1304.242] * [-1300.973] (-1308.807) (-1301.477) (-1300.643) -- 0:00:54

      Average standard deviation of split frequencies: 0.011759

      315500 -- (-1305.887) [-1303.084] (-1304.264) (-1302.576) * (-1302.084) (-1304.191) [-1302.707] (-1299.850) -- 0:00:54
      316000 -- (-1305.829) (-1302.989) [-1304.571] (-1301.937) * [-1301.170] (-1302.547) (-1304.464) (-1302.108) -- 0:00:54
      316500 -- (-1300.837) [-1302.737] (-1300.215) (-1301.335) * (-1300.757) [-1304.203] (-1300.844) (-1302.029) -- 0:00:53
      317000 -- (-1301.333) [-1300.933] (-1300.096) (-1300.834) * (-1300.631) (-1304.161) [-1301.553] (-1304.593) -- 0:00:53
      317500 -- (-1300.979) [-1301.278] (-1301.636) (-1302.780) * [-1300.147] (-1300.773) (-1300.865) (-1300.325) -- 0:00:53
      318000 -- (-1300.668) [-1301.244] (-1300.793) (-1301.846) * (-1300.717) [-1300.403] (-1301.464) (-1301.547) -- 0:00:53
      318500 -- [-1300.309] (-1302.208) (-1302.122) (-1303.833) * (-1300.787) (-1301.418) (-1299.765) [-1301.905] -- 0:00:53
      319000 -- [-1301.078] (-1304.679) (-1299.978) (-1309.728) * (-1303.026) [-1303.290] (-1299.702) (-1302.839) -- 0:00:53
      319500 -- (-1305.224) (-1306.430) [-1300.747] (-1304.904) * (-1305.989) (-1303.954) [-1305.753] (-1305.050) -- 0:00:53
      320000 -- (-1300.477) (-1306.190) [-1299.933] (-1300.845) * (-1304.892) (-1301.686) [-1301.082] (-1301.717) -- 0:00:53

      Average standard deviation of split frequencies: 0.011516

      320500 -- (-1299.696) [-1299.902] (-1303.182) (-1304.815) * (-1308.497) [-1301.839] (-1301.243) (-1300.967) -- 0:00:53
      321000 -- (-1300.702) (-1299.902) (-1301.682) [-1301.023] * (-1301.432) (-1301.100) [-1304.358] (-1305.683) -- 0:00:52
      321500 -- [-1300.418] (-1300.374) (-1302.008) (-1300.799) * (-1300.868) (-1303.653) [-1301.333] (-1303.577) -- 0:00:52
      322000 -- [-1300.290] (-1303.995) (-1299.707) (-1310.165) * [-1301.263] (-1304.553) (-1302.665) (-1306.918) -- 0:00:52
      322500 -- (-1301.110) (-1305.997) [-1302.590] (-1312.905) * (-1301.950) [-1304.212] (-1300.996) (-1309.080) -- 0:00:52
      323000 -- [-1302.736] (-1307.874) (-1300.145) (-1304.728) * (-1300.685) (-1303.446) (-1309.926) [-1301.332] -- 0:00:52
      323500 -- (-1303.867) (-1308.208) [-1301.299] (-1302.820) * (-1300.416) (-1304.631) (-1300.902) [-1301.427] -- 0:00:52
      324000 -- (-1301.544) [-1302.195] (-1305.328) (-1303.622) * (-1299.958) (-1301.331) (-1300.913) [-1300.646] -- 0:00:52
      324500 -- (-1305.535) (-1300.538) (-1301.152) [-1302.813] * (-1301.481) (-1300.349) [-1301.193] (-1300.819) -- 0:00:54
      325000 -- (-1301.020) [-1302.080] (-1302.288) (-1303.097) * [-1301.836] (-1300.550) (-1301.109) (-1304.182) -- 0:00:54

      Average standard deviation of split frequencies: 0.012101

      325500 -- (-1300.824) (-1304.823) [-1303.068] (-1302.239) * (-1302.150) (-1302.341) (-1306.332) [-1301.644] -- 0:00:53
      326000 -- (-1303.951) (-1300.770) [-1301.754] (-1303.351) * [-1304.450] (-1303.924) (-1303.429) (-1308.059) -- 0:00:53
      326500 -- (-1302.460) [-1303.906] (-1301.856) (-1306.102) * [-1305.469] (-1303.400) (-1300.181) (-1306.989) -- 0:00:53
      327000 -- (-1300.221) [-1303.564] (-1303.152) (-1304.001) * (-1299.863) (-1301.299) [-1300.647] (-1304.333) -- 0:00:53
      327500 -- (-1303.152) [-1303.199] (-1303.175) (-1304.572) * (-1299.499) (-1304.206) [-1301.414] (-1302.025) -- 0:00:53
      328000 -- [-1300.524] (-1303.414) (-1302.193) (-1300.587) * [-1303.390] (-1303.600) (-1305.906) (-1299.902) -- 0:00:53
      328500 -- (-1301.611) (-1300.795) [-1301.886] (-1301.640) * (-1304.939) (-1303.730) (-1308.171) [-1299.777] -- 0:00:53
      329000 -- (-1300.107) (-1301.337) (-1303.513) [-1301.517] * (-1309.248) (-1303.639) [-1300.568] (-1299.861) -- 0:00:53
      329500 -- (-1299.937) (-1303.623) (-1304.254) [-1300.277] * (-1302.968) [-1302.231] (-1301.704) (-1299.967) -- 0:00:52
      330000 -- (-1303.601) [-1299.955] (-1301.392) (-1299.507) * (-1303.344) (-1300.733) [-1300.228] (-1299.967) -- 0:00:52

      Average standard deviation of split frequencies: 0.014481

      330500 -- (-1306.535) (-1299.949) (-1301.890) [-1303.214] * [-1301.897] (-1301.816) (-1299.804) (-1300.247) -- 0:00:52
      331000 -- [-1301.670] (-1304.570) (-1301.516) (-1305.519) * [-1302.596] (-1303.557) (-1300.727) (-1301.088) -- 0:00:52
      331500 -- (-1303.826) [-1301.011] (-1301.327) (-1304.695) * (-1301.376) (-1300.826) (-1300.381) [-1301.475] -- 0:00:52
      332000 -- (-1301.740) (-1300.905) (-1301.419) [-1300.908] * (-1301.707) [-1299.889] (-1302.393) (-1309.360) -- 0:00:52
      332500 -- (-1302.731) [-1302.200] (-1300.835) (-1300.748) * (-1307.460) (-1303.411) [-1301.518] (-1302.181) -- 0:00:52
      333000 -- (-1309.012) [-1300.684] (-1303.046) (-1301.164) * (-1311.230) (-1303.298) [-1301.576] (-1303.849) -- 0:00:52
      333500 -- (-1299.507) (-1304.152) [-1304.032] (-1301.683) * (-1304.888) (-1302.498) [-1303.823] (-1302.179) -- 0:00:51
      334000 -- [-1300.957] (-1300.350) (-1300.607) (-1306.458) * (-1300.617) (-1300.273) [-1308.674] (-1301.323) -- 0:00:51
      334500 -- (-1300.910) (-1303.504) (-1300.841) [-1301.232] * [-1303.737] (-1299.919) (-1303.047) (-1307.812) -- 0:00:51
      335000 -- [-1301.362] (-1303.405) (-1300.771) (-1303.155) * [-1301.404] (-1301.247) (-1303.021) (-1304.698) -- 0:00:51

