--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:49:38 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2613/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2613/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2613/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2613/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2737.80         -2740.35
2      -2737.78         -2742.09
--------------------------------------
TOTAL    -2737.79         -2741.56
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2613/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2613/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2613/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.888632    0.086879    0.367972    1.460473    0.860623   1407.08   1419.79    1.000
r(A<->C){all}   0.167461    0.020281    0.000020    0.460483    0.129107    180.49    189.21    1.001
r(A<->G){all}   0.160168    0.019791    0.000021    0.439255    0.123894    322.93    329.18    1.002
r(A<->T){all}   0.154331    0.018279    0.000078    0.425570    0.116584    149.77    150.10    1.003
r(C<->G){all}   0.157512    0.018219    0.000010    0.424707    0.118936    253.65    323.86    1.001
r(C<->T){all}   0.175293    0.020744    0.000049    0.468715    0.138583    166.40    247.55    1.002
r(G<->T){all}   0.185234    0.022236    0.000037    0.475523    0.146415    218.13    231.73    1.002
pi(A){all}      0.222150    0.000087    0.203779    0.239880    0.222081   1082.70   1257.10    1.000
pi(C){all}      0.304613    0.000110    0.284833    0.326036    0.304518   1156.33   1165.59    1.000
pi(G){all}      0.287505    0.000109    0.267623    0.308746    0.287400   1015.82   1139.65    1.000
pi(T){all}      0.185732    0.000068    0.169287    0.202189    0.185589   1218.61   1289.44    1.000
alpha{1,2}      0.428080    0.238957    0.000287    1.394835    0.251459    970.18   1150.42    1.001
alpha{3}        0.441578    0.231926    0.000125    1.414107    0.278515   1221.35   1292.28    1.000
pinvar{all}     0.999292    0.000001    0.997775    1.000000    0.999553   1029.04   1069.57    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2621.486562
Model 2: PositiveSelection	-2621.486562
Model 0: one-ratio	-2621.486717
Model 7: beta	-2621.486562
Model 8: beta&w>1	-2621.487197


Model 0 vs 1	3.100000003541936E-4

Model 2 vs 1	0.0

Model 8 vs 7	0.001269999999749416
>C1
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
>C2
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
>C3
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
>C4
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
>C5
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
>C6
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=667 

C1              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
C2              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
C3              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
C4              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
C5              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
C6              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
                **************************************************

C1              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
C2              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
C3              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
C4              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
C5              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
C6              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
                **************************************************

C1              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
C2              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
C3              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
C4              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
C5              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
C6              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
                **************************************************

C1              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
C2              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
C3              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
C4              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
C5              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
C6              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
                **************************************************

C1              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
C2              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
C3              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
C4              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
C5              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
C6              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
                **************************************************

C1              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
C2              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
C3              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
C4              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
C5              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
C6              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
                **************************************************

C1              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
C2              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
C3              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
C4              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
C5              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
C6              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
                **************************************************

C1              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
C2              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
C3              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
C4              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
C5              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
C6              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
                **************************************************

C1              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
C2              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
C3              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
C4              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
C5              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
C6              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
                **************************************************

C1              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
C2              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
C3              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
C4              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
C5              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
C6              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
                **************************************************

C1              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
C2              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
C3              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
C4              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
C5              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
C6              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
                **************************************************

C1              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
C2              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
C3              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
C4              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
C5              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
C6              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
                **************************************************

C1              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
C2              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
C3              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
C4              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
C5              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
C6              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
                **************************************************

C1              EDDALFLEPQLRVRIWN
C2              EDDALFLEPQLRVRIWN
C3              EDDALFLEPQLRVRIWN
C4              EDDALFLEPQLRVRIWN
C5              EDDALFLEPQLRVRIWN
C6              EDDALFLEPQLRVRIWN
                *****************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  667 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  667 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20010]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [20010]--->[20010]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.605 Mb, Max= 31.297 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
C2              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
C3              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
C4              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
C5              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
C6              VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
                **************************************************

C1              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
C2              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
C3              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
C4              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
C5              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
C6              HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
                **************************************************

C1              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
C2              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
C3              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
C4              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
C5              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
C6              GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
                **************************************************

C1              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
C2              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
C3              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
C4              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
C5              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
C6              YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
                **************************************************

C1              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
C2              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
C3              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
C4              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
C5              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
C6              RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
                **************************************************

C1              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
C2              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
C3              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
C4              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
C5              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
C6              WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
                **************************************************

C1              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
C2              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
C3              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
C4              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
C5              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
C6              RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
                **************************************************

C1              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
C2              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
C3              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
C4              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
C5              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
C6              LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
                **************************************************

C1              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
C2              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
C3              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
C4              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
C5              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
C6              FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
                **************************************************

C1              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
C2              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
C3              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
C4              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
C5              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
C6              EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
                **************************************************

C1              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
C2              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
C3              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
C4              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
C5              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
C6              HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
                **************************************************

C1              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
C2              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
C3              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
C4              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
C5              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
C6              LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
                **************************************************

C1              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
C2              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
C3              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
C4              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
C5              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
C6              FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
                **************************************************

C1              EDDALFLEPQLRVRIWN
C2              EDDALFLEPQLRVRIWN
C3              EDDALFLEPQLRVRIWN
C4              EDDALFLEPQLRVRIWN
C5              EDDALFLEPQLRVRIWN
C6              EDDALFLEPQLRVRIWN
                *****************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
C2              GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
C3              GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
C4              GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
C5              GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
C6              GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
                **************************************************

C1              CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
C2              CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
C3              CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
C4              CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
C5              CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
C6              CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
                **************************************************

C1              TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
C2              TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
C3              TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
C4              TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
C5              TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
C6              TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
                **************************************************

C1              CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
C2              CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
C3              CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
C4              CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
C5              CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
C6              CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
                **************************************************

C1              CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
C2              CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
C3              CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
C4              CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
C5              CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
C6              CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
                **************************************************

C1              TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
C2              TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
C3              TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
C4              TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
C5              TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
C6              TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
                **************************************************

C1              GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
C2              GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
C3              GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
C4              GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
C5              GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
C6              GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
                **************************************************

C1              TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
C2              TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
C3              TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
C4              TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
C5              TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
C6              TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
                **************************************************

C1              GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
C2              GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
C3              GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
C4              GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
C5              GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
C6              GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
                **************************************************

C1              TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
C2              TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
C3              TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
C4              TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
C5              TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
C6              TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
                **************************************************

C1              TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
C2              TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
C3              TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
C4              TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
C5              TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
C6              TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
                **************************************************

C1              TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
C2              TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
C3              TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
C4              TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
C5              TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
C6              TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
                **************************************************

C1              CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
C2              CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
C3              CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
C4              CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
C5              CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
C6              CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
                **************************************************

C1              TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
C2              TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
C3              TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
C4              TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
C5              TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
C6              TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
                **************************************************

C1              ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
C2              ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
C3              ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
C4              ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
C5              ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
C6              ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
                **************************************************

C1              TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
C2              TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
C3              TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
C4              TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
C5              TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
C6              TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
                **************************************************

C1              ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
C2              ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
C3              ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
C4              ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
C5              ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
C6              ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
                **************************************************

C1              AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
C2              AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
C3              AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
C4              AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
C5              AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
C6              AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
                **************************************************

C1              CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
C2              CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
C3              CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
C4              CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
C5              CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
C6              CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
                **************************************************

C1              TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
C2              TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
C3              TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
C4              TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
C5              TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
C6              TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
                **************************************************

C1              AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
C2              AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
C3              AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
C4              AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
C5              AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
C6              AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
                **************************************************

C1              CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
C2              CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
C3              CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
C4              CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
C5              CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
C6              CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
                **************************************************

C1              CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
C2              CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
C3              CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
C4              CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
C5              CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
C6              CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
                **************************************************

C1              CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
C2              CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
C3              CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
C4              CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
C5              CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
C6              CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
                **************************************************

C1              TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
C2              TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
C3              TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
C4              TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
C5              TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
C6              TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
                **************************************************

C1              GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
C2              GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
C3              GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
C4              GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
C5              GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
C6              GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
                **************************************************

C1              TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
C2              TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
C3              TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
C4              TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
C5              TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
C6              TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
                **************************************************

C1              GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
C2              GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
C3              GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
C4              GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
C5              GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
C6              GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
                **************************************************

C1              GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
C2              GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
C3              GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
C4              GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
C5              GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
C6              GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
                **************************************************

C1              TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
C2              TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
C3              TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
C4              TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
C5              TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
C6              TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
                **************************************************

C1              CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
C2              CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
C3              CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
C4              CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
C5              CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
C6              CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
                **************************************************

C1              CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
C2              CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
C3              CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
C4              CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
C5              CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
C6              CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
                **************************************************

C1              CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
C2              CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
C3              CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
C4              CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
C5              CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
C6              CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
                **************************************************

C1              CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
C2              CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
C3              CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
C4              CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
C5              CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
C6              CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
                **************************************************

C1              CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
C2              CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
C3              CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
C4              CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
C5              CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
C6              CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
                **************************************************

C1              ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
C2              ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
C3              ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
C4              ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
C5              ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
C6              ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
                **************************************************

C1              TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
C2              TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
C3              TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
C4              TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
C5              TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
C6              TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
                **************************************************

C1              AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
C2              AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
C3              AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
C4              AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
C5              AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
C6              AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
                **************************************************

C1              ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
C2              ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
C3              ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
C4              ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
C5              ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
C6              ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
                **************************************************

C1              GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C2              GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C3              GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C4              GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C5              GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C6              GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
                **************************************************

C1              C
C2              C
C3              C
C4              C
C5              C
C6              C
                *



>C1
GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C
>C2
GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C
>C3
GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C
>C4
GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C
>C5
GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C
>C6
GTGAATATAGAGGCCATCCGTTCGGGCATCGACCTCAGCTATGTCGACGC
CAATACCCGACCCCAAGACGACCTGTTCGGTCATGTAAACGGCCGCTGGC
TATACGAATACGAGATACCCGCCGACCGGTCGACCGACGGAGCCTTCCGC
CACCTGTTCGACCAAACCGAAGAGCAGGTGCGCGACTTGATCACAGAAGC
CAGCGGGACAGCCGCCGCAGGGGAGACCGCGGAGGCCGACGCACAGCGCA
TCGGTGACTTGTACGCCAGCTTCCTCGACGAGCAAACCGTTGAACGCAGA
GGGACCCAACCCCTGCTGGAGGAGTTGGCCTTGATCGATAACGCCACCGA
TACCTCCGATTTGGCCGCCGTCCTTGGCGCGTTGCAACGCACCGGGATGG
GCGGCGGCGTCGAAGTCTATGTGGATACCGATTCCAAAGATTCGACCCGT
TACCTGCTGCACTTCAGCCAATCAGGCATCGGGTTGCCCGACGAGTCCTA
TTTCCACGATGATCAGCACGCCGAGGTGCTGGCAGCCTACCCTGAACACA
TCGCACGAATGTTCACTCTGGTGTATCGGGGCGAACGCTACCAAGATCCC
CGATGCCACGCCAAAACCGCTGCTCGCATCGTGGCGTTGGAGACCAAACT
TGCCGACGCGCACTGGGACGTGGTTAAGCGCCGCGACGCCGACTTGTCCT
ACAACCTGCGCACGTTCGCCGAACTACAAAGCGACGGTGTGGGCTTCGAC
TGGTCCGCCTGGGTGACCGCGTTGGGCAATACGCCAGAATCAGTCACTGA
ATTAGTTGTGCGCCAACCTGATTATCTCACCGCGTTTGCTGCACTGTGGG
AAACTATTAACCTCGAAGACTGGAAGTGCTGGGCACGTTGGCGATTGATC
CGCGCCCGCGCCCCCTGGCTGACCGACGACTTGGTTGCCGCGGACTTCGA
TTTCTATGGACGCCTGCTGACCGGCGCCGAGCAAATCCGTAACCGCTGGA
AACGAGGGGTTTCGCTGGTAGAGAACCTAATGGGCGATGCCGTCGGAAAG
CTTTACGTGCAAAGACATTTCCCGCTGCACGCCAAAGCCCGCGTCGATGC
CCTGGCGGACAATCTGCAACAAGCGTACCGAATCAGTATCAGCGAATTGG
CCTGGATGACGCCACAGACTCGAGAGCGCGCGCTGGCCAAACTAACCAAG
TTCACCGCCAAGGTTGGCTACCCGAAGAAGTGGCGGGACTACTCTCAGCT
GGTAATCGACCGGGACGACCTCTACGGCAACTGCCAACGAGGGTACGCAG
TCAACCACGATCGCGAGCTGGCCAAGCTCGGCGGTCCGGTGGACCGTGAC
GAATGGTTTATGACGCCGCAGACGGTCAACGCGTACTACAACCCAGGAAT
GAATGAAATCGTTTTCCCCGCAGCTATTCTTCAGCCGCCGTTCTTCGACG
TCGAGGCCGACGACGCCGTCAACTACGGTGGGATCGGGGCAGTGATCGGA
CACGAGATCGGGCACGGCTTCGACGACCAGGGAGCCAAATACGACGGCGA
CGGCAATCTGATCGACTGGTGGACTGACGACGATCGCACCGAGTTCAACA
CTCGCACCAAGGCGCTCATCGAGCAATATAATGTGTACACCCCTCGGGGG
CTCGACGACCACCACGTAAATGGCGCTTTCACCGTCGGTGAGAACATCGG
CGATCTGGGCGGGCTGTCCATCGCACTACTAGCCTACCAGCTGTCGCTGA
ACGGCCAATCAGCTCCTGTTATCGACGGTCTCACCGGCGTACAGCGCGTG
TTTTTCGGCTGGGCACAGATGTGGCGGTCCAAATCTCGAGACGCTGAGAC
AATACGACGGTTAGCCGTGGATCCGCATTCACCGCCAGAGTTCCGGTGCA
ATGGCGTTATCCGTAATGTTGACGCCTTTTACGACGCCTTTGACGTAGAT
GAAGACGACGCACTGTTCCTGGAACCTCAGCTCAGGGTCAGGATCTGGAA
C
>C1
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
>C2
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
>C3
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
>C4
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
>C5
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN
>C6
VNIEAIRSGIDLSYVDANTRPQDDLFGHVNGRWLYEYEIPADRSTDGAFR
HLFDQTEEQVRDLITEASGTAAAGETAEADAQRIGDLYASFLDEQTVERR
GTQPLLEELALIDNATDTSDLAAVLGALQRTGMGGGVEVYVDTDSKDSTR
YLLHFSQSGIGLPDESYFHDDQHAEVLAAYPEHIARMFTLVYRGERYQDP
RCHAKTAARIVALETKLADAHWDVVKRRDADLSYNLRTFAELQSDGVGFD
WSAWVTALGNTPESVTELVVRQPDYLTAFAALWETINLEDWKCWARWRLI
RARAPWLTDDLVAADFDFYGRLLTGAEQIRNRWKRGVSLVENLMGDAVGK
LYVQRHFPLHAKARVDALADNLQQAYRISISELAWMTPQTRERALAKLTK
FTAKVGYPKKWRDYSQLVIDRDDLYGNCQRGYAVNHDRELAKLGGPVDRD
EWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDVEADDAVNYGGIGAVIG
HEIGHGFDDQGAKYDGDGNLIDWWTDDDRTEFNTRTKALIEQYNVYTPRG
LDDHHVNGAFTVGENIGDLGGLSIALLAYQLSLNGQSAPVIDGLTGVQRV
FFGWAQMWRSKSRDAETIRRLAVDPHSPPEFRCNGVIRNVDAFYDAFDVD
EDDALFLEPQLRVRIWN


