>C1
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C2
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C3
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C4
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C5
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMVAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C6
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=343
C1 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C2 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C3 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C4 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C5 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C6 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
**************************************************
C1 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C2 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C3 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C4 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C5 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C6 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
**************************************************
C1 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C2 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C3 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C4 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C5 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C6 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
**************************************************
C1 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C2 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C3 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C4 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C5 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMVAKIYDLA
C6 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
******************************************.*******
C1 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C2 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C3 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C4 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C5 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C6 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
**************************************************
C1 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C2 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C3 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C4 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C5 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C6 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
**************************************************
C1 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C2 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C3 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C4 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C5 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C6 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
*******************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 343 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 343 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10290]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [10290]--->[10290]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.518 Mb, Max= 30.913 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C2 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C3 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C4 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C5 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C6 MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
**************************************************
C1 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C2 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C3 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C4 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C5 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C6 VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
**************************************************
C1 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C2 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C3 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C4 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C5 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C6 AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
**************************************************
C1 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C2 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C3 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C4 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C5 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMVAKIYDLA
C6 TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
******************************************.*******
C1 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C2 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C3 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C4 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C5 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C6 DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
**************************************************
C1 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C2 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C3 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C4 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C5 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C6 VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
**************************************************
C1 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C2 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C3 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C4 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C5 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C6 DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
*******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 99.71 C1 C5 99.71
TOP 4 0 99.71 C5 C1 99.71
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 99.71 C2 C5 99.71
TOP 4 1 99.71 C5 C2 99.71
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.71 C3 C5 99.71
TOP 4 2 99.71 C5 C3 99.71
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 99.71 C4 C5 99.71
TOP 4 3 99.71 C5 C4 99.71
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 99.71 C5 C6 99.71
TOP 5 4 99.71 C6 C5 99.71
AVG 0 C1 * 99.94
AVG 1 C2 * 99.94
AVG 2 C3 * 99.94
AVG 3 C4 * 99.94
AVG 4 C5 * 99.71
AVG 5 C6 * 99.94
TOT TOT * 99.90
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
C2 ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
C3 ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
C4 ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
C5 ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
C6 ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
**************************************************
C1 TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
C2 TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
C3 TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
C4 TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
C5 TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
C6 TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
**************************************************
C1 TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
C2 TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
C3 TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
C4 TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
C5 TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
C6 TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
**************************************************
C1 GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
C2 GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
C3 GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
C4 GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
C5 GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
C6 GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
**************************************************
C1 TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
C2 TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
C3 TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
C4 TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
C5 TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
C6 TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
**************************************************
C1 GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
C2 GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
C3 GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
C4 GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
C5 GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
C6 GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
**************************************************
C1 GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
C2 GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
C3 GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
C4 GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
C5 GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
C6 GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
**************************************************
C1 ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
C2 ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
C3 ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
C4 ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
C5 ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
C6 ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
**************************************************
C1 GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
C2 GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
C3 GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
C4 GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
C5 GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
C6 GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
**************************************************
C1 ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
C2 ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
C3 ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
C4 ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
C5 ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