      Average standard deviation of split frequencies: 0.015138

      335500 -- [-1300.348] (-1302.568) (-1301.128) (-1299.802) * (-1300.907) (-1300.255) [-1300.062] (-1300.590) -- 0:00:51
      336000 -- (-1301.030) (-1302.093) (-1302.194) [-1302.033] * (-1301.393) (-1300.204) [-1302.562] (-1302.262) -- 0:00:51
      336500 -- (-1305.533) (-1302.996) (-1303.188) [-1301.270] * (-1304.496) (-1303.379) (-1301.800) [-1301.999] -- 0:00:51
      337000 -- (-1300.963) [-1301.184] (-1301.755) (-1301.847) * (-1302.517) (-1300.835) [-1303.180] (-1304.840) -- 0:00:51
      337500 -- (-1303.217) (-1303.694) [-1304.474] (-1301.236) * [-1305.918] (-1301.256) (-1305.183) (-1302.816) -- 0:00:51
      338000 -- (-1302.109) [-1303.479] (-1301.546) (-1301.130) * (-1304.148) (-1301.871) (-1303.702) [-1303.894] -- 0:00:52
      338500 -- [-1302.355] (-1303.470) (-1300.766) (-1300.911) * (-1301.720) (-1303.685) (-1304.810) [-1305.456] -- 0:00:52
      339000 -- (-1301.082) [-1301.462] (-1303.086) (-1301.953) * [-1302.440] (-1299.864) (-1300.241) (-1306.454) -- 0:00:52
      339500 -- (-1301.449) (-1301.774) [-1300.202] (-1302.366) * [-1301.592] (-1302.996) (-1300.043) (-1302.462) -- 0:00:52
      340000 -- (-1302.770) (-1300.607) [-1300.592] (-1300.864) * (-1300.909) [-1300.898] (-1302.988) (-1303.162) -- 0:00:52

      Average standard deviation of split frequencies: 0.013911

      340500 -- [-1304.071] (-1305.233) (-1299.646) (-1302.477) * (-1301.176) (-1307.503) (-1300.620) [-1299.848] -- 0:00:52
      341000 -- (-1300.383) (-1304.608) (-1299.664) [-1300.388] * (-1301.409) (-1305.328) (-1300.758) [-1300.575] -- 0:00:52
      341500 -- [-1300.749] (-1306.763) (-1305.692) (-1301.253) * (-1303.806) (-1300.983) (-1301.413) [-1299.895] -- 0:00:52
      342000 -- (-1303.113) (-1303.455) (-1305.253) [-1301.131] * [-1300.563] (-1301.819) (-1300.598) (-1301.708) -- 0:00:51
      342500 -- (-1302.136) [-1301.437] (-1304.160) (-1299.997) * [-1301.704] (-1301.235) (-1301.644) (-1301.937) -- 0:00:51
      343000 -- (-1300.629) (-1300.379) (-1302.262) [-1299.667] * [-1301.859] (-1301.085) (-1301.182) (-1303.400) -- 0:00:51
      343500 -- (-1301.058) [-1302.247] (-1306.367) (-1306.061) * (-1300.949) [-1304.391] (-1301.162) (-1303.508) -- 0:00:51
      344000 -- (-1304.621) [-1303.866] (-1303.326) (-1300.191) * (-1305.374) (-1305.619) (-1301.097) [-1300.734] -- 0:00:51
      344500 -- (-1300.394) (-1300.739) [-1302.011] (-1300.902) * [-1299.586] (-1304.686) (-1303.373) (-1303.671) -- 0:00:51
      345000 -- (-1300.109) [-1300.738] (-1304.180) (-1300.905) * [-1300.784] (-1304.381) (-1306.226) (-1301.161) -- 0:00:51

      Average standard deviation of split frequencies: 0.012477

      345500 -- (-1301.701) (-1302.983) (-1301.663) [-1302.713] * (-1303.654) (-1302.713) (-1302.359) [-1300.896] -- 0:00:51
      346000 -- (-1300.765) (-1300.303) [-1301.734] (-1301.615) * (-1303.075) (-1301.598) [-1300.456] (-1304.355) -- 0:00:51
      346500 -- [-1300.470] (-1301.633) (-1305.816) (-1307.905) * [-1301.651] (-1300.844) (-1302.149) (-1304.044) -- 0:00:50
      347000 -- (-1301.891) (-1301.411) [-1301.882] (-1302.315) * (-1303.319) (-1300.217) (-1300.934) [-1305.855] -- 0:00:50
      347500 -- (-1304.274) [-1300.092] (-1300.776) (-1301.650) * (-1300.247) [-1299.669] (-1303.003) (-1300.381) -- 0:00:50
      348000 -- (-1300.583) [-1301.539] (-1299.744) (-1303.257) * [-1300.481] (-1305.631) (-1300.841) (-1300.820) -- 0:00:50
      348500 -- (-1300.880) (-1300.532) [-1299.738] (-1302.935) * (-1300.885) [-1302.027] (-1304.836) (-1302.394) -- 0:00:50
      349000 -- (-1300.761) (-1302.469) [-1300.233] (-1302.100) * (-1303.100) (-1304.453) [-1301.391] (-1304.213) -- 0:00:50
      349500 -- [-1302.067] (-1300.443) (-1300.489) (-1304.932) * (-1303.866) (-1305.094) (-1302.146) [-1304.731] -- 0:00:50
      350000 -- (-1307.809) (-1300.206) (-1300.379) [-1301.469] * (-1305.484) (-1305.227) (-1303.927) [-1301.153] -- 0:00:50