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2613/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 2001 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859289
      Setting output file names to "/data/9res/ML2613/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 43700240
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5403949970
      Seed = 134567152
      Swapseed = 1579859289
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -4478.333939 -- -24.965149
         Chain 2 -- -4478.333939 -- -24.965149
         Chain 3 -- -4478.333683 -- -24.965149
         Chain 4 -- -4478.333256 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -4478.333939 -- -24.965149
         Chain 2 -- -4478.333939 -- -24.965149
         Chain 3 -- -4478.333939 -- -24.965149
         Chain 4 -- -4478.333683 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-4478.334] (-4478.334) (-4478.334) (-4478.333) * [-4478.334] (-4478.334) (-4478.334) (-4478.334) 
        500 -- (-2755.692) [-2751.294] (-2767.047) (-2769.918) * (-2755.602) (-2753.131) (-2750.734) [-2756.078] -- 0:00:00
       1000 -- (-2748.710) [-2752.359] (-2748.110) (-2759.030) * (-2760.519) (-2757.437) (-2744.391) [-2745.815] -- 0:00:00
       1500 -- (-2755.137) (-2748.894) [-2752.291] (-2754.632) * (-2742.257) (-2758.056) (-2743.559) [-2744.709] -- 0:00:00
       2000 -- (-2756.792) [-2744.495] (-2744.927) (-2757.787) * (-2752.896) [-2746.057] (-2740.298) (-2753.851) -- 0:00:00
       2500 -- (-2756.872) (-2742.752) (-2743.238) [-2747.472] * (-2750.578) (-2750.711) [-2754.545] (-2744.694) -- 0:00:00
       3000 -- (-2757.579) (-2745.748) (-2744.670) [-2743.559] * (-2751.170) (-2755.473) (-2745.421) [-2745.395] -- 0:00:00
       3500 -- (-2745.687) (-2766.492) (-2752.466) [-2740.714] * (-2753.923) [-2747.410] (-2751.071) (-2749.331) -- 0:00:00
       4000 -- (-2747.385) (-2743.357) [-2742.360] (-2753.651) * (-2750.831) [-2745.643] (-2743.637) (-2748.344) -- 0:00:00
       4500 -- (-2751.009) (-2744.814) (-2743.012) [-2751.982] * (-2743.905) [-2752.468] (-2753.743) (-2749.909) -- 0:00:00
       5000 -- [-2742.938] (-2748.038) (-2742.026) (-2749.258) * (-2745.987) (-2748.791) (-2745.758) [-2744.030] -- 0:00:00

      Average standard deviation of split frequencies: 0.085710

       5500 -- (-2751.427) [-2749.042] (-2748.778) (-2741.961) * (-2744.409) (-2745.570) [-2741.578] (-2747.636) -- 0:00:00
       6000 -- (-2743.952) (-2753.080) (-2756.018) [-2743.806] * (-2749.058) (-2749.629) (-2743.696) [-2745.671] -- 0:00:00
       6500 -- (-2744.341) [-2755.119] (-2748.118) (-2743.134) * [-2741.492] (-2751.226) (-2745.032) (-2743.514) -- 0:00:00
       7000 -- (-2749.427) (-2754.697) [-2743.458] (-2747.376) * (-2753.564) [-2744.155] (-2750.376) (-2752.015) -- 0:00:00
       7500 -- (-2750.684) (-2756.409) (-2750.719) [-2745.080] * (-2747.325) (-2744.060) (-2747.278) [-2743.101] -- 0:00:00
       8000 -- (-2747.054) (-2744.813) [-2744.925] (-2742.686) * (-2751.499) (-2750.738) [-2745.747] (-2746.339) -- 0:00:00
       8500 -- (-2742.889) (-2746.892) [-2746.115] (-2753.820) * (-2745.460) (-2747.452) [-2746.640] (-2752.110) -- 0:00:00
       9000 -- [-2748.380] (-2748.204) (-2749.839) (-2747.833) * (-2743.496) [-2742.821] (-2748.257) (-2751.353) -- 0:00:00
       9500 -- (-2744.959) (-2749.117) (-2745.816) [-2754.189] * (-2743.067) (-2749.186) [-2751.038] (-2752.240) -- 0:00:00
      10000 -- [-2749.153] (-2749.055) (-2745.918) (-2753.950) * [-2743.663] (-2753.350) (-2743.633) (-2748.163) -- 0:00:00

      Average standard deviation of split frequencies: 0.082075

      10500 -- (-2747.363) (-2750.721) (-2745.739) [-2746.984] * (-2749.449) [-2745.048] (-2746.375) (-2756.324) -- 0:00:00
      11000 -- (-2755.151) (-2745.332) [-2746.690] (-2750.240) * (-2749.224) [-2751.672] (-2740.867) (-2746.395) -- 0:00:00
      11500 -- (-2750.707) [-2747.381] (-2745.446) (-2748.110) * [-2746.256] (-2750.364) (-2747.976) (-2755.592) -- 0:00:00
      12000 -- (-2752.530) [-2767.359] (-2749.719) (-2748.374) * [-2744.763] (-2738.764) (-2749.071) (-2753.890) -- 0:00:00
      12500 -- (-2742.433) (-2756.799) [-2745.080] (-2749.270) * (-2748.151) (-2737.766) [-2744.477] (-2752.557) -- 0:01:19
      13000 -- (-2746.056) (-2745.161) (-2749.929) [-2746.655] * (-2752.910) [-2737.593] (-2743.713) (-2747.378) -- 0:01:15
      13500 -- [-2748.410] (-2758.074) (-2749.561) (-2743.745) * (-2748.900) (-2738.512) (-2752.796) [-2745.110] -- 0:01:13
      14000 -- (-2755.500) (-2757.781) (-2741.611) [-2741.904] * (-2747.992) (-2737.428) [-2749.369] (-2744.017) -- 0:01:10
      14500 -- (-2744.389) (-2738.069) (-2739.368) [-2742.139] * (-2741.071) [-2737.285] (-2750.167) (-2751.354) -- 0:01:07
      15000 -- (-2741.870) (-2738.243) (-2741.186) [-2749.675] * (-2757.815) (-2737.218) (-2746.883) [-2742.585] -- 0:01:05

      Average standard deviation of split frequencies: 0.050508

      15500 -- (-2745.263) (-2738.716) [-2740.310] (-2749.047) * [-2743.489] (-2737.762) (-2747.377) (-2746.733) -- 0:01:03
      16000 -- (-2749.104) [-2738.748] (-2743.560) (-2752.822) * (-2750.615) (-2738.826) (-2748.064) [-2750.483] -- 0:01:01
      16500 -- (-2742.155) (-2738.767) (-2743.779) [-2747.536] * (-2744.685) (-2737.767) [-2752.635] (-2746.851) -- 0:00:59
      17000 -- (-2743.656) (-2737.982) [-2744.009] (-2750.672) * [-2745.351] (-2737.539) (-2745.737) (-2749.428) -- 0:00:57
      17500 -- [-2746.954] (-2740.409) (-2738.019) (-2743.767) * (-2744.593) [-2737.305] (-2748.250) (-2747.657) -- 0:00:56
      18000 -- (-2751.153) (-2739.672) [-2738.028] (-2750.975) * (-2751.377) [-2737.574] (-2750.540) (-2752.147) -- 0:00:54
      18500 -- [-2748.563] (-2741.495) (-2738.066) (-2747.830) * [-2745.343] (-2737.839) (-2748.077) (-2748.971) -- 0:00:53
      19000 -- (-2745.559) (-2740.076) (-2738.015) [-2752.459] * (-2747.988) (-2737.918) (-2753.377) [-2743.547] -- 0:00:51
      19500 -- (-2747.028) (-2740.095) (-2738.066) [-2749.518] * [-2746.980] (-2738.698) (-2745.873) (-2745.887) -- 0:00:50
      20000 -- (-2755.108) (-2740.096) (-2738.989) [-2744.321] * (-2747.345) (-2737.693) (-2743.028) [-2742.863] -- 0:00:49

      Average standard deviation of split frequencies: 0.038417

      20500 -- (-2749.045) (-2739.080) (-2738.746) [-2742.002] * (-2744.455) (-2737.374) (-2742.810) [-2743.106] -- 0:00:47
      21000 -- [-2745.480] (-2739.053) (-2738.423) (-2753.311) * [-2743.770] (-2738.461) (-2743.949) (-2746.990) -- 0:00:46
      21500 -- [-2754.600] (-2738.356) (-2740.531) (-2745.126) * (-2749.703) (-2738.936) (-2747.637) [-2745.596] -- 0:00:45
      22000 -- (-2748.072) (-2738.800) (-2739.300) [-2748.186] * (-2753.344) (-2740.676) [-2746.402] (-2751.970) -- 0:00:44
      22500 -- (-2744.165) (-2738.800) [-2737.118] (-2744.683) * (-2751.384) (-2740.436) [-2743.004] (-2748.882) -- 0:00:43
      23000 -- (-2743.040) (-2742.114) (-2739.601) [-2752.962] * (-2746.329) [-2739.806] (-2745.033) (-2755.170) -- 0:00:42
      23500 -- [-2746.570] (-2739.271) (-2738.001) (-2751.636) * (-2748.338) (-2739.822) [-2744.450] (-2753.811) -- 0:00:41
      24000 -- (-2755.329) (-2738.867) [-2737.095] (-2747.973) * (-2755.546) (-2738.931) [-2748.643] (-2749.846) -- 0:00:40
      24500 -- (-2747.280) (-2738.885) (-2737.391) [-2747.822] * (-2746.401) (-2738.030) [-2748.806] (-2749.641) -- 0:00:39
      25000 -- (-2752.831) (-2738.976) [-2736.807] (-2750.096) * (-2745.074) (-2741.181) (-2747.592) [-2745.690] -- 0:00:39

      Average standard deviation of split frequencies: 0.038170

      25500 -- (-2745.045) (-2739.461) [-2737.165] (-2745.855) * [-2744.624] (-2742.273) (-2750.992) (-2746.692) -- 0:00:38
      26000 -- [-2746.608] (-2736.949) (-2737.165) (-2756.834) * [-2754.264] (-2738.087) (-2750.377) (-2750.722) -- 0:00:37
      26500 -- [-2743.653] (-2736.949) (-2737.620) (-2748.025) * (-2750.531) [-2740.129] (-2750.329) (-2754.645) -- 0:01:13
      27000 -- (-2743.103) (-2737.404) [-2740.270] (-2745.077) * (-2753.943) (-2738.084) [-2737.349] (-2747.439) -- 0:01:12
      27500 -- (-2745.075) (-2737.920) [-2738.830] (-2749.700) * (-2747.887) [-2737.595] (-2737.360) (-2749.405) -- 0:01:10
      28000 -- (-2755.867) [-2737.151] (-2739.328) (-2751.443) * (-2748.115) (-2737.776) [-2738.074] (-2752.956) -- 0:01:09
      28500 -- (-2741.633) (-2737.473) [-2738.443] (-2747.287) * [-2745.555] (-2737.555) (-2744.408) (-2742.012) -- 0:01:08
      29000 -- [-2743.682] (-2737.428) (-2739.358) (-2747.319) * (-2750.315) (-2738.377) (-2744.392) [-2747.811] -- 0:01:06
      29500 -- (-2751.033) (-2737.419) (-2739.806) [-2747.590] * (-2750.001) (-2738.591) [-2743.436] (-2748.997) -- 0:01:05
      30000 -- [-2746.628] (-2738.781) (-2738.160) (-2746.279) * [-2747.340] (-2741.512) (-2743.216) (-2741.398) -- 0:01:04