C6 ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
**************************************************
C1 GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
C2 GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
C3 GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
C4 GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
C5 GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
C6 GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
**************************************************
C1 TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
C2 TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
C3 TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
C4 TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
C5 TTCCCGACATGTTCATTCCCAAGATGGTTGCCAAGATCTACGATTTGGCC
C6 TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
*************************** **********************
C1 GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
C2 GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
C3 GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
C4 GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
C5 GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
C6 GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
**************************************************
C1 CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
C2 CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
C3 CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
C4 CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
C5 CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
C6 CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
**************************************************
C1 TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
C2 TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
C3 TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
C4 TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
C5 TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
C6 TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
**************************************************
C1 GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
C2 GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
C3 GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
C4 GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
C5 GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
C6 GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
**************************************************
C1 TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
C2 TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
C3 TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
C4 TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
C5 TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
C6 TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
**************************************************
C1 ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
C2 ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
C3 ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
C4 ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
C5 ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
C6 ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
**************************************************
C1 GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
C2 GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
C3 GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
C4 GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
C5 GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
C6 GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
**************************************************
C1 AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
C2 AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
C3 AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
C4 AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
C5 AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
C6 AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
**************************************************
C1 ACCGGCTGGGCTTTCTTCCGCAACGGGGG
C2 ACCGGCTGGGCTTTCTTCCGCAACGGGGG
C3 ACCGGCTGGGCTTTCTTCCGCAACGGGGG
C4 ACCGGCTGGGCTTTCTTCCGCAACGGGGG
C5 ACCGGCTGGGCTTTCTTCCGCAACGGGGG
C6 ACCGGCTGGGCTTTCTTCCGCAACGGGGG
*****************************
>C1
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C2
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C3
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C4
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C5
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGTTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C6
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C1
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C2
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C3
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C4
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C5
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMVAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C6
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 1029 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790473
Setting output file names to "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 220177891