      Average standard deviation of split frequencies: 0.012890

      350500 -- (-1302.247) (-1302.375) (-1306.942) [-1301.191] * [-1301.699] (-1303.743) (-1301.408) (-1301.589) -- 0:00:50
      351000 -- [-1305.338] (-1302.661) (-1301.118) (-1300.736) * (-1300.136) (-1300.837) [-1301.431] (-1304.479) -- 0:00:49
      351500 -- (-1303.484) (-1302.318) [-1301.082] (-1301.874) * (-1300.744) [-1300.440] (-1302.450) (-1305.548) -- 0:00:51
      352000 -- (-1300.355) (-1303.372) (-1299.628) [-1301.791] * (-1300.699) [-1300.403] (-1300.672) (-1301.892) -- 0:00:51
      352500 -- (-1299.916) (-1302.523) [-1300.064] (-1302.412) * (-1301.436) (-1300.327) [-1299.753] (-1301.580) -- 0:00:51
      353000 -- [-1302.861] (-1303.882) (-1300.435) (-1303.068) * (-1301.577) (-1300.641) (-1305.684) [-1303.497] -- 0:00:51
      353500 -- (-1301.043) (-1303.816) (-1300.343) [-1300.745] * [-1300.357] (-1301.227) (-1299.639) (-1301.381) -- 0:00:51
      354000 -- [-1300.242] (-1302.130) (-1301.001) (-1301.179) * [-1300.395] (-1301.837) (-1302.533) (-1303.741) -- 0:00:51
      354500 -- (-1300.451) [-1300.842] (-1300.383) (-1301.440) * [-1302.199] (-1302.483) (-1303.398) (-1301.207) -- 0:00:50
      355000 -- (-1301.352) (-1301.482) [-1300.891] (-1300.473) * (-1301.640) [-1300.534] (-1301.250) (-1301.020) -- 0:00:50

      Average standard deviation of split frequencies: 0.012073

      355500 -- (-1302.967) (-1301.027) (-1300.879) [-1300.087] * [-1304.969] (-1302.497) (-1303.016) (-1300.240) -- 0:00:50
      356000 -- (-1301.740) [-1301.723] (-1300.673) (-1300.208) * (-1301.904) (-1301.521) (-1302.257) [-1301.369] -- 0:00:50
      356500 -- (-1302.157) (-1301.465) (-1301.090) [-1300.143] * [-1302.900] (-1299.957) (-1302.247) (-1301.401) -- 0:00:50
      357000 -- (-1300.863) (-1300.562) (-1300.793) [-1302.482] * (-1302.152) (-1302.853) (-1302.871) [-1301.947] -- 0:00:50
      357500 -- [-1299.820] (-1301.845) (-1303.757) (-1302.401) * (-1300.520) (-1302.184) [-1301.436] (-1301.324) -- 0:00:50
      358000 -- (-1302.047) (-1300.306) (-1300.563) [-1302.255] * (-1299.779) [-1299.910] (-1302.999) (-1305.226) -- 0:00:50
      358500 -- (-1302.879) (-1300.619) (-1301.266) [-1305.619] * (-1301.021) [-1302.991] (-1303.063) (-1304.861) -- 0:00:50
      359000 -- (-1301.320) (-1304.202) (-1302.782) [-1301.954] * (-1302.190) (-1302.753) (-1301.847) [-1303.333] -- 0:00:49
      359500 -- (-1301.343) (-1306.088) [-1304.148] (-1300.148) * (-1303.920) (-1302.757) (-1303.675) [-1300.696] -- 0:00:49
      360000 -- [-1302.044] (-1302.880) (-1302.940) (-1301.151) * (-1303.125) [-1302.475] (-1302.020) (-1302.992) -- 0:00:49

      Average standard deviation of split frequencies: 0.012148

      360500 -- (-1300.250) (-1306.491) [-1301.213] (-1302.740) * [-1301.992] (-1301.801) (-1300.176) (-1300.241) -- 0:00:49
      361000 -- (-1302.324) (-1304.535) (-1300.982) [-1303.264] * [-1301.352] (-1302.078) (-1301.064) (-1303.993) -- 0:00:49
      361500 -- (-1299.912) [-1301.480] (-1301.112) (-1302.062) * [-1301.485] (-1301.023) (-1300.681) (-1300.649) -- 0:00:49
      362000 -- (-1301.437) [-1302.482] (-1302.476) (-1300.798) * [-1300.318] (-1301.897) (-1301.004) (-1300.589) -- 0:00:49
      362500 -- (-1302.513) [-1301.654] (-1300.672) (-1300.556) * (-1302.566) (-1303.065) [-1303.066] (-1301.186) -- 0:00:49
      363000 -- (-1302.445) (-1301.979) [-1300.549] (-1302.651) * [-1302.225] (-1303.516) (-1305.194) (-1302.874) -- 0:00:49
      363500 -- (-1301.334) [-1301.099] (-1301.077) (-1305.966) * (-1302.208) [-1301.767] (-1306.257) (-1299.944) -- 0:00:49
      364000 -- (-1301.066) (-1300.559) [-1300.954] (-1302.661) * (-1303.459) (-1301.251) (-1301.728) [-1300.338] -- 0:00:48
      364500 -- (-1301.225) [-1305.078] (-1301.138) (-1301.774) * (-1300.889) [-1300.637] (-1302.784) (-1301.238) -- 0:00:50
      365000 -- [-1300.353] (-1304.119) (-1302.167) (-1301.597) * (-1301.857) (-1300.435) (-1301.090) [-1300.149] -- 0:00:50

      Average standard deviation of split frequencies: 0.013595

      365500 -- [-1300.999] (-1309.486) (-1301.766) (-1301.526) * (-1300.367) (-1300.809) (-1301.732) [-1301.210] -- 0:00:50
      366000 -- [-1300.792] (-1305.556) (-1302.834) (-1300.784) * (-1301.278) (-1303.481) [-1302.066] (-1303.958) -- 0:00:50
      366500 -- (-1302.598) (-1300.747) (-1302.929) [-1301.506] * [-1302.226] (-1302.268) (-1302.900) (-1302.083) -- 0:00:50
      367000 -- (-1306.881) (-1299.887) (-1305.692) [-1299.779] * [-1303.408] (-1301.975) (-1304.714) (-1303.488) -- 0:00:50
      367500 -- (-1304.002) [-1301.902] (-1299.771) (-1300.677) * (-1301.319) (-1300.730) [-1302.596] (-1301.836) -- 0:00:49
      368000 -- (-1307.180) (-1302.154) [-1301.601] (-1300.349) * (-1301.737) [-1300.990] (-1303.307) (-1300.299) -- 0:00:49
      368500 -- (-1307.785) (-1301.550) (-1306.155) [-1301.019] * (-1302.566) [-1304.121] (-1301.863) (-1302.155) -- 0:00:49
      369000 -- (-1303.708) (-1300.445) [-1305.262] (-1300.393) * [-1303.169] (-1306.846) (-1304.603) (-1302.351) -- 0:00:49
      369500 -- [-1302.360] (-1304.112) (-1307.716) (-1300.232) * [-1307.473] (-1306.721) (-1302.371) (-1304.606) -- 0:00:49
      370000 -- [-1302.601] (-1300.625) (-1306.862) (-1301.506) * (-1302.849) (-1304.144) [-1300.748] (-1302.415) -- 0:00:49