      Average standard deviation of split frequencies: 0.039198

      30500 -- (-2742.982) (-2738.781) (-2739.046) [-2749.721] * [-2753.050] (-2738.533) (-2739.610) (-2748.969) -- 0:01:03
      31000 -- (-2747.626) (-2738.437) (-2739.403) [-2746.537] * (-2749.918) [-2737.857] (-2742.556) (-2750.194) -- 0:01:02
      31500 -- (-2754.760) (-2737.362) (-2740.492) [-2742.923] * (-2745.654) [-2738.086] (-2742.267) (-2744.258) -- 0:01:01
      32000 -- (-2751.540) (-2739.895) (-2739.504) [-2744.939] * (-2745.666) (-2739.845) (-2739.280) [-2741.477] -- 0:01:00
      32500 -- (-2751.266) (-2738.381) [-2738.273] (-2746.151) * (-2744.759) (-2739.699) (-2739.179) [-2747.983] -- 0:00:59
      33000 -- [-2742.882] (-2737.812) (-2737.203) (-2741.381) * [-2748.592] (-2739.489) (-2739.618) (-2753.738) -- 0:00:58
      33500 -- (-2755.033) (-2737.901) [-2737.059] (-2743.236) * [-2747.988] (-2740.529) (-2741.461) (-2746.320) -- 0:00:57
      34000 -- [-2754.749] (-2738.297) (-2739.459) (-2739.551) * (-2745.705) (-2739.665) [-2737.834] (-2744.149) -- 0:00:56
      34500 -- (-2747.572) (-2738.349) [-2737.497] (-2738.764) * [-2747.222] (-2742.958) (-2738.168) (-2757.221) -- 0:00:55
      35000 -- (-2746.012) (-2739.409) (-2736.661) [-2738.585] * (-2745.724) [-2738.602] (-2737.244) (-2750.998) -- 0:00:55

      Average standard deviation of split frequencies: 0.036790

      35500 -- (-2751.596) (-2739.409) (-2737.833) [-2738.126] * (-2752.441) (-2738.972) [-2736.367] (-2754.146) -- 0:00:54
      36000 -- [-2747.686] (-2737.331) (-2737.085) (-2738.122) * [-2744.821] (-2737.559) (-2738.109) (-2746.036) -- 0:00:53
      36500 -- (-2748.277) (-2739.024) (-2738.792) [-2738.122] * (-2740.216) (-2737.174) [-2738.105] (-2745.909) -- 0:00:52
      37000 -- (-2747.288) [-2737.771] (-2738.966) (-2737.429) * [-2744.935] (-2736.847) (-2739.051) (-2754.137) -- 0:00:52
      37500 -- (-2749.063) (-2739.247) (-2739.473) [-2737.412] * (-2746.765) (-2736.846) (-2741.473) [-2744.670] -- 0:00:51
      38000 -- (-2750.734) [-2739.303] (-2737.627) (-2739.078) * [-2744.116] (-2737.788) (-2740.926) (-2749.919) -- 0:00:50
      38500 -- [-2746.016] (-2743.584) (-2737.696) (-2737.335) * (-2741.689) [-2740.192] (-2740.921) (-2753.522) -- 0:00:49
      39000 -- (-2746.491) [-2743.662] (-2738.655) (-2738.408) * (-2748.555) [-2738.138] (-2738.541) (-2749.307) -- 0:00:49
      39500 -- (-2743.570) (-2740.923) (-2738.061) [-2741.207] * (-2744.488) (-2737.744) [-2737.875] (-2758.574) -- 0:00:48
      40000 -- (-2749.287) [-2744.200] (-2738.133) (-2745.647) * (-2748.568) (-2737.836) [-2737.611] (-2749.178) -- 0:00:48

      Average standard deviation of split frequencies: 0.037536

      40500 -- [-2746.074] (-2739.041) (-2737.920) (-2742.986) * (-2750.144) [-2736.840] (-2739.107) (-2757.136) -- 0:00:47
      41000 -- [-2751.889] (-2738.819) (-2737.920) (-2742.545) * (-2742.413) (-2739.050) (-2740.052) [-2748.345] -- 0:01:10
      41500 -- (-2738.399) (-2738.898) [-2737.920] (-2738.956) * (-2751.063) (-2740.020) [-2739.656] (-2752.608) -- 0:01:09
      42000 -- (-2738.492) (-2740.618) (-2737.920) [-2742.386] * (-2742.420) (-2740.792) (-2738.603) [-2746.815] -- 0:01:08
      42500 -- (-2739.489) (-2738.745) [-2739.213] (-2739.250) * (-2750.938) (-2741.154) [-2739.785] (-2752.328) -- 0:01:07
      43000 -- (-2740.003) [-2738.045] (-2742.289) (-2738.489) * (-2744.605) (-2744.708) (-2737.862) [-2743.772] -- 0:01:06
      43500 -- (-2741.127) [-2737.941] (-2740.940) (-2736.597) * [-2748.645] (-2736.603) (-2739.640) (-2744.775) -- 0:01:05
      44000 -- (-2740.347) [-2737.544] (-2737.732) (-2738.295) * (-2753.326) (-2736.603) [-2740.563] (-2751.847) -- 0:01:05
      44500 -- [-2740.767] (-2737.465) (-2741.796) (-2737.206) * (-2744.601) [-2736.718] (-2740.809) (-2750.828) -- 0:01:04
      45000 -- (-2737.814) (-2737.585) (-2742.086) [-2738.001] * [-2745.866] (-2737.182) (-2740.936) (-2744.284) -- 0:01:03

      Average standard deviation of split frequencies: 0.040526

      45500 -- (-2738.341) (-2737.813) (-2738.395) [-2738.826] * (-2745.056) [-2744.604] (-2739.796) (-2745.991) -- 0:01:02
      46000 -- (-2736.970) [-2737.666] (-2738.749) (-2738.430) * (-2748.274) (-2742.952) (-2741.144) [-2743.287] -- 0:01:02
      46500 -- (-2742.613) [-2737.484] (-2738.332) (-2738.465) * (-2753.382) (-2738.859) [-2741.285] (-2749.081) -- 0:01:01
      47000 -- [-2739.869] (-2737.483) (-2739.453) (-2738.622) * (-2746.304) (-2738.225) (-2737.307) [-2744.793] -- 0:01:00
      47500 -- (-2739.247) (-2739.706) [-2738.002] (-2742.207) * (-2743.768) [-2738.906] (-2737.125) (-2748.204) -- 0:01:00
      48000 -- [-2739.905] (-2740.182) (-2740.325) (-2739.561) * (-2745.538) (-2739.541) [-2738.002] (-2750.835) -- 0:00:59
      48500 -- (-2739.690) (-2741.346) (-2738.235) [-2739.561] * [-2748.300] (-2740.019) (-2738.041) (-2749.324) -- 0:00:58
      49000 -- (-2738.377) [-2739.242] (-2736.855) (-2744.288) * (-2750.924) [-2740.721] (-2738.271) (-2755.121) -- 0:00:58
      49500 -- [-2738.556] (-2739.638) (-2736.855) (-2737.852) * (-2755.606) [-2738.959] (-2737.874) (-2753.150) -- 0:00:57
      50000 -- (-2741.744) (-2737.201) (-2736.628) [-2737.652] * (-2748.210) (-2739.560) [-2737.755] (-2753.981) -- 0:00:57

      Average standard deviation of split frequencies: 0.034679

      50500 -- (-2737.205) (-2739.276) [-2736.628] (-2739.045) * (-2751.026) (-2737.543) [-2739.937] (-2752.043) -- 0:00:56
      51000 -- (-2737.370) (-2740.636) (-2737.113) [-2739.320] * (-2746.334) [-2737.600] (-2742.362) (-2762.091) -- 0:00:55
      51500 -- (-2739.045) (-2742.232) (-2737.113) [-2739.621] * (-2745.286) (-2738.984) (-2744.712) [-2743.905] -- 0:00:55
      52000 -- (-2739.236) (-2740.797) [-2739.643] (-2739.253) * (-2751.594) (-2738.615) (-2745.586) [-2747.845] -- 0:00:54
      52500 -- (-2741.254) (-2737.897) [-2736.390] (-2738.946) * (-2751.428) (-2738.615) (-2745.316) [-2747.638] -- 0:00:54
      53000 -- (-2738.886) (-2738.043) (-2737.294) [-2738.887] * (-2744.776) [-2736.878] (-2746.667) (-2749.316) -- 0:00:53
      53500 -- (-2739.294) [-2737.292] (-2737.299) (-2737.513) * (-2746.905) (-2736.860) (-2742.086) [-2741.845] -- 0:00:53
      54000 -- [-2736.767] (-2737.292) (-2740.017) (-2740.511) * (-2745.580) [-2736.725] (-2742.599) (-2744.299) -- 0:00:52
      54500 -- (-2736.808) [-2736.560] (-2740.975) (-2737.203) * (-2749.601) (-2739.053) [-2740.380] (-2743.659) -- 0:00:52
      55000 -- [-2736.242] (-2737.180) (-2741.343) (-2740.741) * (-2753.334) [-2738.520] (-2736.915) (-2746.375) -- 0:01:08

      Average standard deviation of split frequencies: 0.034874

      55500 -- [-2739.742] (-2737.339) (-2742.581) (-2737.976) * [-2746.939] (-2736.866) (-2737.078) (-2745.562) -- 0:01:08
      56000 -- (-2740.323) [-2736.457] (-2742.992) (-2737.968) * (-2746.929) (-2736.834) (-2737.353) [-2745.579] -- 0:01:07
      56500 -- (-2739.233) (-2737.536) (-2747.059) [-2737.666] * (-2756.070) (-2736.975) (-2737.242) [-2741.036] -- 0:01:06
      57000 -- (-2738.412) (-2736.681) (-2741.471) [-2740.945] * (-2746.081) [-2740.299] (-2737.259) (-2749.327) -- 0:01:06
      57500 -- (-2740.870) (-2737.663) [-2743.438] (-2740.769) * [-2742.059] (-2738.014) (-2737.197) (-2758.586) -- 0:01:05
      58000 -- (-2742.805) [-2737.060] (-2740.093) (-2739.697) * [-2750.226] (-2738.014) (-2737.836) (-2749.820) -- 0:01:04
      58500 -- (-2742.910) [-2736.597] (-2740.232) (-2739.740) * (-2743.818) (-2738.353) (-2737.549) [-2747.169] -- 0:01:04
      59000 -- (-2740.988) (-2739.302) [-2741.541] (-2741.356) * (-2756.428) (-2737.166) [-2736.693] (-2745.977) -- 0:01:03
      59500 -- (-2740.918) [-2737.679] (-2742.121) (-2741.700) * (-2754.506) (-2737.692) (-2739.505) [-2750.770] -- 0:01:03
      60000 -- (-2743.179) [-2737.795] (-2741.276) (-2740.578) * [-2747.247] (-2741.787) (-2739.296) (-2755.032) -- 0:01:02

      Average standard deviation of split frequencies: 0.035152

      60500 -- (-2743.758) [-2736.922] (-2740.127) (-2742.831) * (-2749.771) (-2743.010) (-2736.801) [-2743.395] -- 0:01:02
      61000 -- (-2738.250) (-2739.463) (-2739.407) [-2738.429] * (-2746.666) (-2742.565) [-2736.535] (-2754.374) -- 0:01:01
      61500 -- [-2736.424] (-2737.134) (-2738.284) (-2738.567) * (-2752.227) (-2740.209) [-2737.233] (-2749.358) -- 0:01:01
      62000 -- (-2738.311) (-2737.134) (-2738.284) [-2739.208] * (-2748.310) (-2740.339) [-2736.736] (-2755.132) -- 0:01:00
      62500 -- (-2738.318) (-2742.164) [-2738.112] (-2740.975) * (-2746.268) (-2739.429) (-2737.784) [-2747.420] -- 0:01:00
      63000 -- [-2738.309] (-2739.909) (-2737.822) (-2738.781) * (-2755.449) (-2742.296) [-2738.508] (-2749.918) -- 0:00:59
      63500 -- [-2737.447] (-2738.648) (-2736.813) (-2739.399) * [-2743.308] (-2738.534) (-2738.439) (-2745.641) -- 0:00:58
      64000 -- (-2737.554) (-2737.331) [-2736.813] (-2743.314) * (-2747.695) (-2740.182) [-2737.679] (-2747.337) -- 0:00:58
      64500 -- [-2737.083] (-2741.684) (-2736.813) (-2740.692) * (-2751.311) (-2740.009) [-2740.829] (-2746.468) -- 0:00:58
      65000 -- (-2737.662) (-2739.847) (-2736.813) [-2741.064] * (-2748.897) (-2738.815) (-2740.554) [-2742.568] -- 0:00:57

      Average standard deviation of split frequencies: 0.032141

      65500 -- (-2738.349) (-2738.722) (-2737.948) [-2737.415] * [-2745.551] (-2737.822) (-2738.318) (-2749.979) -- 0:00:57
      66000 -- (-2737.286) (-2738.610) [-2737.158] (-2738.975) * (-2743.466) (-2736.951) (-2737.943) [-2743.031] -- 0:00:56
      66500 -- (-2737.624) (-2738.098) (-2738.395) [-2740.719] * (-2753.432) (-2738.375) (-2739.436) [-2739.582] -- 0:00:56
      67000 -- (-2738.278) (-2742.019) [-2738.437] (-2741.092) * [-2747.861] (-2737.628) (-2739.862) (-2757.147) -- 0:00:55
      67500 -- (-2740.193) (-2738.748) (-2740.417) [-2738.456] * (-2752.833) [-2740.376] (-2739.148) (-2742.901) -- 0:00:55
      68000 -- [-2739.452] (-2740.712) (-2739.866) (-2743.992) * [-2742.515] (-2740.106) (-2742.265) (-2745.217) -- 0:00:54
      68500 -- (-2738.467) (-2739.163) [-2738.110] (-2739.867) * [-2746.241] (-2739.573) (-2742.266) (-2747.774) -- 0:00:54
      69000 -- (-2740.631) [-2738.251] (-2742.609) (-2738.692) * (-2747.678) (-2740.036) (-2739.007) [-2745.791] -- 0:00:53
      69500 -- (-2739.752) (-2738.254) (-2740.848) [-2738.429] * (-2744.805) (-2740.015) [-2737.525] (-2751.157) -- 0:01:06
      70000 -- (-2741.590) (-2739.852) [-2740.974] (-2738.564) * [-2750.283] (-2739.988) (-2737.383) (-2749.120) -- 0:01:06