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0538955121
Seed = 2138082342
Swapseed = 1579790473
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2306.352641 -- -24.965149
Chain 2 -- -2306.353774 -- -24.965149
Chain 3 -- -2306.353774 -- -24.965149
Chain 4 -- -2306.354057 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2306.354190 -- -24.965149
Chain 2 -- -2306.353774 -- -24.965149
Chain 3 -- -2306.354190 -- -24.965149
Chain 4 -- -2306.354190 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2306.353] (-2306.354) (-2306.354) (-2306.354) * [-2306.354] (-2306.354) (-2306.354) (-2306.354)
500 -- (-1433.559) (-1450.745) (-1434.656) [-1426.924] * (-1426.676) (-1442.798) (-1432.250) [-1427.142] -- 0:00:00
1000 -- [-1422.003] (-1430.574) (-1429.788) (-1425.365) * (-1429.896) (-1431.222) (-1430.583) [-1425.767] -- 0:00:00
1500 -- [-1422.467] (-1429.584) (-1425.456) (-1433.326) * (-1427.522) (-1428.743) [-1425.484] (-1427.975) -- 0:00:00
2000 -- [-1425.311] (-1432.626) (-1425.610) (-1434.476) * (-1424.184) (-1426.195) (-1439.794) [-1426.512] -- 0:00:00
2500 -- [-1424.560] (-1426.989) (-1438.656) (-1429.793) * [-1431.296] (-1429.978) (-1428.824) (-1437.922) -- 0:00:00
3000 -- [-1424.076] (-1423.582) (-1422.314) (-1431.105) * [-1431.778] (-1426.240) (-1425.126) (-1429.394) -- 0:00:00
3500 -- (-1434.542) (-1433.484) (-1424.047) [-1427.413] * (-1428.252) [-1426.027] (-1424.836) (-1430.082) -- 0:00:00
4000 -- [-1425.971] (-1423.987) (-1432.469) (-1426.788) * [-1431.277] (-1427.402) (-1429.716) (-1430.185) -- 0:00:00
4500 -- (-1437.907) (-1434.577) (-1430.745) [-1422.349] * (-1423.858) [-1432.328] (-1429.023) (-1426.446) -- 0:00:00
5000 -- (-1423.512) (-1428.872) (-1432.147) [-1424.440] * [-1427.945] (-1432.116) (-1428.952) (-1427.946) -- 0:00:00
Average standard deviation of split frequencies: 0.095647
5500 -- [-1425.107] (-1426.954) (-1426.660) (-1430.416) * [-1429.177] (-1429.476) (-1423.265) (-1426.555) -- 0:00:00
6000 -- (-1427.721) [-1431.541] (-1426.032) (-1426.043) * [-1420.277] (-1429.706) (-1422.530) (-1434.232) -- 0:00:00
6500 -- (-1424.918) (-1428.070) (-1424.959) [-1425.058] * (-1425.432) (-1430.112) (-1437.756) [-1428.907] -- 0:00:00
7000 -- (-1423.517) (-1429.516) (-1438.163) [-1425.445] * (-1425.054) (-1427.592) (-1420.691) [-1422.834] -- 0:00:00
7500 -- (-1430.520) (-1428.667) (-1429.753) [-1425.057] * (-1422.442) [-1428.097] (-1423.363) (-1423.210) -- 0:00:00
8000 -- (-1427.895) (-1431.322) (-1435.033) [-1420.580] * (-1425.028) (-1432.197) [-1421.226] (-1427.873) -- 0:02:04
8500 -- (-1430.003) (-1424.802) [-1438.811] (-1430.374) * (-1426.496) [-1431.863] (-1423.732) (-1422.341) -- 0:01:56
9000 -- (-1434.451) (-1425.608) [-1428.858] (-1439.532) * [-1422.899] (-1429.513) (-1428.103) (-1425.336) -- 0:01:50
9500 -- [-1422.777] (-1423.404) (-1428.002) (-1442.930) * (-1430.127) (-1422.686) (-1429.578) [-1427.971] -- 0:01:44
10000 -- [-1423.351] (-1433.700) (-1421.213) (-1431.003) * (-1430.299) (-1435.911) [-1423.025] (-1424.624) -- 0:01:39
Average standard deviation of split frequencies: 0.074938
10500 -- (-1419.553) [-1421.440] (-1419.939) (-1426.047) * (-1429.351) [-1423.178] (-1428.552) (-1428.712) -- 0:01:34
11000 -- [-1427.596] (-1430.335) (-1424.281) (-1432.287) * [-1427.369] (-1424.355) (-1422.680) (-1425.592) -- 0:01:29
11500 -- [-1429.119] (-1423.013) (-1427.820) (-1433.309) * (-1424.578) [-1426.803] (-1424.600) (-1423.130) -- 0:01:25
12000 -- (-1424.061) (-1424.497) (-1425.275) [-1429.655] * (-1429.821) [-1419.863] (-1427.244) (-1422.373) -- 0:01:22
12500 -- (-1433.566) [-1429.675] (-1421.903) (-1426.248) * (-1428.949) (-1426.483) (-1430.982) [-1427.479] -- 0:01:19
13000 -- [-1432.684] (-1429.324) (-1423.071) (-1428.682) * (-1432.278) [-1425.673] (-1425.941) (-1428.683) -- 0:01:15
13500 -- (-1430.946) (-1436.078) (-1423.137) [-1428.710] * [-1430.474] (-1425.994) (-1429.669) (-1432.904) -- 0:01:13
14000 -- (-1427.764) (-1426.371) (-1422.572) [-1428.244] * (-1422.666) (-1424.384) (-1431.817) [-1434.031] -- 0:01:10
14500 -- (-1431.019) [-1425.739] (-1420.554) (-1427.255) * (-1423.275) (-1420.444) [-1427.319] (-1433.554) -- 0:01:07
15000 -- (-1430.861) (-1426.476) (-1420.879) [-1428.223] * (-1420.417) (-1424.471) (-1431.175) [-1439.432] -- 0:01:05
Average standard deviation of split frequencies: 0.054015
15500 -- (-1429.199) (-1420.136) (-1421.406) [-1427.614] * (-1423.051) (-1426.530) [-1422.769] (-1428.876) -- 0:01:03
16000 -- (-1431.581) [-1424.011] (-1420.996) (-1425.821) * [-1421.124] (-1424.448) (-1436.204) (-1429.668) -- 0:01:01
16500 -- (-1426.669) (-1423.281) (-1420.833) [-1431.790] * (-1421.572) (-1433.600) (-1429.534) [-1423.172] -- 0:00:59
17000 -- (-1428.228) (-1426.430) (-1421.393) [-1431.368] * (-1424.334) (-1432.306) [-1421.917] (-1428.467) -- 0:00:57
17500 -- (-1422.316) (-1430.901) (-1421.184) [-1424.129] * (-1422.739) (-1430.424) [-1429.951] (-1422.884) -- 0:00:56
18000 -- (-1429.692) (-1425.076) [-1419.669] (-1433.200) * (-1423.071) [-1424.998] (-1430.030) (-1426.904) -- 0:00:54
18500 -- (-1421.641) [-1425.084] (-1421.235) (-1424.633) * (-1422.679) [-1426.336] (-1423.642) (-1428.250) -- 0:00:53
19000 -- (-1426.973) [-1423.092] (-1420.639) (-1427.308) * (-1424.900) [-1429.112] (-1427.219) (-1433.717) -- 0:00:51