      Average standard deviation of split frequencies: 0.014060

      370500 -- (-1303.441) [-1300.653] (-1303.941) (-1303.593) * (-1300.883) (-1303.048) (-1302.133) [-1300.593] -- 0:00:49
      371000 -- (-1300.579) (-1301.835) [-1303.876] (-1303.726) * [-1300.755] (-1303.927) (-1301.433) (-1301.349) -- 0:00:49
      371500 -- [-1301.336] (-1300.250) (-1303.140) (-1302.547) * (-1303.721) [-1302.647] (-1302.865) (-1303.916) -- 0:00:49
      372000 -- (-1301.715) [-1300.378] (-1303.222) (-1302.782) * [-1303.157] (-1303.560) (-1301.917) (-1302.821) -- 0:00:48
      372500 -- (-1301.497) (-1299.766) (-1300.684) [-1302.855] * [-1301.072] (-1304.409) (-1303.260) (-1303.115) -- 0:00:48
      373000 -- (-1301.139) [-1301.324] (-1300.677) (-1302.639) * [-1302.312] (-1303.618) (-1300.882) (-1301.781) -- 0:00:48
      373500 -- (-1302.868) [-1301.352] (-1301.037) (-1300.743) * (-1303.004) [-1303.134] (-1301.084) (-1302.519) -- 0:00:48
      374000 -- [-1305.676] (-1301.222) (-1303.325) (-1302.153) * (-1306.658) (-1307.431) [-1301.029] (-1302.492) -- 0:00:48
      374500 -- [-1302.628] (-1302.133) (-1301.961) (-1307.259) * (-1300.746) [-1302.158] (-1303.091) (-1302.606) -- 0:00:48
      375000 -- (-1301.538) (-1300.770) (-1300.596) [-1309.406] * (-1299.967) (-1302.848) (-1303.976) [-1302.477] -- 0:00:48

      Average standard deviation of split frequencies: 0.013791

      375500 -- (-1304.124) (-1301.067) (-1301.041) [-1309.450] * (-1300.361) (-1301.818) [-1302.004] (-1302.846) -- 0:00:48
      376000 -- (-1301.583) (-1304.953) (-1302.852) [-1300.713] * (-1303.620) [-1300.971] (-1302.292) (-1301.299) -- 0:00:48
      376500 -- (-1300.068) [-1301.558] (-1301.623) (-1302.153) * (-1307.840) (-1307.701) (-1311.676) [-1300.151] -- 0:00:48
      377000 -- (-1301.167) (-1301.617) (-1301.226) [-1301.303] * (-1301.082) (-1301.732) [-1306.317] (-1301.459) -- 0:00:47
      377500 -- [-1300.589] (-1299.764) (-1304.421) (-1302.993) * [-1300.666] (-1301.315) (-1304.955) (-1300.861) -- 0:00:47
      378000 -- (-1300.766) (-1299.559) [-1304.196] (-1302.436) * (-1303.998) (-1300.910) (-1301.092) [-1300.849] -- 0:00:49
      378500 -- (-1301.091) (-1301.215) [-1303.667] (-1302.282) * (-1304.196) [-1302.389] (-1300.209) (-1301.792) -- 0:00:49
      379000 -- [-1304.400] (-1301.718) (-1303.711) (-1303.257) * [-1301.306] (-1302.942) (-1301.619) (-1300.050) -- 0:00:49
      379500 -- (-1304.357) (-1300.235) (-1301.106) [-1302.388] * (-1301.341) [-1305.427] (-1300.316) (-1299.587) -- 0:00:49
      380000 -- (-1300.301) [-1302.364] (-1302.508) (-1303.901) * (-1301.230) (-1300.821) [-1302.363] (-1303.055) -- 0:00:48

      Average standard deviation of split frequencies: 0.013003

      380500 -- (-1300.152) [-1301.289] (-1299.568) (-1305.542) * (-1301.748) (-1301.520) [-1301.914] (-1300.438) -- 0:00:48
      381000 -- (-1300.152) (-1305.388) [-1300.454] (-1303.373) * (-1301.996) [-1299.977] (-1301.110) (-1300.585) -- 0:00:48
      381500 -- (-1303.783) (-1301.695) (-1302.073) [-1300.989] * (-1303.539) [-1299.992] (-1301.165) (-1310.280) -- 0:00:48
      382000 -- (-1299.560) (-1305.783) [-1305.147] (-1301.183) * (-1303.387) (-1305.416) (-1300.347) [-1303.654] -- 0:00:48
      382500 -- (-1300.133) (-1305.036) (-1304.342) [-1300.366] * (-1301.415) (-1301.989) [-1302.392] (-1301.366) -- 0:00:48
      383000 -- [-1302.537] (-1300.933) (-1302.291) (-1304.509) * (-1299.864) [-1307.011] (-1302.257) (-1303.621) -- 0:00:48
      383500 -- [-1301.661] (-1300.980) (-1305.570) (-1302.455) * (-1300.732) (-1303.253) [-1302.257] (-1302.070) -- 0:00:48
      384000 -- (-1304.989) [-1304.243] (-1305.134) (-1302.636) * (-1301.766) [-1300.179] (-1301.722) (-1300.468) -- 0:00:48
      384500 -- (-1304.918) (-1303.693) (-1301.122) [-1301.863] * (-1302.553) (-1301.992) [-1302.347] (-1300.079) -- 0:00:48
      385000 -- (-1302.271) (-1301.694) (-1304.392) [-1300.760] * (-1301.889) [-1301.204] (-1301.989) (-1301.772) -- 0:00:47

      Average standard deviation of split frequencies: 0.012920

      385500 -- (-1300.916) (-1302.143) (-1301.483) [-1300.608] * (-1301.316) (-1303.792) [-1301.097] (-1304.568) -- 0:00:47
      386000 -- (-1300.837) (-1301.963) (-1302.833) [-1301.733] * (-1301.098) [-1301.879] (-1300.825) (-1303.420) -- 0:00:47
      386500 -- [-1304.081] (-1299.909) (-1301.496) (-1304.478) * (-1300.874) [-1302.706] (-1301.346) (-1301.585) -- 0:00:47
      387000 -- (-1303.340) [-1299.888] (-1302.325) (-1305.486) * (-1299.943) (-1302.895) [-1300.033] (-1300.638) -- 0:00:47
      387500 -- (-1304.252) [-1300.036] (-1306.411) (-1303.789) * (-1299.924) (-1304.621) (-1300.098) [-1300.189] -- 0:00:47
      388000 -- (-1301.347) [-1300.387] (-1301.434) (-1306.422) * (-1303.476) (-1303.363) [-1303.951] (-1300.842) -- 0:00:47
      388500 -- (-1301.768) [-1300.051] (-1300.360) (-1303.423) * (-1302.189) [-1305.052] (-1301.538) (-1302.721) -- 0:00:47
      389000 -- (-1305.873) [-1302.243] (-1300.182) (-1302.004) * (-1301.671) (-1305.532) [-1301.030] (-1299.552) -- 0:00:47
      389500 -- (-1302.104) (-1301.469) [-1303.069] (-1302.372) * (-1301.317) [-1302.067] (-1301.498) (-1301.673) -- 0:00:47
      390000 -- (-1302.264) (-1300.238) [-1304.262] (-1304.526) * (-1304.905) (-1303.001) [-1303.559] (-1302.109) -- 0:00:46