      Average standard deviation of split frequencies: 0.034407

      70500 -- (-2738.387) (-2739.173) (-2741.061) [-2737.670] * (-2746.903) (-2737.897) [-2736.902] (-2744.536) -- 0:01:05
      71000 -- [-2738.845] (-2738.720) (-2738.342) (-2739.173) * [-2744.306] (-2741.669) (-2738.477) (-2749.902) -- 0:01:05
      71500 -- (-2738.858) (-2737.867) (-2741.158) [-2737.552] * (-2744.693) (-2740.133) [-2738.214] (-2750.420) -- 0:01:04
      72000 -- (-2738.262) (-2737.867) [-2736.821] (-2737.809) * (-2748.560) (-2738.964) (-2738.237) [-2749.338] -- 0:01:04
      72500 -- (-2736.315) (-2736.954) (-2738.376) [-2736.865] * [-2745.749] (-2739.299) (-2736.943) (-2754.034) -- 0:01:03
      73000 -- (-2738.079) (-2738.040) (-2736.653) [-2737.499] * [-2746.142] (-2740.872) (-2737.163) (-2753.402) -- 0:01:03
      73500 -- (-2737.619) [-2739.935] (-2738.813) (-2740.021) * (-2756.758) (-2739.942) [-2736.783] (-2749.385) -- 0:01:03
      74000 -- (-2737.271) (-2739.071) [-2736.920] (-2740.360) * (-2747.892) (-2740.630) [-2736.760] (-2744.322) -- 0:01:02
      74500 -- [-2737.108] (-2740.692) (-2737.707) (-2740.416) * (-2755.967) (-2741.057) [-2738.263] (-2746.397) -- 0:01:02
      75000 -- (-2737.054) [-2737.228] (-2738.258) (-2740.341) * (-2749.945) (-2740.697) [-2737.951] (-2745.036) -- 0:01:01

      Average standard deviation of split frequencies: 0.036563

      75500 -- (-2739.396) [-2737.761] (-2738.298) (-2741.312) * (-2754.927) (-2743.788) (-2738.640) [-2748.751] -- 0:01:01
      76000 -- (-2737.314) (-2737.459) (-2740.555) [-2740.956] * [-2745.251] (-2743.700) (-2737.674) (-2749.374) -- 0:01:00
      76500 -- [-2737.317] (-2740.002) (-2741.108) (-2740.622) * (-2742.895) (-2744.581) [-2737.674] (-2759.757) -- 0:01:00
      77000 -- [-2737.773] (-2740.091) (-2740.871) (-2739.573) * [-2744.281] (-2740.424) (-2737.180) (-2747.126) -- 0:00:59
      77500 -- (-2741.775) [-2739.036] (-2740.809) (-2740.158) * (-2748.513) (-2740.137) [-2737.161] (-2754.109) -- 0:00:59
      78000 -- (-2742.680) [-2738.463] (-2737.460) (-2737.310) * [-2742.389] (-2740.925) (-2737.960) (-2748.279) -- 0:00:59
      78500 -- (-2739.339) [-2739.173] (-2737.923) (-2738.410) * [-2746.090] (-2740.983) (-2737.162) (-2748.882) -- 0:00:58
      79000 -- (-2739.518) [-2739.225] (-2737.405) (-2738.287) * (-2747.549) (-2737.352) (-2737.290) [-2756.030] -- 0:00:58
      79500 -- (-2739.704) (-2739.296) [-2736.639] (-2739.223) * (-2748.277) (-2737.446) (-2740.030) [-2744.024] -- 0:00:57
      80000 -- (-2739.704) (-2741.169) [-2736.847] (-2737.394) * (-2746.169) [-2739.695] (-2737.045) (-2744.854) -- 0:00:57

      Average standard deviation of split frequencies: 0.035712

      80500 -- (-2739.268) (-2742.093) (-2737.273) [-2737.465] * (-2750.647) (-2738.406) (-2736.884) [-2744.097] -- 0:00:57
      81000 -- [-2737.399] (-2742.604) (-2738.541) (-2737.466) * [-2756.649] (-2738.407) (-2737.860) (-2745.889) -- 0:00:56
      81500 -- (-2738.795) (-2737.716) (-2738.560) [-2738.531] * (-2759.316) [-2738.346] (-2737.771) (-2746.904) -- 0:00:56
      82000 -- [-2737.352] (-2737.422) (-2738.829) (-2738.181) * (-2746.998) (-2738.589) [-2740.990] (-2746.951) -- 0:00:55
      82500 -- (-2738.283) (-2738.103) [-2738.664] (-2738.481) * (-2747.473) [-2738.201] (-2738.830) (-2745.335) -- 0:01:06
      83000 -- [-2737.811] (-2737.394) (-2740.309) (-2738.117) * (-2747.214) (-2738.443) [-2741.836] (-2747.663) -- 0:01:06
      83500 -- [-2737.798] (-2738.544) (-2739.666) (-2738.301) * (-2754.800) [-2738.081] (-2740.428) (-2748.147) -- 0:01:05
      84000 -- (-2737.618) (-2737.156) (-2739.650) [-2737.525] * [-2753.262] (-2738.003) (-2741.180) (-2750.513) -- 0:01:05
      84500 -- [-2738.434] (-2739.239) (-2738.584) (-2737.531) * (-2746.761) (-2738.256) (-2739.725) [-2752.860] -- 0:01:05
      85000 -- (-2737.006) [-2739.318] (-2737.763) (-2737.967) * (-2742.416) (-2738.829) (-2739.753) [-2742.880] -- 0:01:04

      Average standard deviation of split frequencies: 0.034107

      85500 -- [-2736.801] (-2740.061) (-2737.697) (-2737.756) * (-2745.799) [-2739.161] (-2738.452) (-2742.651) -- 0:01:04
      86000 -- (-2737.367) (-2742.132) (-2737.229) [-2737.538] * (-2747.902) (-2738.290) [-2737.573] (-2747.160) -- 0:01:03
      86500 -- (-2736.611) (-2738.141) (-2739.033) [-2737.182] * (-2744.441) (-2738.293) (-2738.438) [-2745.811] -- 0:01:03
      87000 -- [-2736.698] (-2738.417) (-2738.501) (-2736.514) * (-2752.561) (-2738.292) (-2736.973) [-2746.436] -- 0:01:02
      87500 -- [-2737.554] (-2737.955) (-2737.852) (-2737.175) * (-2745.370) (-2738.019) [-2737.166] (-2741.875) -- 0:01:02
      88000 -- [-2741.909] (-2737.572) (-2737.852) (-2737.114) * (-2749.189) [-2737.675] (-2737.290) (-2748.770) -- 0:01:02
      88500 -- (-2739.076) [-2740.563] (-2737.386) (-2737.112) * (-2746.735) (-2738.569) (-2739.898) [-2743.428] -- 0:01:01
      89000 -- (-2747.005) [-2740.867] (-2737.569) (-2737.315) * (-2745.573) [-2737.513] (-2740.354) (-2748.027) -- 0:01:01
      89500 -- (-2737.974) (-2739.108) (-2739.311) [-2737.305] * (-2746.530) [-2737.815] (-2738.665) (-2747.961) -- 0:01:01
      90000 -- (-2740.884) (-2738.484) (-2739.701) [-2737.305] * (-2747.459) (-2737.679) [-2739.785] (-2748.091) -- 0:01:00

      Average standard deviation of split frequencies: 0.036395

      90500 -- (-2738.259) (-2739.121) [-2740.590] (-2736.810) * [-2748.494] (-2739.078) (-2740.112) (-2749.652) -- 0:01:00
      91000 -- (-2736.989) (-2740.725) (-2739.113) [-2737.442] * [-2745.917] (-2741.388) (-2739.494) (-2744.147) -- 0:00:59
      91500 -- [-2737.723] (-2737.970) (-2739.579) (-2739.604) * (-2745.361) (-2738.461) (-2738.733) [-2749.655] -- 0:00:59
      92000 -- [-2738.986] (-2737.989) (-2738.653) (-2742.362) * (-2751.716) (-2738.805) (-2738.106) [-2741.473] -- 0:00:59
      92500 -- [-2738.721] (-2737.901) (-2739.657) (-2736.678) * [-2743.126] (-2739.013) (-2741.208) (-2759.902) -- 0:00:58
      93000 -- (-2740.248) (-2738.697) (-2741.697) [-2739.055] * (-2750.153) (-2741.943) (-2741.612) [-2747.968] -- 0:00:58
      93500 -- (-2740.438) [-2736.889] (-2739.970) (-2737.973) * (-2749.323) (-2741.872) (-2739.803) [-2742.916] -- 0:00:58
      94000 -- [-2738.518] (-2739.430) (-2739.420) (-2739.021) * [-2750.628] (-2738.776) (-2741.317) (-2752.291) -- 0:00:57
      94500 -- (-2741.051) (-2737.264) [-2739.483] (-2736.817) * (-2754.652) (-2737.372) (-2740.671) [-2752.139] -- 0:00:57
      95000 -- (-2739.340) [-2738.858] (-2737.045) (-2736.825) * (-2746.186) (-2737.365) [-2737.015] (-2755.317) -- 0:00:57

      Average standard deviation of split frequencies: 0.031100

      95500 -- [-2739.856] (-2746.934) (-2737.047) (-2736.635) * (-2751.230) (-2737.271) (-2737.710) [-2744.241] -- 0:00:56
      96000 -- (-2737.089) [-2740.999] (-2740.416) (-2736.635) * (-2748.594) (-2742.138) (-2737.679) [-2743.036] -- 0:00:56
      96500 -- (-2737.017) (-2737.236) (-2736.830) [-2736.412] * (-2756.424) (-2740.227) [-2739.349] (-2738.276) -- 0:01:05
      97000 -- (-2736.943) (-2737.826) [-2736.507] (-2736.406) * (-2744.038) [-2738.049] (-2738.806) (-2737.657) -- 0:01:05
      97500 -- (-2737.298) (-2739.093) [-2736.842] (-2736.584) * [-2748.004] (-2738.049) (-2737.023) (-2737.129) -- 0:01:04
      98000 -- (-2738.063) (-2740.330) (-2737.387) [-2737.451] * (-2750.939) (-2737.089) [-2740.406] (-2737.538) -- 0:01:04
      98500 -- (-2736.780) (-2740.996) (-2737.399) [-2738.044] * [-2750.245] (-2739.641) (-2741.437) (-2738.458) -- 0:01:04
      99000 -- [-2736.971] (-2738.675) (-2736.641) (-2736.456) * (-2741.459) (-2739.471) (-2736.612) [-2737.996] -- 0:01:03
      99500 -- (-2739.346) (-2740.514) (-2736.641) [-2742.159] * (-2742.404) (-2742.208) [-2736.519] (-2737.928) -- 0:01:03
      100000 -- (-2739.267) (-2741.623) (-2736.971) [-2740.538] * (-2744.960) [-2739.861] (-2737.997) (-2737.709) -- 0:01:02

      Average standard deviation of split frequencies: 0.031479

      100500 -- [-2739.015] (-2740.805) (-2738.110) (-2738.294) * (-2752.985) (-2742.887) (-2739.187) [-2739.095] -- 0:01:02
      101000 -- (-2739.762) [-2739.589] (-2736.593) (-2736.362) * (-2747.864) (-2743.138) (-2737.424) [-2738.031] -- 0:01:02
      101500 -- [-2739.022] (-2740.970) (-2736.846) (-2736.125) * (-2749.355) (-2740.283) [-2737.091] (-2739.107) -- 0:01:01
      102000 -- (-2740.868) (-2741.007) [-2736.831] (-2736.125) * (-2746.166) (-2740.439) [-2737.950] (-2739.352) -- 0:01:01
      102500 -- [-2738.249] (-2740.373) (-2737.325) (-2736.187) * (-2745.408) (-2739.139) (-2738.123) [-2738.891] -- 0:01:01
      103000 -- (-2738.246) [-2740.102] (-2738.149) (-2736.187) * [-2752.972] (-2738.919) (-2737.536) (-2739.845) -- 0:01:00
      103500 -- (-2737.056) [-2739.743] (-2737.779) (-2741.928) * (-2746.177) (-2737.551) (-2737.437) [-2740.658] -- 0:01:00
      104000 -- (-2738.508) (-2738.683) (-2738.146) [-2740.776] * [-2746.511] (-2740.186) (-2736.676) (-2742.452) -- 0:01:00
      104500 -- (-2741.661) [-2737.267] (-2738.041) (-2740.869) * (-2746.790) (-2739.096) (-2736.388) [-2736.994] -- 0:00:59
      105000 -- (-2739.216) (-2738.055) [-2743.663] (-2740.626) * [-2742.779] (-2739.813) (-2736.232) (-2736.843) -- 0:00:59