19500 -- (-1423.786) [-1424.612] (-1422.511) (-1431.738) * (-1425.617) (-1430.480) [-1424.779] (-1422.091) -- 0:00:50
20000 -- (-1424.479) [-1424.512] (-1419.963) (-1432.531) * (-1422.407) [-1425.463] (-1422.466) (-1424.820) -- 0:00:49
Average standard deviation of split frequencies: 0.044194
20500 -- (-1435.798) [-1426.315] (-1420.763) (-1425.717) * (-1424.368) (-1427.180) (-1422.626) [-1422.228] -- 0:01:35
21000 -- (-1424.720) (-1433.898) (-1419.963) [-1422.645] * (-1422.952) (-1434.313) [-1423.702] (-1425.871) -- 0:01:33
21500 -- (-1430.038) (-1428.677) (-1420.050) [-1424.271] * (-1422.820) (-1431.823) (-1424.032) [-1426.509] -- 0:01:31
22000 -- (-1422.351) [-1423.179] (-1426.140) (-1428.308) * (-1422.781) (-1423.011) [-1420.629] (-1425.790) -- 0:01:28
22500 -- (-1428.374) (-1430.302) (-1428.178) [-1429.482] * (-1427.785) [-1431.273] (-1421.885) (-1426.051) -- 0:01:26
23000 -- [-1433.632] (-1421.243) (-1422.673) (-1426.508) * (-1424.168) [-1426.028] (-1422.998) (-1418.735) -- 0:01:24
23500 -- (-1428.263) [-1423.739] (-1421.831) (-1430.825) * (-1423.888) [-1427.255] (-1421.088) (-1434.031) -- 0:01:23
24000 -- [-1428.701] (-1422.896) (-1420.690) (-1425.871) * (-1425.510) [-1423.332] (-1421.593) (-1426.575) -- 0:01:21
24500 -- [-1424.433] (-1424.957) (-1420.242) (-1423.093) * [-1424.087] (-1424.218) (-1420.419) (-1422.018) -- 0:01:19
25000 -- (-1424.865) [-1423.101] (-1420.988) (-1422.685) * (-1425.450) [-1427.618] (-1421.302) (-1427.242) -- 0:01:18
Average standard deviation of split frequencies: 0.036262
25500 -- [-1422.084] (-1433.776) (-1419.218) (-1430.221) * (-1422.900) (-1429.854) (-1420.609) [-1423.888] -- 0:01:16
26000 -- (-1426.706) (-1422.055) (-1423.131) [-1423.011] * [-1420.937] (-1424.321) (-1422.047) (-1424.891) -- 0:01:14
26500 -- (-1429.493) (-1439.390) [-1421.869] (-1425.805) * (-1423.897) [-1426.919] (-1420.239) (-1428.773) -- 0:01:13
27000 -- (-1426.764) (-1420.199) [-1420.652] (-1422.759) * (-1424.429) (-1426.444) (-1424.103) [-1424.356] -- 0:01:12
27500 -- (-1424.941) [-1423.340] (-1423.099) (-1422.125) * (-1423.180) (-1425.802) (-1420.740) [-1430.207] -- 0:01:10
28000 -- [-1432.790] (-1429.471) (-1424.218) (-1424.775) * (-1423.916) (-1421.080) [-1425.633] (-1423.358) -- 0:01:09
28500 -- (-1426.942) (-1423.011) (-1420.979) [-1428.895] * (-1428.603) (-1422.256) [-1422.359] (-1428.817) -- 0:01:08
29000 -- (-1429.053) [-1423.186] (-1421.547) (-1423.274) * [-1422.686] (-1423.605) (-1422.598) (-1432.930) -- 0:01:06
29500 -- (-1428.067) [-1429.200] (-1420.404) (-1425.027) * (-1424.378) (-1423.970) (-1420.937) [-1428.291] -- 0:01:05
30000 -- (-1429.414) (-1423.236) (-1421.311) [-1421.600] * [-1422.834] (-1423.904) (-1419.418) (-1428.408) -- 0:01:04
Average standard deviation of split frequencies: 0.031598
30500 -- [-1428.116] (-1424.614) (-1427.791) (-1425.673) * [-1423.331] (-1421.705) (-1422.212) (-1426.633) -- 0:01:03
31000 -- (-1424.813) [-1427.074] (-1423.510) (-1419.545) * (-1424.827) (-1422.377) (-1420.722) [-1421.624] -- 0:01:02
31500 -- [-1434.722] (-1421.388) (-1420.279) (-1422.222) * [-1423.884] (-1422.957) (-1421.837) (-1423.082) -- 0:01:01
32000 -- (-1429.065) (-1425.950) [-1421.297] (-1422.997) * [-1421.065] (-1420.599) (-1424.652) (-1426.289) -- 0:01:00
32500 -- [-1420.296] (-1429.725) (-1421.947) (-1422.927) * (-1423.138) (-1423.595) [-1420.871] (-1425.769) -- 0:00:59
33000 -- (-1425.589) [-1427.235] (-1425.069) (-1422.238) * [-1424.673] (-1426.353) (-1421.694) (-1429.397) -- 0:00:58
33500 -- [-1422.549] (-1436.312) (-1425.849) (-1421.840) * (-1425.027) (-1425.437) [-1424.764] (-1425.365) -- 0:00:57
34000 -- [-1425.694] (-1424.789) (-1422.331) (-1424.754) * [-1422.930] (-1422.487) (-1430.335) (-1424.820) -- 0:01:25
34500 -- (-1429.224) (-1426.991) (-1425.290) [-1425.664] * [-1428.556] (-1422.277) (-1424.181) (-1432.207) -- 0:01:23
35000 -- (-1419.030) (-1432.626) (-1425.428) [-1422.933] * (-1424.667) (-1420.250) [-1420.652] (-1427.630) -- 0:01:22
Average standard deviation of split frequencies: 0.038595
35500 -- (-1422.188) (-1430.370) (-1425.750) [-1423.718] * [-1428.025] (-1420.107) (-1420.337) (-1431.994) -- 0:01:21
36000 -- (-1420.143) (-1424.766) [-1424.497] (-1422.384) * (-1424.130) (-1420.696) (-1419.471) [-1421.489] -- 0:01:20
36500 -- (-1425.289) [-1428.266] (-1423.371) (-1421.601) * (-1424.240) (-1422.045) [-1423.882] (-1429.487) -- 0:01:19
37000 -- (-1425.185) (-1427.701) [-1422.719] (-1423.113) * (-1422.232) [-1421.619] (-1422.308) (-1424.253) -- 0:01:18
37500 -- (-1426.142) (-1423.754) (-1420.587) [-1422.523] * (-1424.355) [-1423.896] (-1421.595) (-1424.177) -- 0:01:17
38000 -- (-1419.982) [-1423.631] (-1426.238) (-1420.740) * (-1425.338) (-1420.839) [-1421.583] (-1423.417) -- 0:01:15
38500 -- (-1423.567) [-1425.690] (-1423.617) (-1421.804) * (-1422.848) [-1421.099] (-1421.063) (-1424.977) -- 0:01:14
39000 -- [-1421.570] (-1429.966) (-1419.378) (-1422.178) * (-1421.014) (-1421.700) (-1424.289) [-1431.956] -- 0:01:13
39500 -- (-1421.080) [-1426.015] (-1425.486) (-1422.161) * (-1424.617) (-1421.867) (-1426.551) [-1423.777] -- 0:01:12
40000 -- (-1423.399) (-1427.635) [-1421.942] (-1422.699) * (-1424.465) (-1421.991) (-1421.501) [-1422.515] -- 0:01:12
Average standard deviation of split frequencies: 0.029559
40500 -- (-1423.921) (-1423.244) [-1421.044] (-1424.194) * (-1424.072) (-1422.991) (-1421.847) [-1423.010] -- 0:01:11