      Average standard deviation of split frequencies: 0.014734

      390500 -- (-1300.900) [-1302.068] (-1303.008) (-1303.322) * (-1304.067) (-1303.664) [-1302.028] (-1303.031) -- 0:00:46
      391000 -- (-1302.248) (-1306.052) [-1301.658] (-1304.162) * (-1304.065) (-1305.852) (-1302.998) [-1300.402] -- 0:00:46
      391500 -- (-1301.157) [-1303.186] (-1300.830) (-1306.697) * (-1304.854) [-1303.021] (-1304.402) (-1301.552) -- 0:00:48
      392000 -- (-1302.313) (-1300.256) [-1301.016] (-1304.122) * (-1305.480) (-1304.067) (-1303.771) [-1302.106] -- 0:00:48
      392500 -- [-1301.455] (-1302.822) (-1300.910) (-1302.877) * [-1301.713] (-1305.214) (-1301.243) (-1301.365) -- 0:00:47
      393000 -- (-1302.847) (-1303.930) (-1300.093) [-1302.297] * (-1301.055) [-1302.123] (-1301.676) (-1301.480) -- 0:00:47
      393500 -- [-1300.149] (-1304.577) (-1300.064) (-1300.066) * [-1299.952] (-1302.033) (-1301.503) (-1301.709) -- 0:00:47
      394000 -- [-1300.044] (-1305.931) (-1300.699) (-1300.105) * (-1300.777) (-1300.323) (-1300.032) [-1303.912] -- 0:00:47
      394500 -- (-1301.331) [-1305.546] (-1301.933) (-1303.526) * (-1303.522) (-1302.049) (-1300.561) [-1300.970] -- 0:00:47
      395000 -- (-1301.821) [-1300.820] (-1303.335) (-1301.933) * (-1303.526) [-1300.866] (-1303.088) (-1303.073) -- 0:00:47

      Average standard deviation of split frequencies: 0.014661

      395500 -- (-1303.609) (-1300.492) [-1302.014] (-1303.255) * [-1303.936] (-1302.378) (-1303.283) (-1302.483) -- 0:00:47
      396000 -- [-1302.638] (-1303.018) (-1309.308) (-1301.953) * (-1303.304) (-1303.513) (-1303.918) [-1301.410] -- 0:00:47
      396500 -- [-1303.465] (-1301.616) (-1302.089) (-1301.134) * [-1302.585] (-1303.201) (-1303.372) (-1301.314) -- 0:00:47
      397000 -- [-1301.999] (-1302.943) (-1301.713) (-1302.846) * (-1301.144) [-1303.821] (-1301.760) (-1300.341) -- 0:00:47
      397500 -- [-1302.089] (-1302.311) (-1303.928) (-1301.515) * (-1301.513) [-1302.881] (-1300.095) (-1301.467) -- 0:00:46
      398000 -- (-1304.350) [-1300.197] (-1302.527) (-1303.175) * (-1299.543) [-1301.700] (-1300.683) (-1300.446) -- 0:00:46
      398500 -- (-1303.358) (-1299.986) [-1301.484] (-1301.946) * (-1299.804) (-1299.984) (-1303.220) [-1301.257] -- 0:00:46
      399000 -- (-1303.486) (-1299.859) [-1300.703] (-1301.360) * [-1300.125] (-1300.584) (-1303.969) (-1299.824) -- 0:00:46
      399500 -- (-1302.068) [-1302.869] (-1300.851) (-1300.470) * (-1302.941) (-1301.076) [-1300.588] (-1304.232) -- 0:00:46
      400000 -- (-1305.871) (-1303.694) (-1307.502) [-1303.396] * [-1302.280] (-1301.624) (-1303.970) (-1301.380) -- 0:00:46

      Average standard deviation of split frequencies: 0.014428

      400500 -- (-1304.472) (-1301.606) [-1303.312] (-1302.391) * [-1300.763] (-1301.010) (-1303.541) (-1301.356) -- 0:00:46
      401000 -- [-1301.006] (-1303.308) (-1306.859) (-1306.783) * [-1304.273] (-1301.286) (-1303.541) (-1300.657) -- 0:00:46
      401500 -- [-1300.578] (-1306.004) (-1300.283) (-1302.286) * (-1302.155) (-1300.775) [-1302.356] (-1303.059) -- 0:00:46
      402000 -- (-1300.200) (-1301.556) (-1300.623) [-1301.296] * (-1300.998) [-1302.303] (-1301.432) (-1306.121) -- 0:00:46
      402500 -- [-1300.450] (-1301.744) (-1303.162) (-1301.340) * (-1303.748) (-1303.511) [-1300.539] (-1302.405) -- 0:00:46
      403000 -- (-1302.603) (-1300.521) (-1303.428) [-1300.976] * (-1300.800) (-1304.310) [-1302.423] (-1304.067) -- 0:00:45
      403500 -- (-1300.688) (-1301.009) [-1301.982] (-1300.595) * (-1305.368) (-1301.224) [-1300.793] (-1303.559) -- 0:00:45
      404000 -- (-1300.198) [-1301.270] (-1302.361) (-1303.738) * (-1305.023) [-1300.737] (-1301.213) (-1304.401) -- 0:00:45
      404500 -- (-1300.144) (-1302.618) [-1301.199] (-1303.892) * [-1300.069] (-1302.475) (-1300.955) (-1301.159) -- 0:00:45
      405000 -- (-1300.495) [-1300.554] (-1303.938) (-1301.789) * (-1301.159) [-1300.973] (-1301.900) (-1300.352) -- 0:00:47