      Average standard deviation of split frequencies: 0.033107

      105500 -- [-2738.518] (-2739.030) (-2738.900) (-2738.131) * (-2754.637) (-2740.484) [-2737.026] (-2737.181) -- 0:00:59
      106000 -- (-2738.132) (-2739.195) (-2740.367) [-2741.602] * [-2750.838] (-2736.724) (-2736.404) (-2737.305) -- 0:00:59
      106500 -- [-2737.683] (-2738.586) (-2739.025) (-2741.614) * (-2744.050) (-2739.004) [-2736.919] (-2738.642) -- 0:00:58
      107000 -- [-2738.767] (-2738.777) (-2737.403) (-2738.959) * [-2744.345] (-2740.651) (-2736.402) (-2738.640) -- 0:00:58
      107500 -- (-2740.900) [-2741.644] (-2736.769) (-2738.916) * [-2750.984] (-2741.132) (-2736.669) (-2740.541) -- 0:00:58
      108000 -- (-2737.765) [-2737.868] (-2738.831) (-2738.916) * (-2743.312) (-2741.093) (-2738.279) [-2738.534] -- 0:00:57
      108500 -- (-2736.663) [-2737.800] (-2738.815) (-2743.720) * (-2748.877) (-2738.173) (-2738.624) [-2738.533] -- 0:00:57
      109000 -- (-2737.947) (-2737.825) (-2738.361) [-2739.168] * (-2749.254) (-2738.173) [-2738.613] (-2738.534) -- 0:00:57
      109500 -- [-2737.687] (-2737.488) (-2740.496) (-2739.609) * (-2746.270) (-2739.859) [-2736.844] (-2740.215) -- 0:00:56
      110000 -- (-2736.860) (-2741.373) (-2740.372) [-2738.266] * [-2751.270] (-2737.787) (-2736.579) (-2740.878) -- 0:00:56

      Average standard deviation of split frequencies: 0.031474

      110500 -- (-2738.035) (-2741.275) (-2740.179) [-2741.056] * [-2753.217] (-2737.755) (-2738.756) (-2738.066) -- 0:00:56
      111000 -- (-2736.928) (-2743.349) [-2740.134] (-2743.598) * (-2745.314) (-2737.057) (-2737.244) [-2740.343] -- 0:01:04
      111500 -- [-2736.987] (-2737.751) (-2739.474) (-2742.105) * (-2751.153) (-2737.089) (-2737.904) [-2738.540] -- 0:01:03
      112000 -- (-2738.529) [-2739.386] (-2738.338) (-2745.632) * [-2747.275] (-2738.151) (-2740.295) (-2737.085) -- 0:01:03
      112500 -- (-2738.897) [-2740.984] (-2738.929) (-2743.612) * (-2747.229) (-2738.151) (-2736.419) [-2737.167] -- 0:01:03
      113000 -- [-2737.906] (-2741.092) (-2740.632) (-2737.296) * (-2747.292) (-2738.426) [-2736.420] (-2737.502) -- 0:01:02
      113500 -- (-2740.353) [-2741.053] (-2738.957) (-2739.864) * (-2751.156) (-2740.980) [-2736.450] (-2737.655) -- 0:01:02
      114000 -- (-2742.268) (-2740.801) [-2739.558] (-2738.718) * (-2752.188) (-2737.526) [-2736.613] (-2737.784) -- 0:01:02
      114500 -- [-2737.699] (-2742.162) (-2737.224) (-2738.271) * (-2750.721) (-2738.838) (-2736.879) [-2737.749] -- 0:01:01
      115000 -- (-2736.927) [-2740.117] (-2740.826) (-2737.611) * (-2743.807) [-2739.909] (-2737.424) (-2741.069) -- 0:01:01

      Average standard deviation of split frequencies: 0.031655

      115500 -- (-2739.158) (-2741.251) (-2742.024) [-2741.113] * (-2759.240) (-2737.079) (-2739.752) [-2739.902] -- 0:01:01
      116000 -- [-2738.494] (-2737.779) (-2739.110) (-2740.204) * (-2748.958) (-2737.381) (-2740.209) [-2742.577] -- 0:01:00
      116500 -- [-2738.924] (-2737.310) (-2738.069) (-2739.255) * (-2742.691) [-2737.968] (-2740.229) (-2739.966) -- 0:01:00
      117000 -- (-2738.427) [-2737.326] (-2743.555) (-2740.297) * [-2748.439] (-2739.999) (-2738.298) (-2739.556) -- 0:01:00
      117500 -- (-2738.427) (-2740.499) [-2741.076] (-2739.897) * (-2750.708) (-2737.620) [-2738.298] (-2739.412) -- 0:01:00
      118000 -- (-2737.063) (-2739.183) [-2740.240] (-2739.244) * (-2746.503) [-2737.287] (-2738.398) (-2740.299) -- 0:00:59
      118500 -- (-2737.554) [-2737.351] (-2739.678) (-2738.400) * (-2749.611) (-2738.076) (-2737.854) [-2739.728] -- 0:00:59
      119000 -- [-2737.418] (-2737.327) (-2737.949) (-2739.570) * (-2750.472) (-2737.204) (-2738.419) [-2736.443] -- 0:00:59
      119500 -- [-2737.482] (-2736.854) (-2738.867) (-2737.934) * (-2751.512) [-2738.106] (-2739.464) (-2736.705) -- 0:00:58
      120000 -- (-2738.377) (-2740.951) (-2738.783) [-2737.192] * (-2744.147) (-2737.646) (-2739.114) [-2736.852] -- 0:00:58

      Average standard deviation of split frequencies: 0.034509

      120500 -- (-2741.224) (-2736.764) [-2741.121] (-2737.811) * [-2746.493] (-2737.662) (-2738.388) (-2736.842) -- 0:00:58
      121000 -- (-2738.964) [-2736.416] (-2747.581) (-2738.187) * (-2743.194) [-2740.845] (-2738.424) (-2737.529) -- 0:00:58
      121500 -- (-2737.517) (-2736.406) (-2741.549) [-2737.416] * (-2754.221) (-2739.698) [-2738.637] (-2737.460) -- 0:00:57
      122000 -- [-2737.418] (-2737.764) (-2739.874) (-2737.842) * (-2753.603) (-2739.947) (-2741.284) [-2737.773] -- 0:00:57
      122500 -- (-2738.530) (-2737.753) [-2737.797] (-2741.510) * (-2748.495) (-2742.286) (-2737.121) [-2736.868] -- 0:00:57
      123000 -- [-2738.647] (-2737.223) (-2736.856) (-2740.386) * (-2751.832) (-2738.506) [-2738.740] (-2737.046) -- 0:00:57
      123500 -- (-2738.678) [-2736.851] (-2736.716) (-2738.411) * (-2751.538) [-2739.116] (-2741.546) (-2737.009) -- 0:00:56
      124000 -- (-2737.906) [-2736.430] (-2736.474) (-2742.172) * [-2745.849] (-2737.236) (-2741.676) (-2741.211) -- 0:00:56
      124500 -- [-2737.032] (-2737.219) (-2736.133) (-2739.474) * (-2737.641) (-2737.390) (-2741.800) [-2740.981] -- 0:01:03
      125000 -- [-2737.137] (-2740.246) (-2738.755) (-2740.130) * (-2737.863) [-2737.549] (-2743.101) (-2747.364) -- 0:01:03

      Average standard deviation of split frequencies: 0.033278

      125500 -- (-2738.914) (-2737.593) (-2738.115) [-2737.621] * [-2738.428] (-2738.413) (-2740.842) (-2742.284) -- 0:01:02
      126000 -- (-2738.100) (-2736.623) [-2737.072] (-2737.768) * (-2739.316) (-2738.892) (-2740.002) [-2739.522] -- 0:01:02
      126500 -- [-2739.783] (-2737.036) (-2738.340) (-2736.928) * (-2738.173) (-2739.190) (-2739.832) [-2742.641] -- 0:01:02
      127000 -- (-2737.189) [-2737.125] (-2738.982) (-2736.662) * (-2738.305) (-2739.871) [-2740.069] (-2739.794) -- 0:01:01
      127500 -- (-2737.445) (-2738.080) (-2737.750) [-2737.789] * (-2738.111) (-2741.014) [-2736.754] (-2740.765) -- 0:01:01
      128000 -- (-2737.558) (-2737.481) [-2736.173] (-2738.020) * (-2737.558) (-2737.632) [-2737.912] (-2740.178) -- 0:01:01
      128500 -- [-2737.087] (-2737.419) (-2737.097) (-2737.347) * (-2741.705) (-2736.939) [-2738.524] (-2741.580) -- 0:01:01
      129000 -- (-2737.025) (-2738.018) (-2737.463) [-2737.512] * (-2741.396) [-2737.174] (-2737.552) (-2745.106) -- 0:01:00
      129500 -- (-2738.178) (-2738.370) [-2738.452] (-2738.881) * [-2739.806] (-2737.174) (-2737.202) (-2742.226) -- 0:01:00
      130000 -- [-2738.706] (-2737.040) (-2737.325) (-2739.791) * [-2738.338] (-2737.260) (-2737.579) (-2739.654) -- 0:01:00

      Average standard deviation of split frequencies: 0.032279

      130500 -- (-2738.971) (-2737.712) (-2740.257) [-2737.971] * (-2741.353) (-2736.874) (-2738.350) [-2738.905] -- 0:00:59
      131000 -- (-2739.567) (-2738.029) [-2737.947] (-2738.559) * (-2740.361) [-2736.958] (-2740.400) (-2738.959) -- 0:00:59
      131500 -- (-2738.915) [-2738.695] (-2739.749) (-2738.122) * (-2738.985) [-2736.890] (-2738.025) (-2741.711) -- 0:00:59
      132000 -- (-2739.171) (-2738.490) [-2738.120] (-2737.605) * (-2738.946) [-2738.813] (-2737.930) (-2739.347) -- 0:00:59
      132500 -- (-2740.838) [-2738.623] (-2739.929) (-2737.584) * (-2738.352) [-2737.694] (-2738.268) (-2738.963) -- 0:00:58
      133000 -- (-2740.199) [-2738.721] (-2740.790) (-2737.605) * [-2737.318] (-2737.351) (-2738.971) (-2738.128) -- 0:00:58
      133500 -- [-2740.064] (-2738.531) (-2738.406) (-2738.461) * (-2738.517) (-2736.810) (-2738.456) [-2738.153] -- 0:00:58
      134000 -- (-2739.919) (-2738.056) [-2738.406] (-2737.662) * [-2737.128] (-2736.860) (-2739.578) (-2739.030) -- 0:00:58
      134500 -- (-2739.635) [-2738.410] (-2736.691) (-2738.975) * (-2737.684) [-2736.860] (-2741.775) (-2741.512) -- 0:00:57
      135000 -- (-2741.040) (-2738.763) [-2736.937] (-2738.980) * (-2737.704) (-2737.088) (-2740.168) [-2740.970] -- 0:00:57

      Average standard deviation of split frequencies: 0.031388

      135500 -- (-2739.024) (-2738.367) (-2736.920) [-2738.622] * [-2737.614] (-2737.065) (-2738.762) (-2741.022) -- 0:00:57
      136000 -- (-2739.221) (-2740.305) (-2736.991) [-2738.597] * [-2738.247] (-2739.200) (-2738.539) (-2738.821) -- 0:00:57
      136500 -- (-2739.476) (-2737.917) [-2737.003] (-2739.178) * (-2739.097) (-2738.688) (-2738.079) [-2737.226] -- 0:00:56
      137000 -- [-2740.931] (-2737.718) (-2738.613) (-2738.862) * (-2738.571) (-2739.216) (-2737.759) [-2737.265] -- 0:00:56
      137500 -- (-2738.261) (-2737.019) [-2737.305] (-2738.135) * (-2737.245) (-2738.695) (-2740.472) [-2738.065] -- 0:01:02
      138000 -- [-2739.227] (-2737.523) (-2737.912) (-2737.717) * (-2738.496) (-2740.391) [-2739.872] (-2737.191) -- 0:01:02
      138500 -- (-2737.667) (-2737.474) (-2737.860) [-2738.780] * [-2737.318] (-2739.888) (-2739.280) (-2740.100) -- 0:01:02
      139000 -- (-2739.688) (-2737.835) [-2738.712] (-2736.316) * (-2737.175) (-2738.371) [-2738.408] (-2741.674) -- 0:01:01
      139500 -- (-2742.004) [-2738.425] (-2742.528) (-2736.281) * (-2737.175) [-2739.359] (-2739.465) (-2740.047) -- 0:01:01
      140000 -- (-2738.739) (-2739.186) [-2740.484] (-2738.126) * (-2737.175) (-2740.839) [-2741.159] (-2739.823) -- 0:01:01

      Average standard deviation of split frequencies: 0.028672

      140500 -- [-2738.737] (-2737.715) (-2737.730) (-2736.493) * (-2737.238) [-2742.053] (-2736.629) (-2741.028) -- 0:01:01
      141000 -- (-2738.533) (-2737.516) [-2737.730] (-2736.503) * (-2738.198) (-2740.496) (-2740.121) [-2741.045] -- 0:01:00
      141500 -- (-2743.000) [-2740.033] (-2742.744) (-2736.595) * (-2741.055) (-2738.849) (-2739.299) [-2737.215] -- 0:01:00
      142000 -- (-2743.632) (-2737.952) (-2741.816) [-2737.295] * (-2738.971) [-2738.814] (-2737.216) (-2737.266) -- 0:01:00
      142500 -- (-2741.452) [-2737.675] (-2738.570) (-2738.423) * (-2743.212) [-2739.016] (-2737.330) (-2737.190) -- 0:01:00
      143000 -- (-2739.794) (-2738.872) (-2739.408) [-2738.214] * (-2742.287) (-2739.258) (-2737.120) [-2736.415] -- 0:00:59
      143500 -- [-2739.688] (-2737.503) (-2739.791) (-2743.073) * [-2737.937] (-2738.598) (-2738.902) (-2736.438) -- 0:00:59
      144000 -- [-2737.811] (-2738.175) (-2736.985) (-2736.715) * [-2737.399] (-2738.928) (-2739.155) (-2736.461) -- 0:00:59
      144500 -- [-2737.339] (-2738.175) (-2741.872) (-2740.993) * (-2738.790) [-2738.739] (-2736.668) (-2736.790) -- 0:00:59
      145000 -- (-2738.479) (-2737.617) [-2737.547] (-2738.635) * (-2738.672) (-2737.786) (-2738.301) [-2738.630] -- 0:00:58