41000 -- (-1425.052) (-1421.649) (-1422.154) [-1426.437] * (-1420.773) (-1423.874) [-1418.464] (-1440.016) -- 0:01:10
41500 -- (-1428.145) [-1423.075] (-1420.817) (-1422.251) * (-1421.439) (-1422.554) [-1420.229] (-1431.225) -- 0:01:09
42000 -- (-1425.935) (-1425.652) [-1423.932] (-1418.987) * (-1424.707) (-1423.577) [-1418.573] (-1432.660) -- 0:01:08
42500 -- (-1425.822) (-1426.038) [-1422.022] (-1421.987) * (-1421.840) [-1421.475] (-1424.689) (-1429.782) -- 0:01:07
43000 -- (-1420.673) (-1422.165) (-1422.013) [-1422.727] * [-1423.438] (-1422.011) (-1428.108) (-1426.359) -- 0:01:06
43500 -- (-1422.624) [-1423.722] (-1424.334) (-1420.122) * (-1422.815) (-1422.035) (-1420.958) [-1426.904] -- 0:01:05
44000 -- (-1425.822) (-1427.223) (-1423.594) [-1423.692] * (-1422.520) (-1424.950) (-1422.570) [-1423.922] -- 0:01:05
44500 -- (-1431.579) [-1426.123] (-1421.793) (-1421.621) * [-1422.844] (-1420.753) (-1421.015) (-1425.536) -- 0:01:04
45000 -- (-1422.663) [-1424.139] (-1422.869) (-1420.642) * (-1427.872) (-1424.183) (-1419.005) [-1429.859] -- 0:01:03
Average standard deviation of split frequencies: 0.030256
45500 -- [-1421.384] (-1421.986) (-1427.146) (-1420.769) * (-1422.622) [-1424.998] (-1424.717) (-1424.386) -- 0:01:02
46000 -- (-1420.593) (-1426.295) (-1422.856) [-1420.655] * (-1422.208) [-1421.153] (-1420.262) (-1435.062) -- 0:01:02
46500 -- (-1423.068) [-1422.361] (-1420.319) (-1420.596) * (-1422.555) [-1422.029] (-1419.959) (-1426.349) -- 0:01:01
47000 -- (-1419.993) (-1425.697) (-1419.679) [-1420.499] * (-1420.366) (-1423.570) (-1421.173) [-1422.734] -- 0:01:00
47500 -- (-1425.087) [-1426.030] (-1422.128) (-1422.402) * (-1420.735) (-1422.561) (-1422.528) [-1432.177] -- 0:01:00
48000 -- [-1422.079] (-1425.531) (-1425.354) (-1422.247) * (-1422.278) (-1423.108) (-1423.018) [-1429.167] -- 0:00:59
48500 -- (-1422.701) [-1422.269] (-1428.104) (-1419.205) * (-1420.672) (-1425.020) (-1426.584) [-1427.262] -- 0:01:18
49000 -- (-1420.366) (-1424.830) (-1425.564) [-1422.180] * (-1422.882) (-1422.268) (-1422.227) [-1428.047] -- 0:01:17
49500 -- (-1422.112) (-1426.886) (-1421.920) [-1419.551] * (-1422.337) [-1421.720] (-1424.357) (-1432.119) -- 0:01:16
50000 -- (-1419.414) (-1425.160) (-1422.759) [-1421.689] * [-1421.128] (-1422.885) (-1422.934) (-1430.141) -- 0:01:16
Average standard deviation of split frequencies: 0.023505
50500 -- (-1422.480) (-1431.644) (-1424.410) [-1420.819] * [-1424.669] (-1423.849) (-1422.098) (-1425.054) -- 0:01:15
51000 -- (-1420.386) (-1425.540) (-1422.425) [-1422.997] * (-1422.007) [-1421.889] (-1424.391) (-1435.132) -- 0:01:14
51500 -- (-1421.495) [-1423.201] (-1424.299) (-1423.188) * (-1424.234) (-1424.931) [-1423.789] (-1423.967) -- 0:01:13
52000 -- (-1420.440) [-1424.918] (-1422.151) (-1424.064) * (-1424.280) (-1422.386) (-1422.332) [-1424.185] -- 0:01:12
52500 -- (-1423.506) (-1436.899) (-1423.563) [-1424.720] * (-1420.445) [-1421.466] (-1421.758) (-1424.084) -- 0:01:12
53000 -- (-1422.555) [-1427.356] (-1422.222) (-1421.494) * (-1421.705) [-1421.256] (-1422.027) (-1426.644) -- 0:01:11
53500 -- (-1420.883) [-1422.950] (-1423.052) (-1419.336) * (-1421.655) (-1420.567) (-1421.838) [-1425.102] -- 0:01:10
54000 -- (-1421.156) [-1419.055] (-1424.091) (-1420.854) * (-1423.416) (-1420.399) (-1421.845) [-1430.605] -- 0:01:10
54500 -- (-1422.662) [-1425.771] (-1422.913) (-1421.525) * (-1421.677) (-1421.514) [-1422.096] (-1426.364) -- 0:01:09
55000 -- (-1420.238) [-1427.420] (-1423.165) (-1424.158) * (-1422.159) (-1422.679) [-1427.077] (-1427.618) -- 0:01:08
Average standard deviation of split frequencies: 0.020823
55500 -- (-1425.784) (-1427.386) (-1422.774) [-1422.397] * [-1421.637] (-1422.469) (-1426.021) (-1427.096) -- 0:01:08
56000 -- (-1420.937) [-1423.477] (-1422.650) (-1426.308) * (-1421.208) (-1424.202) (-1426.769) [-1428.263] -- 0:01:07
56500 -- (-1421.443) [-1423.247] (-1425.662) (-1425.373) * [-1420.480] (-1427.074) (-1427.141) (-1426.507) -- 0:01:06
57000 -- (-1423.773) [-1424.650] (-1424.387) (-1421.387) * (-1423.194) (-1424.461) (-1421.279) [-1425.889] -- 0:01:06
57500 -- [-1423.268] (-1432.898) (-1421.641) (-1422.691) * (-1419.621) (-1426.295) (-1421.611) [-1426.159] -- 0:01:05
58000 -- [-1421.794] (-1425.022) (-1422.957) (-1421.196) * (-1421.412) (-1425.736) (-1421.746) [-1420.283] -- 0:01:04
58500 -- (-1421.452) [-1426.151] (-1423.045) (-1420.022) * (-1420.779) (-1424.622) (-1421.361) [-1422.549] -- 0:01:04
59000 -- [-1422.791] (-1426.947) (-1421.146) (-1419.879) * (-1424.027) [-1424.208] (-1423.824) (-1424.314) -- 0:01:03
59500 -- [-1422.879] (-1425.667) (-1425.219) (-1422.167) * (-1426.705) (-1421.614) (-1421.554) [-1426.024] -- 0:01:03
60000 -- (-1421.714) (-1426.608) [-1423.290] (-1422.843) * (-1422.249) (-1421.863) [-1421.362] (-1424.826) -- 0:01:02
Average standard deviation of split frequencies: 0.030673
60500 -- [-1422.474] (-1430.171) (-1421.776) (-1421.111) * (-1422.866) [-1422.682] (-1420.814) (-1434.868) -- 0:01:02
61000 -- (-1423.428) (-1430.439) [-1422.495] (-1419.437) * [-1421.015] (-1423.397) (-1420.600) (-1430.305) -- 0:01:01
61500 -- (-1426.903) (-1427.009) (-1423.947) [-1424.082] * (-1420.833) (-1421.184) (-1425.555) [-1427.119] -- 0:01:01