      Average standard deviation of split frequencies: 0.013872

      405500 -- (-1300.563) (-1301.017) [-1303.421] (-1303.163) * (-1301.857) (-1305.021) (-1299.640) [-1299.889] -- 0:00:46
      406000 -- (-1300.809) (-1302.479) (-1299.704) [-1302.271] * (-1303.094) [-1303.402] (-1300.064) (-1299.886) -- 0:00:46
      406500 -- (-1304.417) [-1303.748] (-1300.959) (-1300.324) * [-1301.709] (-1302.353) (-1300.801) (-1299.821) -- 0:00:46
      407000 -- (-1302.345) (-1301.204) [-1302.401] (-1299.890) * [-1305.842] (-1302.175) (-1302.042) (-1300.796) -- 0:00:46
      407500 -- (-1302.135) (-1301.023) (-1303.494) [-1300.492] * (-1303.653) [-1304.293] (-1302.312) (-1300.659) -- 0:00:46
      408000 -- (-1301.802) [-1302.827] (-1303.448) (-1300.514) * (-1301.889) [-1301.108] (-1302.018) (-1304.016) -- 0:00:46
      408500 -- (-1301.154) (-1303.308) (-1302.852) [-1300.666] * (-1302.338) [-1303.231] (-1302.913) (-1300.220) -- 0:00:46
      409000 -- (-1303.950) (-1304.393) [-1301.241] (-1301.743) * (-1300.980) (-1304.338) [-1301.856] (-1301.153) -- 0:00:46
      409500 -- (-1302.887) (-1303.912) (-1301.871) [-1299.913] * (-1300.861) (-1307.490) [-1301.588] (-1302.542) -- 0:00:46
      410000 -- [-1301.128] (-1301.728) (-1300.174) (-1300.067) * (-1300.021) (-1304.149) (-1302.495) [-1300.174] -- 0:00:46

      Average standard deviation of split frequencies: 0.013775

      410500 -- [-1300.812] (-1301.784) (-1301.720) (-1301.217) * (-1299.893) [-1300.391] (-1302.732) (-1301.519) -- 0:00:45
      411000 -- (-1301.876) (-1300.507) (-1305.201) [-1300.060] * (-1302.435) (-1303.135) (-1301.648) [-1300.376] -- 0:00:45
      411500 -- (-1301.343) (-1299.481) [-1305.783] (-1299.982) * [-1305.080] (-1303.260) (-1302.000) (-1301.324) -- 0:00:45
      412000 -- (-1301.480) (-1301.486) (-1302.920) [-1300.103] * (-1305.588) (-1301.350) [-1301.482] (-1300.569) -- 0:00:45
      412500 -- [-1303.007] (-1302.637) (-1302.894) (-1301.400) * [-1301.927] (-1300.990) (-1301.550) (-1303.124) -- 0:00:45
      413000 -- (-1299.786) [-1303.968] (-1302.420) (-1301.232) * [-1302.203] (-1300.353) (-1302.475) (-1300.935) -- 0:00:45
      413500 -- [-1299.866] (-1303.905) (-1303.435) (-1306.913) * (-1302.324) [-1300.502] (-1304.022) (-1302.705) -- 0:00:45
      414000 -- [-1300.411] (-1305.726) (-1302.469) (-1300.656) * (-1302.802) (-1300.554) [-1304.862] (-1302.441) -- 0:00:45
      414500 -- (-1301.615) [-1303.056] (-1301.407) (-1300.061) * (-1300.670) (-1302.058) (-1306.959) [-1301.341] -- 0:00:45
      415000 -- (-1300.006) [-1304.170] (-1302.317) (-1300.884) * (-1300.664) (-1302.650) (-1305.232) [-1303.240] -- 0:00:45

      Average standard deviation of split frequencies: 0.013360

      415500 -- (-1299.573) [-1299.925] (-1300.675) (-1301.089) * (-1300.704) (-1303.591) (-1302.248) [-1301.701] -- 0:00:45
      416000 -- (-1300.196) (-1300.868) (-1300.494) [-1301.477] * [-1300.674] (-1301.982) (-1300.556) (-1300.521) -- 0:00:44
      416500 -- (-1303.339) (-1299.586) (-1302.495) [-1303.485] * (-1300.342) (-1301.831) (-1300.880) [-1302.494] -- 0:00:44
      417000 -- (-1303.094) (-1300.559) (-1303.561) [-1303.493] * (-1301.403) (-1301.049) [-1300.576] (-1304.771) -- 0:00:44
      417500 -- (-1303.211) (-1302.157) (-1306.016) [-1300.883] * (-1302.785) (-1301.534) (-1303.602) [-1302.098] -- 0:00:44
      418000 -- (-1300.491) (-1302.100) (-1306.097) [-1301.379] * (-1302.567) (-1305.664) (-1301.971) [-1300.116] -- 0:00:45
      418500 -- [-1303.559] (-1301.452) (-1300.530) (-1305.641) * (-1300.954) (-1301.834) [-1301.422] (-1303.859) -- 0:00:45
      419000 -- (-1302.143) (-1300.113) [-1300.078] (-1304.674) * (-1301.756) (-1305.252) [-1301.475] (-1301.981) -- 0:00:45
      419500 -- (-1304.740) [-1300.112] (-1303.607) (-1302.046) * [-1300.975] (-1303.525) (-1299.423) (-1303.734) -- 0:00:45
      420000 -- (-1303.573) (-1302.064) (-1301.938) [-1303.228] * (-1301.488) (-1300.538) (-1300.131) [-1301.764] -- 0:00:45

      Average standard deviation of split frequencies: 0.013624

      420500 -- (-1304.828) (-1300.841) (-1307.215) [-1299.943] * (-1300.119) (-1301.203) [-1300.559] (-1305.897) -- 0:00:45
      421000 -- [-1302.364] (-1300.671) (-1308.651) (-1304.239) * (-1304.196) (-1302.580) (-1305.261) [-1304.195] -- 0:00:45
      421500 -- (-1299.727) [-1300.686] (-1303.835) (-1303.298) * (-1302.602) [-1300.980] (-1301.150) (-1302.183) -- 0:00:45
      422000 -- [-1302.031] (-1305.569) (-1300.437) (-1302.394) * (-1301.815) (-1301.149) [-1302.660] (-1299.910) -- 0:00:45
      422500 -- (-1303.275) (-1306.395) (-1302.715) [-1303.644] * (-1301.217) [-1303.765] (-1301.332) (-1300.587) -- 0:00:45
      423000 -- [-1303.000] (-1304.398) (-1302.510) (-1302.792) * (-1303.671) (-1307.742) (-1300.058) [-1300.450] -- 0:00:45
      423500 -- (-1300.423) (-1300.801) (-1301.002) [-1300.710] * (-1302.580) [-1303.549] (-1300.246) (-1300.447) -- 0:00:44
      424000 -- (-1303.586) [-1303.196] (-1302.977) (-1301.179) * (-1303.677) [-1302.201] (-1300.872) (-1302.337) -- 0:00:44
      424500 -- (-1299.887) (-1300.258) [-1302.032] (-1302.179) * [-1299.745] (-1302.857) (-1301.128) (-1301.063) -- 0:00:44
      425000 -- (-1301.835) (-1300.953) (-1301.040) [-1302.207] * [-1300.408] (-1301.437) (-1302.368) (-1302.386) -- 0:00:44