      Average standard deviation of split frequencies: 0.024055

      145500 -- (-2739.851) (-2737.619) (-2738.387) [-2737.735] * [-2739.723] (-2736.649) (-2738.771) (-2740.643) -- 0:00:58
      146000 -- [-2740.114] (-2737.615) (-2737.051) (-2739.378) * (-2740.369) (-2736.417) (-2737.419) [-2737.096] -- 0:00:58
      146500 -- [-2739.178] (-2737.660) (-2737.768) (-2739.569) * (-2745.251) (-2736.560) [-2739.415] (-2738.331) -- 0:00:58
      147000 -- (-2737.677) (-2739.724) (-2738.093) [-2740.819] * (-2748.832) (-2738.385) (-2739.787) [-2738.672] -- 0:00:58
      147500 -- (-2739.665) [-2739.332] (-2738.316) (-2740.408) * (-2745.879) [-2740.912] (-2739.025) (-2738.608) -- 0:00:57
      148000 -- [-2741.161] (-2738.961) (-2738.457) (-2739.558) * (-2747.023) [-2741.133] (-2738.392) (-2738.609) -- 0:00:57
      148500 -- [-2736.929] (-2738.964) (-2738.473) (-2736.535) * (-2745.784) (-2739.290) (-2738.346) [-2737.850] -- 0:00:57
      149000 -- (-2737.603) (-2738.024) (-2738.473) [-2738.576] * (-2745.470) (-2738.471) (-2741.843) [-2739.336] -- 0:00:57
      149500 -- [-2742.130] (-2737.912) (-2741.630) (-2737.381) * (-2745.222) (-2743.255) (-2739.011) [-2739.641] -- 0:00:56
      150000 -- (-2743.217) (-2737.642) (-2741.077) [-2738.239] * [-2744.485] (-2738.857) (-2739.342) (-2738.233) -- 0:00:56

      Average standard deviation of split frequencies: 0.022214

      150500 -- (-2741.430) [-2741.184] (-2737.183) (-2738.268) * (-2742.217) (-2738.724) (-2738.891) [-2738.720] -- 0:00:56
      151000 -- (-2748.843) (-2742.224) [-2737.390] (-2739.683) * (-2744.995) (-2737.479) [-2738.518] (-2738.782) -- 0:00:56
      151500 -- (-2741.569) (-2742.043) [-2738.080] (-2741.208) * (-2743.126) (-2737.923) (-2740.358) [-2739.694] -- 0:01:01
      152000 -- (-2740.037) (-2741.644) [-2738.174] (-2739.464) * [-2740.660] (-2740.260) (-2739.635) (-2739.958) -- 0:01:01
      152500 -- (-2739.495) (-2741.384) [-2741.171] (-2737.376) * (-2738.360) [-2736.404] (-2739.514) (-2739.368) -- 0:01:01
      153000 -- (-2739.694) (-2742.034) [-2741.855] (-2738.692) * (-2738.300) [-2736.522] (-2741.066) (-2737.115) -- 0:01:00
      153500 -- (-2738.867) [-2740.079] (-2738.749) (-2739.126) * [-2738.870] (-2741.006) (-2738.852) (-2737.956) -- 0:01:00
      154000 -- (-2737.449) (-2738.711) [-2740.762] (-2737.666) * (-2739.057) (-2739.735) [-2743.357] (-2737.225) -- 0:01:00
      154500 -- (-2737.447) (-2738.764) (-2739.501) [-2740.138] * [-2738.904] (-2738.858) (-2743.005) (-2736.681) -- 0:01:00
      155000 -- (-2740.309) (-2741.910) (-2738.232) [-2738.603] * (-2738.904) [-2739.909] (-2736.728) (-2738.581) -- 0:00:59

      Average standard deviation of split frequencies: 0.021757

      155500 -- (-2740.310) (-2737.696) (-2737.641) [-2737.491] * [-2739.056] (-2739.696) (-2737.588) (-2742.048) -- 0:00:59
      156000 -- (-2737.288) (-2737.553) (-2737.539) [-2740.776] * (-2740.416) (-2742.135) [-2736.547] (-2736.734) -- 0:00:59
      156500 -- (-2737.368) (-2738.380) [-2740.399] (-2740.786) * (-2737.610) (-2743.744) [-2737.294] (-2736.549) -- 0:00:59
      157000 -- (-2744.996) [-2739.371] (-2741.941) (-2740.713) * (-2737.610) (-2738.946) [-2737.224] (-2736.452) -- 0:00:59
      157500 -- (-2746.136) (-2739.532) [-2738.855] (-2741.318) * [-2741.797] (-2741.489) (-2738.250) (-2737.021) -- 0:00:58
      158000 -- (-2744.213) (-2739.353) [-2739.513] (-2738.526) * (-2739.782) (-2740.458) [-2740.112] (-2739.626) -- 0:00:58
      158500 -- (-2742.726) (-2738.236) (-2738.776) [-2738.654] * (-2743.408) (-2740.436) [-2736.892] (-2738.655) -- 0:00:58
      159000 -- (-2742.267) [-2737.891] (-2738.371) (-2741.961) * (-2743.230) [-2739.607] (-2737.091) (-2738.355) -- 0:00:58
      159500 -- (-2739.509) (-2738.209) (-2738.655) [-2739.031] * (-2741.588) (-2739.187) [-2736.345] (-2736.922) -- 0:00:57
      160000 -- (-2737.651) (-2738.051) (-2738.309) [-2738.970] * (-2741.762) [-2738.528] (-2736.354) (-2739.408) -- 0:00:57

      Average standard deviation of split frequencies: 0.019303

      160500 -- (-2737.825) (-2739.252) [-2738.460] (-2740.851) * [-2740.504] (-2737.457) (-2744.822) (-2739.528) -- 0:00:57
      161000 -- [-2737.825] (-2738.823) (-2738.065) (-2737.159) * [-2741.851] (-2737.566) (-2741.132) (-2739.050) -- 0:00:57
      161500 -- (-2737.662) [-2737.505] (-2738.694) (-2736.524) * (-2740.365) [-2737.091] (-2740.023) (-2740.392) -- 0:00:57
      162000 -- (-2738.746) (-2737.284) (-2738.591) [-2736.478] * [-2739.969] (-2738.267) (-2741.012) (-2739.283) -- 0:00:56
      162500 -- [-2736.832] (-2737.885) (-2737.204) (-2736.233) * (-2742.243) [-2740.174] (-2741.588) (-2738.678) -- 0:00:56
      163000 -- (-2736.832) (-2736.651) [-2738.190] (-2736.666) * (-2741.192) (-2737.856) [-2737.746] (-2738.652) -- 0:00:56
      163500 -- (-2737.829) (-2736.872) (-2737.462) [-2737.131] * (-2739.912) (-2738.228) [-2737.828] (-2738.738) -- 0:00:56
      164000 -- (-2737.645) (-2737.140) [-2736.958] (-2740.500) * (-2738.393) (-2738.328) [-2737.783] (-2738.809) -- 0:00:56
      164500 -- (-2737.422) (-2739.812) (-2737.064) [-2740.696] * (-2744.145) (-2738.318) (-2740.820) [-2738.654] -- 0:00:55
      165000 -- (-2736.947) (-2738.645) (-2738.121) [-2741.969] * (-2745.189) (-2738.831) (-2738.902) [-2736.986] -- 0:00:55

      Average standard deviation of split frequencies: 0.018982

      165500 -- (-2738.220) (-2739.938) (-2740.397) [-2739.580] * (-2745.685) (-2736.817) (-2739.698) [-2737.487] -- 0:01:00
      166000 -- (-2738.393) (-2739.333) (-2740.095) [-2737.939] * [-2740.225] (-2737.995) (-2740.728) (-2737.536) -- 0:01:00
      166500 -- (-2739.012) [-2738.831] (-2741.014) (-2738.323) * [-2739.666] (-2736.549) (-2746.093) (-2737.770) -- 0:01:00
      167000 -- (-2739.047) [-2740.665] (-2740.169) (-2738.707) * (-2739.399) [-2740.540] (-2742.566) (-2737.112) -- 0:00:59
      167500 -- [-2739.847] (-2741.236) (-2741.411) (-2740.450) * (-2739.749) [-2741.029] (-2740.270) (-2737.314) -- 0:00:59
      168000 -- (-2738.279) [-2740.969] (-2736.919) (-2737.494) * (-2741.388) (-2737.271) [-2740.430] (-2740.402) -- 0:00:59
      168500 -- [-2739.611] (-2737.798) (-2737.660) (-2739.816) * [-2746.444] (-2736.748) (-2737.716) (-2740.836) -- 0:00:59
      169000 -- (-2738.735) [-2736.807] (-2740.936) (-2737.509) * (-2744.393) (-2738.301) [-2736.938] (-2739.578) -- 0:00:59
      169500 -- (-2738.847) [-2740.178] (-2743.338) (-2737.519) * [-2738.045] (-2738.705) (-2736.297) (-2738.630) -- 0:00:58
      170000 -- (-2739.552) (-2737.088) [-2737.105] (-2738.847) * (-2741.185) (-2737.855) (-2736.297) [-2738.181] -- 0:00:58

      Average standard deviation of split frequencies: 0.018027

      170500 -- (-2741.552) (-2737.547) (-2738.216) [-2736.998] * [-2738.240] (-2740.523) (-2736.292) (-2738.110) -- 0:00:58
      171000 -- (-2742.654) [-2737.924] (-2736.583) (-2736.981) * (-2738.310) (-2740.089) (-2736.283) [-2738.504] -- 0:00:58
      171500 -- (-2742.891) (-2737.828) [-2736.392] (-2738.423) * (-2736.981) (-2744.381) [-2737.548] (-2737.586) -- 0:00:57
      172000 -- (-2737.999) [-2737.146] (-2737.639) (-2740.056) * (-2737.616) (-2739.852) [-2737.327] (-2737.380) -- 0:00:57
      172500 -- [-2737.281] (-2737.047) (-2739.394) (-2742.608) * (-2743.046) (-2737.860) [-2737.350] (-2738.152) -- 0:00:57
      173000 -- [-2736.521] (-2742.865) (-2737.103) (-2739.334) * (-2743.903) (-2738.104) [-2737.392] (-2737.096) -- 0:00:57
      173500 -- (-2736.318) (-2744.056) (-2740.407) [-2739.127] * (-2742.308) [-2737.573] (-2738.266) (-2737.168) -- 0:00:57
      174000 -- (-2736.448) (-2742.299) (-2737.221) [-2737.290] * (-2739.226) [-2737.888] (-2739.143) (-2738.216) -- 0:00:56
      174500 -- (-2737.534) (-2739.061) [-2736.821] (-2742.350) * (-2739.180) [-2739.493] (-2739.258) (-2738.109) -- 0:00:56
      175000 -- [-2737.698] (-2739.690) (-2736.768) (-2739.110) * [-2739.217] (-2739.375) (-2739.238) (-2738.171) -- 0:00:56

      Average standard deviation of split frequencies: 0.018481

      175500 -- (-2740.362) [-2737.470] (-2736.083) (-2739.151) * (-2739.217) [-2741.148] (-2739.925) (-2737.387) -- 0:00:56
      176000 -- [-2740.338] (-2743.496) (-2738.477) (-2737.698) * [-2739.008] (-2739.819) (-2736.454) (-2737.553) -- 0:00:56
      176500 -- (-2742.587) (-2740.621) [-2737.367] (-2738.761) * [-2736.780] (-2738.754) (-2737.058) (-2736.348) -- 0:00:55
      177000 -- [-2737.884] (-2737.725) (-2739.297) (-2739.173) * (-2737.525) (-2736.467) [-2736.731] (-2739.071) -- 0:00:55
      177500 -- (-2740.457) (-2740.199) (-2737.811) [-2739.166] * (-2738.421) (-2737.353) (-2738.910) [-2738.045] -- 0:00:55
      178000 -- (-2741.549) (-2739.454) [-2739.201] (-2739.151) * (-2738.417) (-2736.881) [-2737.071] (-2737.196) -- 0:00:55
      178500 -- (-2741.167) [-2738.728] (-2737.570) (-2742.432) * (-2738.072) [-2736.875] (-2737.741) (-2740.781) -- 0:00:55
      179000 -- (-2740.187) (-2742.339) (-2736.902) [-2737.249] * (-2737.946) (-2736.786) [-2738.060] (-2740.023) -- 0:00:55
      179500 -- [-2739.404] (-2738.777) (-2737.577) (-2740.731) * [-2738.300] (-2737.270) (-2739.992) (-2741.500) -- 0:00:54
      180000 -- (-2738.132) (-2738.554) (-2737.363) [-2739.879] * (-2746.239) [-2738.642] (-2738.126) (-2737.845) -- 0:00:54