62000 -- (-1422.517) [-1433.548] (-1422.546) (-1424.842) * (-1423.508) (-1421.005) (-1420.716) [-1423.818] -- 0:01:00
62500 -- (-1425.423) [-1426.252] (-1419.399) (-1420.854) * (-1422.221) [-1421.110] (-1422.685) (-1420.366) -- 0:01:00
63000 -- (-1424.372) [-1426.512] (-1421.585) (-1422.543) * (-1420.027) (-1419.230) (-1422.789) [-1424.763] -- 0:01:14
63500 -- (-1420.565) (-1423.843) (-1421.002) [-1421.912] * (-1420.018) (-1426.118) (-1421.366) [-1425.697] -- 0:01:13
64000 -- (-1425.008) (-1427.050) [-1423.272] (-1423.447) * (-1420.826) [-1422.334] (-1422.900) (-1423.955) -- 0:01:13
64500 -- (-1423.996) [-1424.505] (-1421.830) (-1422.244) * (-1420.215) [-1422.575] (-1422.281) (-1425.842) -- 0:01:12
65000 -- (-1421.876) (-1433.867) (-1423.220) [-1421.850] * [-1423.342] (-1421.028) (-1424.210) (-1424.190) -- 0:01:11
Average standard deviation of split frequencies: 0.029998
65500 -- [-1423.173] (-1436.473) (-1423.160) (-1423.085) * (-1424.995) (-1421.579) (-1419.534) [-1423.249] -- 0:01:11
66000 -- (-1424.188) [-1432.201] (-1422.798) (-1420.644) * (-1425.390) (-1422.304) (-1422.722) [-1425.312] -- 0:01:10
66500 -- (-1421.095) (-1433.242) [-1422.380] (-1422.054) * (-1423.597) (-1425.028) [-1422.866] (-1427.757) -- 0:01:10
67000 -- (-1426.599) (-1426.763) [-1420.037] (-1421.595) * [-1423.481] (-1427.324) (-1422.717) (-1423.922) -- 0:01:09
67500 -- (-1424.376) [-1424.463] (-1424.090) (-1424.489) * (-1420.289) (-1427.732) (-1424.617) [-1420.970] -- 0:01:09
68000 -- [-1422.047] (-1430.649) (-1421.519) (-1423.136) * (-1422.683) [-1427.678] (-1422.271) (-1421.524) -- 0:01:08
68500 -- (-1424.495) [-1427.460] (-1424.459) (-1421.866) * [-1423.671] (-1425.993) (-1422.723) (-1423.590) -- 0:01:07
69000 -- (-1427.197) [-1426.594] (-1425.338) (-1422.776) * (-1424.437) (-1421.725) [-1422.309] (-1425.730) -- 0:01:07
69500 -- (-1427.257) [-1424.832] (-1423.409) (-1424.703) * [-1421.036] (-1422.156) (-1425.252) (-1427.517) -- 0:01:06
70000 -- (-1423.296) [-1429.438] (-1422.658) (-1429.107) * (-1420.376) [-1421.175] (-1425.602) (-1423.322) -- 0:01:06
Average standard deviation of split frequencies: 0.032687
70500 -- (-1422.500) (-1429.561) [-1423.309] (-1423.926) * (-1422.157) [-1420.580] (-1422.341) (-1432.025) -- 0:01:05
71000 -- [-1421.399] (-1424.178) (-1423.260) (-1420.967) * (-1420.571) [-1423.140] (-1423.037) (-1428.119) -- 0:01:05
71500 -- [-1420.336] (-1429.769) (-1421.447) (-1422.123) * (-1419.552) (-1422.429) [-1421.263] (-1430.397) -- 0:01:04
72000 -- [-1422.445] (-1427.955) (-1421.961) (-1421.669) * [-1421.732] (-1423.177) (-1423.045) (-1424.170) -- 0:01:04
72500 -- [-1423.341] (-1433.903) (-1422.696) (-1420.291) * (-1422.658) (-1424.146) (-1421.567) [-1427.160] -- 0:01:03
73000 -- [-1422.155] (-1424.502) (-1422.087) (-1423.438) * (-1420.611) (-1424.536) [-1421.249] (-1431.446) -- 0:01:03
73500 -- (-1422.288) (-1424.958) (-1422.950) [-1422.248] * (-1422.685) (-1422.162) (-1420.203) [-1431.833] -- 0:01:03
74000 -- (-1425.496) [-1425.841] (-1422.276) (-1423.651) * (-1425.509) (-1422.484) (-1422.180) [-1425.448] -- 0:01:02
74500 -- (-1424.789) (-1427.201) [-1422.430] (-1425.980) * (-1422.914) (-1420.411) (-1419.970) [-1426.560] -- 0:01:02
75000 -- (-1420.124) [-1429.134] (-1423.991) (-1425.775) * (-1422.730) (-1421.419) [-1420.580] (-1428.059) -- 0:01:01
Average standard deviation of split frequencies: 0.033952
75500 -- [-1420.526] (-1428.431) (-1422.446) (-1424.394) * (-1421.603) (-1422.481) [-1420.181] (-1427.576) -- 0:01:01
76000 -- (-1420.864) (-1424.327) [-1419.847] (-1427.201) * [-1420.265] (-1424.150) (-1421.951) (-1432.963) -- 0:01:00
76500 -- (-1421.718) (-1428.726) (-1422.598) [-1423.168] * (-1419.370) (-1422.301) (-1423.125) [-1433.355] -- 0:01:00
77000 -- [-1420.661] (-1424.387) (-1425.623) (-1422.321) * (-1421.489) (-1425.536) (-1421.937) [-1425.776] -- 0:00:59
77500 -- (-1422.175) [-1421.807] (-1421.254) (-1424.962) * (-1424.685) (-1424.346) (-1420.499) [-1425.244] -- 0:00:59
78000 -- (-1424.155) (-1423.185) [-1420.546] (-1430.441) * (-1422.282) [-1420.133] (-1421.535) (-1426.975) -- 0:01:10
78500 -- (-1421.497) [-1426.783] (-1424.382) (-1434.894) * (-1420.216) (-1422.355) (-1424.772) [-1421.144] -- 0:01:10
79000 -- (-1423.210) [-1430.004] (-1423.603) (-1423.183) * (-1427.641) [-1420.032] (-1421.208) (-1425.504) -- 0:01:09
79500 -- (-1420.493) [-1433.983] (-1424.891) (-1423.969) * (-1420.731) (-1421.887) (-1421.282) [-1424.476] -- 0:01:09
80000 -- [-1421.194] (-1425.720) (-1423.689) (-1422.370) * (-1421.497) (-1421.467) (-1425.687) [-1429.586] -- 0:01:09
Average standard deviation of split frequencies: 0.035751
80500 -- (-1424.404) (-1428.514) (-1426.638) [-1421.472] * (-1421.933) [-1419.785] (-1430.681) (-1438.518) -- 0:01:08
81000 -- (-1422.505) (-1432.895) (-1425.157) [-1421.584] * [-1420.973] (-1421.483) (-1433.048) (-1436.581) -- 0:01:08
81500 -- (-1424.132) (-1426.941) [-1423.841] (-1422.690) * [-1421.583] (-1421.572) (-1431.895) (-1428.836) -- 0:01:07
82000 -- (-1422.479) (-1432.298) (-1420.109) [-1422.238] * (-1427.274) [-1420.443] (-1422.579) (-1428.445) -- 0:01:07
82500 -- (-1422.162) [-1426.109] (-1423.339) (-1425.888) * (-1424.732) (-1424.855) (-1423.377) [-1429.098] -- 0:01:06
83000 -- (-1421.159) (-1427.480) [-1421.199] (-1424.436) * [-1421.954] (-1424.022) (-1423.694) (-1432.776) -- 0:01:06