      Average standard deviation of split frequencies: 0.013978

      425500 -- (-1301.786) [-1299.846] (-1300.166) (-1300.849) * (-1300.453) [-1300.774] (-1301.392) (-1300.556) -- 0:00:44
      426000 -- (-1299.723) [-1300.347] (-1300.408) (-1300.852) * (-1300.082) (-1301.701) (-1302.663) [-1301.668] -- 0:00:44
      426500 -- (-1302.363) (-1300.262) [-1300.954] (-1300.551) * (-1301.525) [-1301.517] (-1301.264) (-1301.479) -- 0:00:44
      427000 -- (-1304.705) (-1301.369) [-1301.854] (-1303.160) * [-1301.525] (-1302.178) (-1303.129) (-1303.241) -- 0:00:44
      427500 -- (-1301.260) (-1300.568) [-1301.103] (-1303.186) * (-1300.440) (-1308.919) [-1303.593] (-1301.271) -- 0:00:44
      428000 -- (-1299.435) (-1303.023) [-1299.606] (-1299.781) * [-1304.598] (-1302.001) (-1301.357) (-1301.047) -- 0:00:44
      428500 -- [-1300.779] (-1313.062) (-1301.568) (-1300.382) * [-1303.528] (-1302.890) (-1301.693) (-1302.820) -- 0:00:44
      429000 -- [-1301.949] (-1313.518) (-1300.905) (-1300.610) * [-1301.753] (-1303.623) (-1307.436) (-1303.094) -- 0:00:43
      429500 -- (-1301.222) (-1302.181) (-1303.354) [-1303.932] * (-1301.858) (-1301.360) (-1302.588) [-1301.244] -- 0:00:43
      430000 -- (-1301.079) [-1304.295] (-1302.510) (-1302.675) * (-1301.461) (-1303.649) [-1301.245] (-1305.429) -- 0:00:43

      Average standard deviation of split frequencies: 0.013538

      430500 -- (-1304.367) (-1301.218) [-1303.263] (-1302.066) * (-1300.967) (-1302.800) [-1302.262] (-1304.916) -- 0:00:44
      431000 -- (-1299.820) [-1302.357] (-1302.292) (-1300.590) * [-1304.192] (-1304.040) (-1300.506) (-1304.845) -- 0:00:44
      431500 -- (-1302.158) (-1304.512) (-1303.002) [-1301.981] * (-1304.713) [-1300.521] (-1302.736) (-1306.297) -- 0:00:44
      432000 -- (-1301.935) (-1302.809) [-1304.611] (-1301.334) * [-1306.707] (-1299.703) (-1301.416) (-1303.210) -- 0:00:44
      432500 -- (-1302.448) (-1301.951) [-1301.261] (-1300.048) * (-1300.589) (-1299.988) [-1301.031] (-1301.531) -- 0:00:44
      433000 -- (-1302.626) (-1303.513) (-1301.091) [-1300.215] * [-1303.041] (-1305.389) (-1301.293) (-1305.880) -- 0:00:44
      433500 -- (-1308.630) [-1301.762] (-1301.919) (-1300.980) * (-1303.090) (-1301.155) [-1300.037] (-1300.942) -- 0:00:44
      434000 -- (-1304.401) (-1300.095) (-1302.198) [-1300.078] * (-1301.829) [-1304.476] (-1299.565) (-1306.073) -- 0:00:44
      434500 -- (-1303.178) [-1299.773] (-1302.732) (-1299.717) * (-1302.201) (-1303.810) [-1299.907] (-1301.566) -- 0:00:44
      435000 -- (-1300.432) (-1302.190) [-1301.072] (-1301.264) * (-1301.041) [-1301.407] (-1301.320) (-1301.744) -- 0:00:44

      Average standard deviation of split frequencies: 0.013259

      435500 -- (-1301.584) (-1304.094) (-1301.549) [-1301.908] * [-1302.307] (-1303.633) (-1300.914) (-1303.819) -- 0:00:44
      436000 -- [-1302.238] (-1304.821) (-1304.107) (-1304.278) * (-1300.394) [-1301.113] (-1301.789) (-1302.331) -- 0:00:43
      436500 -- (-1302.505) (-1304.392) (-1301.530) [-1304.747] * (-1301.664) (-1303.462) [-1300.945] (-1300.545) -- 0:00:43
      437000 -- (-1303.678) (-1302.438) [-1302.089] (-1301.456) * (-1301.208) [-1301.884] (-1303.767) (-1302.278) -- 0:00:43
      437500 -- [-1304.257] (-1303.004) (-1301.238) (-1300.924) * (-1304.375) [-1302.999] (-1302.777) (-1301.466) -- 0:00:43
      438000 -- [-1304.429] (-1301.464) (-1301.058) (-1310.083) * [-1300.470] (-1305.023) (-1303.842) (-1300.625) -- 0:00:43
      438500 -- (-1300.446) (-1303.808) [-1302.190] (-1301.155) * (-1300.588) [-1302.505] (-1300.612) (-1299.886) -- 0:00:43
      439000 -- [-1303.025] (-1303.705) (-1300.628) (-1301.621) * (-1300.624) (-1302.574) [-1302.938] (-1300.171) -- 0:00:43
      439500 -- (-1301.030) (-1303.476) [-1300.124] (-1303.196) * [-1301.452] (-1302.761) (-1299.775) (-1301.776) -- 0:00:43
      440000 -- [-1301.070] (-1304.597) (-1303.450) (-1300.509) * [-1302.458] (-1302.637) (-1303.812) (-1304.283) -- 0:00:43

      Average standard deviation of split frequencies: 0.013847

      440500 -- (-1303.318) [-1301.249] (-1305.993) (-1303.257) * (-1301.161) [-1300.216] (-1302.896) (-1301.758) -- 0:00:43
      441000 -- (-1303.977) (-1300.806) (-1306.307) [-1300.573] * [-1300.309] (-1301.894) (-1302.130) (-1303.242) -- 0:00:43
      441500 -- [-1301.928] (-1302.886) (-1303.289) (-1302.332) * (-1300.827) [-1305.415] (-1301.077) (-1303.118) -- 0:00:43
      442000 -- (-1301.548) (-1304.396) (-1301.092) [-1302.182] * (-1303.451) (-1301.084) [-1303.078] (-1301.667) -- 0:00:42
      442500 -- (-1302.212) [-1305.393] (-1303.429) (-1303.493) * (-1303.264) (-1300.341) [-1303.365] (-1306.483) -- 0:00:42
      443000 -- (-1302.172) [-1302.674] (-1300.382) (-1302.078) * [-1301.033] (-1299.856) (-1302.403) (-1303.864) -- 0:00:42
      443500 -- (-1300.848) [-1302.788] (-1301.368) (-1301.664) * (-1301.996) (-1302.226) (-1300.048) [-1303.359] -- 0:00:42
      444000 -- (-1302.140) [-1302.043] (-1302.034) (-1304.592) * [-1301.734] (-1303.483) (-1300.569) (-1301.863) -- 0:00:43
      444500 -- (-1302.606) [-1302.709] (-1301.980) (-1303.643) * (-1299.765) (-1300.208) (-1299.476) [-1301.387] -- 0:00:43
      445000 -- [-1303.679] (-1301.808) (-1301.549) (-1302.235) * (-1300.387) (-1302.245) (-1308.751) [-1303.749] -- 0:00:43