      Average standard deviation of split frequencies: 0.018917

      180500 -- (-2738.111) (-2737.764) [-2738.524] (-2741.714) * (-2737.105) [-2738.959] (-2736.800) (-2741.069) -- 0:00:59
      181000 -- (-2737.797) (-2738.347) [-2736.528] (-2739.977) * (-2736.986) (-2739.660) [-2736.803] (-2737.661) -- 0:00:58
      181500 -- (-2738.267) [-2738.673] (-2736.300) (-2742.294) * (-2737.617) (-2737.322) (-2740.473) [-2736.575] -- 0:00:58
      182000 -- (-2741.314) (-2738.318) [-2736.307] (-2738.893) * [-2737.092] (-2737.380) (-2740.482) (-2736.735) -- 0:00:58
      182500 -- [-2737.596] (-2737.812) (-2736.835) (-2745.195) * (-2740.172) (-2737.733) (-2740.482) [-2736.875] -- 0:00:58
      183000 -- (-2737.631) [-2740.315] (-2740.248) (-2738.096) * [-2739.843] (-2737.544) (-2739.572) (-2741.369) -- 0:00:58
      183500 -- (-2747.406) (-2740.824) (-2743.069) [-2739.945] * [-2737.583] (-2737.590) (-2739.432) (-2739.553) -- 0:00:57
      184000 -- [-2740.303] (-2741.340) (-2740.419) (-2739.846) * (-2738.205) (-2738.061) (-2739.038) [-2738.804] -- 0:00:57
      184500 -- (-2738.265) (-2739.680) (-2743.555) [-2738.210] * (-2739.152) [-2737.230] (-2739.979) (-2741.200) -- 0:00:57
      185000 -- [-2742.702] (-2738.282) (-2739.923) (-2740.205) * [-2739.138] (-2738.180) (-2739.116) (-2739.207) -- 0:00:57

      Average standard deviation of split frequencies: 0.018248

      185500 -- (-2741.671) [-2737.359] (-2743.958) (-2738.405) * (-2742.096) (-2737.490) [-2737.613] (-2738.688) -- 0:00:57
      186000 -- (-2740.297) (-2738.286) (-2741.464) [-2737.168] * (-2738.359) [-2739.777] (-2738.328) (-2738.688) -- 0:00:56
      186500 -- (-2740.205) (-2737.658) (-2740.633) [-2737.434] * (-2738.916) (-2737.576) [-2737.822] (-2738.687) -- 0:00:56
      187000 -- (-2740.769) (-2737.811) [-2738.449] (-2737.032) * (-2742.773) [-2736.464] (-2741.237) (-2737.913) -- 0:00:56
      187500 -- (-2743.801) (-2739.374) (-2736.721) [-2739.788] * (-2738.332) (-2737.172) [-2738.472] (-2740.628) -- 0:00:56
      188000 -- (-2739.343) (-2738.351) (-2738.870) [-2739.845] * (-2741.251) (-2737.240) [-2737.641] (-2737.961) -- 0:00:56
      188500 -- [-2738.000] (-2737.541) (-2736.562) (-2737.853) * (-2740.502) [-2737.789] (-2737.641) (-2738.481) -- 0:00:55
      189000 -- (-2736.964) (-2737.541) [-2739.159] (-2738.613) * (-2739.139) (-2736.942) [-2738.448] (-2739.376) -- 0:00:55
      189500 -- (-2739.859) (-2737.031) (-2739.288) [-2737.319] * (-2738.095) [-2738.395] (-2738.500) (-2741.530) -- 0:00:55
      190000 -- [-2737.518] (-2738.301) (-2736.993) (-2737.761) * (-2738.676) [-2739.175] (-2737.582) (-2742.485) -- 0:00:55

      Average standard deviation of split frequencies: 0.018543

      190500 -- [-2737.647] (-2737.720) (-2736.509) (-2742.762) * (-2736.344) [-2737.205] (-2738.354) (-2737.933) -- 0:00:55
      191000 -- [-2740.954] (-2738.576) (-2736.525) (-2737.575) * (-2738.182) [-2737.087] (-2738.066) (-2737.887) -- 0:00:55
      191500 -- [-2737.363] (-2738.661) (-2737.145) (-2739.588) * (-2737.073) [-2737.485] (-2737.191) (-2739.254) -- 0:00:54
      192000 -- (-2738.490) (-2737.200) [-2737.217] (-2743.675) * (-2737.073) [-2738.623] (-2739.824) (-2739.533) -- 0:00:54
      192500 -- [-2737.776] (-2737.200) (-2740.749) (-2737.731) * (-2738.328) (-2738.224) [-2741.405] (-2738.413) -- 0:00:54
      193000 -- (-2740.024) [-2739.149] (-2740.573) (-2739.664) * (-2740.110) (-2741.108) [-2739.469] (-2737.532) -- 0:00:54
      193500 -- (-2740.612) (-2737.081) (-2738.131) [-2742.686] * (-2737.034) [-2741.101] (-2738.553) (-2740.593) -- 0:00:54
      194000 -- (-2741.283) (-2736.865) [-2737.743] (-2744.108) * (-2742.641) [-2738.671] (-2738.878) (-2738.886) -- 0:00:54
      194500 -- [-2738.958] (-2737.306) (-2737.599) (-2741.553) * [-2737.792] (-2738.177) (-2736.350) (-2739.596) -- 0:00:53
      195000 -- (-2737.517) (-2737.712) (-2738.955) [-2739.182] * (-2737.754) (-2738.475) (-2737.774) [-2738.853] -- 0:00:57

      Average standard deviation of split frequencies: 0.017504

      195500 -- [-2737.238] (-2738.773) (-2738.841) (-2737.977) * (-2737.823) (-2738.453) (-2738.621) [-2737.572] -- 0:00:57
      196000 -- (-2737.282) (-2738.801) (-2739.950) [-2737.729] * (-2736.919) (-2738.696) [-2739.017] (-2737.911) -- 0:00:57
      196500 -- (-2737.902) (-2736.663) (-2738.727) [-2737.075] * [-2736.858] (-2739.640) (-2738.840) (-2737.786) -- 0:00:57
      197000 -- (-2738.100) (-2737.496) (-2737.665) [-2737.046] * [-2736.865] (-2739.488) (-2739.934) (-2739.780) -- 0:00:57
      197500 -- (-2736.920) [-2736.667] (-2737.539) (-2740.606) * [-2737.025] (-2738.409) (-2740.252) (-2739.003) -- 0:00:56
      198000 -- (-2737.082) (-2737.126) (-2740.497) [-2738.574] * [-2737.155] (-2738.947) (-2740.454) (-2739.530) -- 0:00:56
      198500 -- (-2736.629) (-2737.509) [-2737.057] (-2740.715) * (-2738.133) [-2739.569] (-2740.543) (-2742.640) -- 0:00:56
      199000 -- [-2738.867] (-2738.482) (-2736.715) (-2736.541) * [-2736.828] (-2741.211) (-2739.066) (-2741.498) -- 0:00:56
      199500 -- (-2738.867) [-2738.310] (-2737.462) (-2738.855) * (-2739.730) (-2740.485) [-2738.955] (-2741.449) -- 0:00:56
      200000 -- (-2740.515) [-2739.856] (-2738.962) (-2738.269) * [-2739.024] (-2740.746) (-2737.096) (-2740.160) -- 0:00:55

      Average standard deviation of split frequencies: 0.018533

      200500 -- [-2737.779] (-2738.764) (-2741.862) (-2738.154) * (-2740.109) (-2740.687) [-2736.652] (-2741.242) -- 0:00:55
      201000 -- (-2737.100) (-2738.329) (-2740.623) [-2738.553] * [-2740.957] (-2740.223) (-2736.624) (-2738.146) -- 0:00:55
      201500 -- (-2738.247) (-2738.491) [-2741.142] (-2738.813) * (-2739.667) (-2745.999) [-2737.206] (-2738.679) -- 0:00:55
      202000 -- (-2738.240) (-2741.541) (-2742.880) [-2737.688] * (-2743.797) (-2742.634) (-2737.336) [-2739.172] -- 0:00:55
      202500 -- (-2738.238) (-2741.923) [-2739.699] (-2737.453) * (-2743.345) (-2738.469) [-2737.767] (-2741.871) -- 0:00:55
      203000 -- (-2740.800) [-2738.390] (-2736.642) (-2740.714) * (-2743.437) [-2738.787] (-2738.839) (-2748.888) -- 0:00:54
      203500 -- (-2739.709) (-2738.649) [-2737.489] (-2741.363) * (-2740.342) (-2737.145) (-2740.687) [-2742.751] -- 0:00:54
      204000 -- (-2739.894) (-2739.433) (-2736.686) [-2745.108] * (-2738.608) (-2739.970) [-2739.043] (-2743.661) -- 0:00:54
      204500 -- (-2740.003) (-2740.935) [-2739.725] (-2739.091) * (-2739.167) [-2740.110] (-2739.255) (-2739.474) -- 0:00:54
      205000 -- [-2739.073] (-2742.601) (-2743.160) (-2739.017) * (-2738.899) (-2740.360) [-2738.188] (-2741.864) -- 0:00:54

      Average standard deviation of split frequencies: 0.019030

      205500 -- (-2739.521) (-2742.185) (-2740.833) [-2739.754] * (-2739.940) (-2739.745) (-2738.497) [-2739.867] -- 0:00:54
      206000 -- (-2739.131) [-2736.642] (-2738.692) (-2740.881) * [-2740.113] (-2737.017) (-2740.695) (-2739.050) -- 0:00:53
      206500 -- (-2739.543) (-2737.022) [-2739.230] (-2738.550) * [-2738.557] (-2737.208) (-2740.918) (-2738.667) -- 0:00:53
      207000 -- (-2737.661) [-2737.106] (-2739.577) (-2737.530) * (-2737.655) [-2738.179] (-2738.696) (-2738.596) -- 0:00:53
      207500 -- (-2737.392) [-2736.352] (-2738.297) (-2737.532) * [-2737.570] (-2737.338) (-2739.648) (-2738.545) -- 0:00:53
      208000 -- (-2737.768) (-2739.549) [-2740.164] (-2736.419) * [-2737.827] (-2738.273) (-2739.331) (-2737.832) -- 0:00:53
      208500 -- [-2738.808] (-2738.974) (-2740.294) (-2736.243) * (-2739.749) [-2738.355] (-2738.436) (-2737.559) -- 0:00:53
      209000 -- [-2740.347] (-2738.615) (-2742.377) (-2736.242) * [-2741.829] (-2738.330) (-2739.811) (-2742.429) -- 0:00:52
      209500 -- (-2742.660) [-2738.900] (-2742.210) (-2736.243) * [-2740.720] (-2736.960) (-2738.330) (-2745.377) -- 0:00:56
      210000 -- (-2739.128) (-2742.323) (-2741.675) [-2738.716] * [-2737.589] (-2736.862) (-2740.442) (-2746.651) -- 0:00:56

      Average standard deviation of split frequencies: 0.019550

      210500 -- (-2741.889) [-2742.891] (-2739.158) (-2742.547) * (-2738.577) [-2736.931] (-2740.446) (-2739.250) -- 0:00:56
      211000 -- (-2741.296) (-2740.726) (-2742.868) [-2736.269] * (-2738.574) [-2736.932] (-2739.822) (-2740.544) -- 0:00:56
      211500 -- (-2739.788) [-2738.353] (-2741.744) (-2738.001) * (-2741.010) (-2737.845) [-2737.009] (-2740.235) -- 0:00:55
      212000 -- (-2742.386) (-2738.953) [-2738.075] (-2738.257) * [-2740.695] (-2736.457) (-2737.099) (-2742.012) -- 0:00:55
      212500 -- (-2739.275) [-2739.729] (-2737.961) (-2737.175) * (-2739.284) (-2736.587) [-2737.338] (-2741.421) -- 0:00:55
      213000 -- (-2737.812) (-2738.856) [-2738.669] (-2740.177) * (-2738.604) [-2740.223] (-2736.919) (-2739.258) -- 0:00:55
      213500 -- [-2738.681] (-2738.602) (-2739.894) (-2738.563) * (-2738.515) [-2738.195] (-2737.917) (-2741.680) -- 0:00:55
      214000 -- (-2739.416) (-2738.279) (-2739.894) [-2738.520] * (-2738.681) (-2739.191) (-2738.756) [-2740.813] -- 0:00:55
      214500 -- [-2738.848] (-2738.094) (-2740.132) (-2736.670) * (-2738.613) (-2739.579) (-2745.629) [-2738.555] -- 0:00:54
      215000 -- (-2737.238) (-2739.782) (-2739.094) [-2736.670] * (-2740.362) (-2738.915) [-2739.967] (-2738.299) -- 0:00:54

      Average standard deviation of split frequencies: 0.020369

      215500 -- (-2737.746) (-2739.076) (-2739.678) [-2736.522] * (-2740.576) (-2742.835) (-2740.419) [-2737.539] -- 0:00:54
      216000 -- (-2737.629) (-2740.908) [-2739.865] (-2737.268) * (-2740.775) (-2738.696) [-2738.726] (-2737.120) -- 0:00:54
      216500 -- (-2737.572) (-2743.826) (-2740.205) [-2740.829] * (-2740.393) [-2738.559] (-2740.628) (-2738.857) -- 0:00:54
      217000 -- (-2739.737) [-2741.365] (-2740.141) (-2738.245) * (-2741.062) (-2738.593) (-2740.786) [-2739.942] -- 0:00:54
      217500 -- (-2739.354) (-2740.890) [-2737.968] (-2738.368) * (-2741.896) [-2738.493] (-2738.663) (-2743.777) -- 0:00:53
      218000 -- (-2739.303) (-2737.963) [-2737.006] (-2738.374) * (-2740.636) [-2738.491] (-2737.607) (-2737.652) -- 0:00:53
      218500 -- (-2739.498) (-2740.650) (-2736.990) [-2736.705] * (-2741.028) [-2738.538] (-2737.652) (-2737.243) -- 0:00:53
      219000 -- (-2739.223) (-2739.724) [-2737.515] (-2736.705) * (-2738.935) [-2737.302] (-2737.256) (-2738.930) -- 0:00:53
      219500 -- (-2739.258) (-2742.939) (-2738.041) [-2736.954] * (-2739.252) (-2737.918) (-2737.663) [-2736.904] -- 0:00:53
      220000 -- (-2737.355) (-2740.671) (-2739.617) [-2738.279] * (-2742.144) (-2736.965) (-2739.631) [-2736.626] -- 0:00:53