      Average standard deviation of split frequencies: 0.014621

      445500 -- (-1305.461) (-1303.390) (-1300.002) [-1300.322] * [-1301.074] (-1300.068) (-1301.394) (-1304.034) -- 0:00:43
      446000 -- (-1301.816) (-1300.809) (-1304.280) [-1299.901] * (-1302.579) (-1300.186) (-1303.457) [-1305.363] -- 0:00:43
      446500 -- (-1301.038) [-1301.796] (-1301.519) (-1301.172) * (-1303.010) [-1300.413] (-1301.505) (-1302.750) -- 0:00:43
      447000 -- (-1300.972) [-1301.904] (-1300.896) (-1302.660) * (-1304.995) (-1300.944) [-1302.749] (-1307.620) -- 0:00:43
      447500 -- (-1302.397) (-1301.149) [-1301.821] (-1302.697) * (-1303.982) (-1302.358) [-1303.257] (-1303.468) -- 0:00:43
      448000 -- (-1301.434) (-1300.199) (-1300.917) [-1300.134] * (-1304.285) (-1301.705) (-1300.725) [-1301.077] -- 0:00:43
      448500 -- [-1300.716] (-1301.081) (-1302.022) (-1304.099) * (-1302.021) (-1300.653) (-1303.842) [-1303.281] -- 0:00:43
      449000 -- [-1304.020] (-1301.862) (-1300.847) (-1307.435) * [-1300.980] (-1301.620) (-1310.099) (-1299.788) -- 0:00:42
      449500 -- (-1309.372) (-1301.816) (-1301.757) [-1303.640] * (-1304.156) (-1308.639) (-1301.448) [-1301.862] -- 0:00:42
      450000 -- (-1307.346) (-1299.718) (-1300.635) [-1303.427] * (-1301.651) [-1303.103] (-1300.580) (-1302.997) -- 0:00:42

      Average standard deviation of split frequencies: 0.013773

      450500 -- (-1306.969) (-1302.616) [-1300.389] (-1301.515) * (-1304.042) (-1301.126) (-1304.276) [-1301.892] -- 0:00:42
      451000 -- (-1306.905) (-1302.371) (-1303.305) [-1301.219] * (-1301.569) [-1300.537] (-1304.518) (-1301.037) -- 0:00:42
      451500 -- (-1306.520) (-1301.137) (-1301.085) [-1301.350] * [-1305.081] (-1300.170) (-1303.264) (-1302.403) -- 0:00:42
      452000 -- (-1308.765) [-1302.554] (-1301.091) (-1301.172) * [-1302.763] (-1301.385) (-1305.229) (-1301.085) -- 0:00:42
      452500 -- (-1303.714) (-1302.841) [-1300.511] (-1300.279) * [-1304.346] (-1301.251) (-1300.054) (-1304.003) -- 0:00:42
      453000 -- [-1302.620] (-1303.824) (-1300.070) (-1301.383) * (-1300.535) [-1301.429] (-1300.361) (-1303.320) -- 0:00:42
      453500 -- (-1303.525) (-1305.019) (-1301.484) [-1299.756] * (-1301.365) (-1302.006) (-1301.408) [-1301.540] -- 0:00:42
      454000 -- (-1303.591) (-1302.949) (-1303.511) [-1301.416] * [-1302.162] (-1303.690) (-1303.131) (-1300.458) -- 0:00:42
      454500 -- (-1305.779) (-1300.542) (-1302.972) [-1300.658] * (-1305.080) (-1303.696) [-1301.585] (-1300.501) -- 0:00:42
      455000 -- (-1304.287) [-1302.441] (-1300.715) (-1306.028) * [-1301.041] (-1304.327) (-1300.582) (-1300.344) -- 0:00:41

      Average standard deviation of split frequencies: 0.012041

      455500 -- (-1302.112) (-1303.229) (-1300.540) [-1305.438] * (-1301.081) [-1299.779] (-1300.793) (-1301.662) -- 0:00:41
      456000 -- (-1302.076) (-1301.655) (-1300.645) [-1305.420] * (-1303.315) [-1301.356] (-1302.346) (-1300.523) -- 0:00:41
      456500 -- (-1304.728) (-1301.330) (-1306.206) [-1300.585] * (-1300.967) (-1300.294) (-1302.313) [-1301.750] -- 0:00:41
      457000 -- (-1305.821) [-1303.644] (-1304.559) (-1299.690) * (-1300.386) [-1299.952] (-1301.972) (-1304.546) -- 0:00:41
      457500 -- (-1308.443) (-1305.509) [-1301.839] (-1300.737) * (-1303.635) (-1301.464) (-1302.783) [-1307.676] -- 0:00:42
      458000 -- [-1301.222] (-1299.848) (-1305.743) (-1300.705) * (-1303.925) [-1300.188] (-1300.872) (-1300.458) -- 0:00:42
      458500 -- [-1300.514] (-1302.433) (-1305.935) (-1303.377) * [-1300.847] (-1300.644) (-1301.718) (-1300.387) -- 0:00:42
      459000 -- [-1300.672] (-1301.750) (-1304.249) (-1304.668) * (-1301.985) (-1302.174) [-1301.275] (-1300.284) -- 0:00:42
      459500 -- (-1300.675) [-1302.030] (-1302.217) (-1302.324) * (-1300.962) (-1301.306) [-1301.806] (-1299.925) -- 0:00:42
      460000 -- (-1300.679) (-1306.851) (-1302.347) [-1304.753] * (-1303.432) (-1301.024) (-1304.072) [-1302.912] -- 0:00:42

      Average standard deviation of split frequencies: 0.012159

      460500 -- (-1303.270) [-1303.307] (-1308.890) (-1302.330) * (-1303.697) (-1301.103) [-1302.523] (-1303.260) -- 0:00:42
      461000 -- (-1304.959) [-1304.524] (-1304.877) (-1303.157) * (-1302.119) (-1303.813) (-1304.398) [-1301.337] -- 0:00:42
      461500 -- [-1300.825] (-1300.828) (-1301.808) (-1305.602) * (-1301.338) [-1300.721] (-1304.346) (-1302.984) -- 0:00:42
      462000 -- (-1301.390) (-1302.588)