      Average standard deviation of split frequencies: 0.018989

      220500 -- (-2737.574) (-2741.629) [-2741.972] (-2737.857) * (-2739.829) (-2736.980) [-2738.662] (-2738.727) -- 0:00:53
      221000 -- (-2737.263) (-2742.286) (-2744.955) [-2738.056] * (-2738.215) (-2737.046) (-2739.146) [-2739.219] -- 0:00:52
      221500 -- (-2737.066) [-2738.385] (-2740.398) (-2738.063) * [-2739.569] (-2736.926) (-2740.501) (-2740.477) -- 0:00:52
      222000 -- (-2737.223) (-2740.826) [-2736.810] (-2740.359) * [-2740.573] (-2737.408) (-2740.126) (-2739.443) -- 0:00:52
      222500 -- [-2737.198] (-2740.149) (-2736.786) (-2738.159) * (-2740.341) [-2737.408] (-2743.349) (-2738.843) -- 0:00:52
      223000 -- (-2737.199) (-2741.085) (-2736.544) [-2737.879] * (-2741.964) (-2738.342) [-2743.539] (-2740.561) -- 0:00:52
      223500 -- (-2737.378) [-2741.890] (-2741.857) (-2737.919) * (-2742.179) (-2737.516) [-2740.513] (-2739.568) -- 0:00:52
      224000 -- (-2737.707) (-2738.611) [-2736.465] (-2738.786) * (-2743.062) (-2737.505) (-2744.131) [-2740.170] -- 0:00:55
      224500 -- [-2737.707] (-2738.598) (-2736.549) (-2738.283) * (-2744.681) [-2737.406] (-2742.735) (-2739.834) -- 0:00:55
      225000 -- (-2737.337) (-2738.326) [-2738.029] (-2740.339) * (-2741.567) (-2737.705) [-2739.597] (-2739.936) -- 0:00:55

      Average standard deviation of split frequencies: 0.018773

      225500 -- [-2737.995] (-2738.197) (-2736.665) (-2740.397) * (-2743.102) [-2736.536] (-2741.448) (-2740.380) -- 0:00:54
      226000 -- (-2738.022) [-2737.905] (-2738.247) (-2738.886) * (-2742.548) [-2739.310] (-2739.077) (-2739.092) -- 0:00:54
      226500 -- (-2737.963) (-2738.292) (-2739.016) [-2737.756] * (-2745.134) (-2743.712) (-2739.638) [-2740.627] -- 0:00:54
      227000 -- (-2737.872) (-2738.287) (-2740.266) [-2737.652] * (-2742.810) (-2745.988) [-2740.703] (-2740.239) -- 0:00:54
      227500 -- (-2739.384) (-2737.364) [-2738.689] (-2738.112) * (-2744.084) (-2743.715) [-2739.429] (-2738.784) -- 0:00:54
      228000 -- (-2739.379) (-2737.905) [-2739.225] (-2738.889) * (-2739.870) (-2744.069) (-2738.037) [-2736.451] -- 0:00:54
      228500 -- (-2737.598) [-2738.190] (-2738.915) (-2738.515) * (-2738.751) (-2740.374) [-2737.894] (-2736.836) -- 0:00:54
      229000 -- [-2740.533] (-2738.986) (-2736.951) (-2737.614) * (-2738.095) (-2739.434) (-2738.281) [-2739.763] -- 0:00:53
      229500 -- [-2737.434] (-2740.500) (-2741.172) (-2737.574) * [-2737.220] (-2740.625) (-2737.934) (-2736.566) -- 0:00:53
      230000 -- [-2737.680] (-2739.614) (-2741.597) (-2737.573) * [-2736.599] (-2738.548) (-2741.331) (-2736.563) -- 0:00:53

      Average standard deviation of split frequencies: 0.017191

      230500 -- (-2738.117) [-2739.452] (-2742.446) (-2739.216) * (-2736.672) [-2738.265] (-2740.710) (-2736.571) -- 0:00:53
      231000 -- [-2737.860] (-2737.785) (-2738.097) (-2739.216) * (-2738.781) (-2737.660) (-2738.420) [-2736.404] -- 0:00:53
      231500 -- [-2737.170] (-2738.229) (-2737.663) (-2737.854) * (-2739.893) (-2737.605) (-2738.436) [-2736.608] -- 0:00:53
      232000 -- [-2737.553] (-2737.625) (-2737.674) (-2737.851) * [-2738.501] (-2737.634) (-2741.269) (-2736.620) -- 0:00:52
      232500 -- (-2737.562) (-2736.422) (-2738.505) [-2736.657] * (-2739.220) (-2737.632) [-2736.937] (-2736.613) -- 0:00:52
      233000 -- (-2739.683) (-2736.879) (-2741.549) [-2737.017] * [-2739.495] (-2738.015) (-2737.088) (-2737.470) -- 0:00:52
      233500 -- (-2739.655) [-2736.591] (-2743.867) (-2738.936) * (-2736.423) [-2740.166] (-2737.586) (-2738.012) -- 0:00:52
      234000 -- (-2740.310) (-2738.577) [-2740.953] (-2739.193) * (-2737.838) (-2737.638) (-2737.583) [-2737.831] -- 0:00:52
      234500 -- [-2738.513] (-2738.599) (-2738.896) (-2738.160) * (-2738.292) [-2737.839] (-2737.546) (-2737.434) -- 0:00:52
      235000 -- [-2738.385] (-2736.989) (-2738.104) (-2738.764) * (-2739.093) (-2737.670) (-2738.101) [-2736.903] -- 0:00:52

      Average standard deviation of split frequencies: 0.015510

      235500 -- (-2737.145) [-2740.547] (-2740.662) (-2741.133) * (-2740.055) (-2737.864) (-2737.174) [-2740.141] -- 0:00:51
      236000 -- (-2736.884) [-2737.688] (-2738.173) (-2742.596) * [-2737.606] (-2737.384) (-2740.823) (-2739.282) -- 0:00:51
      236500 -- [-2737.052] (-2739.969) (-2737.329) (-2740.121) * (-2737.293) (-2737.272) [-2738.595] (-2738.315) -- 0:00:51
      237000 -- (-2737.067) (-2738.319) [-2737.299] (-2742.127) * (-2742.524) [-2738.312] (-2737.855) (-2739.083) -- 0:00:51
      237500 -- (-2737.507) (-2737.324) (-2738.496) [-2738.683] * [-2738.362] (-2737.840) (-2737.185) (-2738.313) -- 0:00:51
      238000 -- (-2738.459) (-2738.930) (-2737.846) [-2738.430] * (-2741.689) (-2737.840) [-2738.170] (-2738.475) -- 0:00:51
      238500 -- (-2736.761) (-2740.511) (-2737.760) [-2737.580] * (-2739.188) [-2739.556] (-2737.186) (-2742.802) -- 0:00:54
      239000 -- [-2737.532] (-2738.152) (-2736.929) (-2740.088) * (-2738.132) [-2739.644] (-2737.468) (-2739.111) -- 0:00:54
      239500 -- (-2737.532) (-2743.804) [-2736.929] (-2738.443) * (-2743.765) (-2739.732) (-2737.300) [-2737.681] -- 0:00:53
      240000 -- (-2737.311) [-2737.666] (-2737.349) (-2739.814) * (-2738.942) (-2739.032) (-2737.230) [-2740.299] -- 0:00:53

      Average standard deviation of split frequencies: 0.014172

      240500 -- (-2740.322) (-2737.602) [-2738.004] (-2740.818) * (-2738.743) [-2739.668] (-2739.205) (-2742.108) -- 0:00:53
      241000 -- (-2740.393) (-2737.619) [-2738.215] (-2739.183) * (-2738.299) (-2738.785) [-2740.538] (-2742.872) -- 0:00:53
      241500 -- (-2740.393) (-2740.076) (-2742.019) [-2738.296] * [-2737.770] (-2739.299) (-2743.309) (-2745.552) -- 0:00:53
      242000 -- (-2739.524) (-2739.799) (-2741.628) [-2738.785] * (-2740.847) [-2738.621] (-2743.309) (-2741.246) -- 0:00:53
      242500 -- (-2736.560) (-2746.501) (-2737.623) [-2739.453] * (-2742.345) (-2738.289) [-2738.711] (-2740.581) -- 0:00:53
      243000 -- [-2736.949] (-2739.788) (-2740.251) (-2736.481) * (-2740.103) [-2736.747] (-2738.381) (-2737.080) -- 0:00:52
      243500 -- (-2739.612) [-2740.442] (-2739.339) (-2736.758) * (-2737.422) [-2736.954] (-2740.578) (-2742.033) -- 0:00:52
      244000 -- (-2738.480) [-2739.689] (-2739.655) (-2737.007) * [-2738.056] (-2736.895) (-2737.336) (-2740.071) -- 0:00:52
      244500 -- (-2741.272) (-2736.873) (-2740.005) [-2737.134] * (-2737.583) (-2740.690) [-2737.203] (-2738.266) -- 0:00:52
      245000 -- [-2740.203] (-2739.637) (-2738.263) (-2737.790) * (-2742.009) (-2741.448) [-2737.230] (-2738.287) -- 0:00:52

      Average standard deviation of split frequencies: 0.013076

      245500 -- (-2739.975) [-2738.212] (-2740.400) (-2737.791) * (-2742.993) [-2736.757] (-2737.124) (-2739.791) -- 0:00:52
      246000 -- (-2739.008) (-2737.115) (-2740.330) [-2738.085] * [-2739.686] (-2737.989) (-2736.903) (-2739.195) -- 0:00:52
      246500 -- (-2738.576) (-2736.680) (-2737.968) [-2737.909] * (-2738.279) [-2737.767] (-2736.678) (-2739.052) -- 0:00:51
      247000 -- (-2737.948) (-2736.768) (-2742.076) [-2737.865] * (-2740.707) (-2737.813) [-2738.931] (-2739.677) -- 0:00:51
      247500 -- (-2736.764) (-2736.693) (-2739.517) [-2739.735] * (-2738.105) [-2737.242] (-2745.268) (-2742.309) -- 0:00:51
      248000 -- (-2737.594) (-2737.570) (-2741.666) [-2738.486] * [-2738.889] (-2737.273) (-2742.840) (-2740.304) -- 0:00:51
      248500 -- (-2737.721) [-2738.352] (-2742.641) (-2738.089) * (-2740.794) (-2736.931) (-2738.634) [-2737.533] -- 0:00:51
      249000 -- (-2736.756) [-2738.461] (-2738.828) (-2737.399) * (-2738.285) (-2736.900) [-2740.528] (-2737.003) -- 0:00:51
      249500 -- [-2736.858] (-2739.226) (-2741.476) (-2737.933) * (-2738.133) [-2738.189] (-2740.505) (-2736.757) -- 0:00:51
      250000 -- [-2736.857] (-2738.495) (-2741.996) (-2738.443) * (-2740.281) (-2737.974) [-2739.077] (-2739.048) -- 0:00:51

      Average standard deviation of split frequencies: 0.012433

      250500 -- [-2737.516] (-2739.260) (-2738.433) (-2738.109) * (-2738.296) (-2736.870) [-2741.292] (-2736.924) -- 0:00:50
      251000 -- (-2737.209) [-2739.196] (-2740.422) (-2738.314) * (-2739.270) (-2737.400) (-2742.914) [-2736.725] -- 0:00:50
      251500 -- (-2738.049) (-2738.351) [-2737.363] (-2743.105) * [-2738.927] (-2738.128) (-2740.125) (-2736.948) -- 0:00:50
      252000 -- (-2738.069) (-2740.804) [-2740.946] (-2739.214) * (-2738.784) [-2737.751] (-2738.326) (-2740.406) -- 0:00:50
      252500 -- [-2738.922] (-2741.669) (-2742.561) (-2738.017) * (-2738.283) [-2737.860] (-2738.321) (-2737.718) -- 0:00:50
      253000 -- (-2739.036) (-2746.662) [-2743.530] (-2737.581) * [-2738.015] (-2741.668) (-2737.467) (-2737.724) -- 0:00:53
      253500 -- [-2737.976] (-2741.823) (-2741.974) (-2737.522) * (-2738.548) (-2742.154) (-2737.735) [-2738.249] -- 0:00:53
      254000 -- [-2738.050] (-2740.552) (-2739.600) (-2737.978) * (-2738.179) [-2739.659] (-2737.673) (-2740.016) -- 0:00:52
      254500 -- (-2742.244) (-2738.987) [-2738.982] (-2737.582) * [-2737.226] (-2737.389) (-2737.914) (-2738.990) -- 0:00:52
      255000 -- (-2737.130) (-2738.936) [-2741.514] (-2738.402) * (-2738.824) [-2736.736] (-2737.704) (-2738.815) -- 0:00:52