83500 -- (-1422.939) (-1428.881) [-1422.809] (-1423.756) * [-1423.367] (-1423.319) (-1422.350) (-1429.849) -- 0:01:05
84000 -- (-1423.560) [-1424.376] (-1423.589) (-1422.535) * (-1422.166) [-1422.532] (-1422.129) (-1434.212) -- 0:01:05
84500 -- (-1420.254) [-1425.109] (-1423.593) (-1425.605) * [-1427.458] (-1424.285) (-1422.266) (-1431.320) -- 0:01:05
85000 -- [-1420.518] (-1422.775) (-1422.666) (-1426.732) * (-1423.079) (-1422.911) (-1423.301) [-1421.742] -- 0:01:04
Average standard deviation of split frequencies: 0.032889
85500 -- (-1421.978) (-1422.852) [-1422.669] (-1421.900) * (-1422.862) (-1421.964) (-1421.103) [-1424.994] -- 0:01:04
86000 -- (-1425.289) (-1425.392) [-1424.696] (-1420.591) * (-1423.647) [-1423.074] (-1419.967) (-1430.482) -- 0:01:03
86500 -- (-1423.012) (-1423.216) (-1425.064) [-1419.608] * (-1424.230) [-1421.812] (-1420.730) (-1423.370) -- 0:01:03
87000 -- (-1421.358) [-1419.753] (-1423.502) (-1422.911) * [-1426.117] (-1423.871) (-1420.122) (-1426.968) -- 0:01:02
87500 -- (-1421.067) [-1427.564] (-1423.720) (-1419.960) * (-1421.568) (-1420.264) (-1419.846) [-1426.512] -- 0:01:02
88000 -- (-1423.140) (-1430.150) (-1424.212) [-1423.211] * (-1424.931) (-1421.201) (-1424.600) [-1419.914] -- 0:01:02
88500 -- [-1421.928] (-1425.812) (-1425.869) (-1420.226) * (-1424.412) (-1422.007) (-1422.492) [-1431.729] -- 0:01:01
89000 -- (-1423.787) (-1429.857) (-1424.542) [-1420.834] * (-1424.028) (-1425.166) [-1424.630] (-1427.096) -- 0:01:01
89500 -- (-1422.455) (-1422.147) [-1422.795] (-1422.713) * (-1424.016) (-1420.348) (-1423.025) [-1424.578] -- 0:01:01
90000 -- (-1422.464) (-1427.545) (-1422.827) [-1425.590] * [-1423.952] (-1420.411) (-1423.383) (-1425.239) -- 0:01:00
Average standard deviation of split frequencies: 0.031502
90500 -- (-1427.162) [-1423.572] (-1424.194) (-1423.696) * (-1422.923) (-1420.704) [-1421.659] (-1421.904) -- 0:01:00
91000 -- (-1424.265) [-1426.013] (-1424.208) (-1424.806) * [-1424.793] (-1420.467) (-1423.486) (-1428.426) -- 0:00:59
91500 -- [-1422.002] (-1421.681) (-1422.656) (-1425.650) * [-1421.910] (-1421.200) (-1422.578) (-1427.439) -- 0:00:59
92000 -- [-1423.108] (-1430.551) (-1426.083) (-1426.391) * (-1419.488) (-1422.280) (-1422.535) [-1421.995] -- 0:00:59
92500 -- (-1426.509) [-1427.598] (-1425.394) (-1426.957) * (-1422.731) (-1421.665) (-1428.417) [-1424.629] -- 0:00:58
93000 -- (-1423.775) [-1425.210] (-1424.385) (-1424.222) * (-1421.243) (-1421.546) (-1420.092) [-1424.450] -- 0:01:08
93500 -- (-1422.987) [-1425.718] (-1425.200) (-1421.934) * (-1422.867) (-1420.181) (-1420.630) [-1419.090] -- 0:01:07
94000 -- (-1423.093) (-1429.182) [-1424.572] (-1422.692) * (-1425.104) [-1419.141] (-1421.928) (-1428.923) -- 0:01:07
94500 -- (-1421.076) [-1419.990] (-1433.107) (-1421.291) * (-1425.398) [-1421.447] (-1421.395) (-1429.077) -- 0:01:07
95000 -- (-1424.705) (-1424.278) (-1432.123) [-1420.734] * (-1423.633) (-1422.643) (-1423.532) [-1424.586] -- 0:01:06
Average standard deviation of split frequencies: 0.030907
95500 -- (-1425.127) (-1423.550) (-1426.787) [-1419.006] * (-1422.045) (-1426.676) [-1420.949] (-1423.821) -- 0:01:06
96000 -- (-1422.238) [-1425.239] (-1420.832) (-1420.318) * (-1423.673) (-1420.741) (-1422.530) [-1428.807] -- 0:01:05
96500 -- (-1420.982) [-1428.671] (-1421.296) (-1422.335) * (-1423.912) (-1425.429) (-1427.409) [-1424.554] -- 0:01:05
97000 -- (-1421.038) (-1426.635) (-1424.396) [-1424.150] * (-1423.999) [-1425.671] (-1423.619) (-1432.344) -- 0:01:05
97500 -- [-1420.790] (-1425.384) (-1424.403) (-1421.523) * (-1422.144) (-1426.798) [-1422.070] (-1425.356) -- 0:01:04
98000 -- [-1421.133] (-1433.543) (-1422.858) (-1424.131) * (-1422.264) (-1423.295) [-1422.812] (-1427.137) -- 0:01:04
98500 -- (-1423.778) [-1437.170] (-1423.178) (-1429.680) * (-1425.211) (-1422.218) (-1425.745) [-1425.374] -- 0:01:04
99000 -- (-1422.026) (-1433.753) (-1421.957) [-1426.887] * (-1422.981) (-1430.267) (-1425.266) [-1421.923] -- 0:01:03
99500 -- [-1422.933] (-1424.091) (-1425.480) (-1423.254) * (-1420.872) (-1423.276) (-1421.585) [-1428.696] -- 0:01:03
100000 -- (-1424.029) [-1421.618] (-1422.252) (-1421.663) * (-1422.210) (-1419.201) [-1422.571] (-1427.068) -- 0:01:02
Average standard deviation of split frequencies: 0.031127
100500 -- (-1423.351) [-1431.031] (-1422.884) (-1420.566) * (-1420.597) [-1420.917] (-1425.515) (-1426.694) -- 0:01:02
101000 -- (-1423.800) (-1429.989) (-1422.852) [-1420.238] * [-1419.446] (-1423.289) (-1422.917) (-1427.767) -- 0:01:02
101500 -- (-1422.098) (-1426.305) (-1422.774) [-1420.016] * (-1420.937) (-1423.644) (-1422.763) [-1426.318] -- 0:01:01
102000 -- [-1422.466] (-1423.041) (-1422.789) (-1420.736) * (-1419.541) (-1419.187) [-1423.554] (-1422.389) -- 0:01:01
102500 -- (-1421.385) [-1424.230] (-1424.575) (-1419.921) * [-1418.817] (-1424.077) (-1423.597) (-1425.184) -- 0:01:01
103000 -- (-1424.788) (-1430.546) (-1423.825) [-1422.186] * (-1423.261) (-1421.867) [-1424.320] (-1425.525) -- 0:01:00
103500 -- (-1425.638) [-1422.098] (-1421.318) (-1426.333) * [-1422.855] (-1424.441) (-1421.886) (-1428.589) -- 0:01:00
104000 -- (-1424.979) [-1430.602] (-1421.137) (-1424.003) * (-1426.842) (-1420.587) [-1422.845] (-1427.305) -- 0:01:00
104500 -- (-1424.709) [-1427.340] (-1423.035) (-1421.270) * (-1423.279) [-1420.350] (-1421.232) (-1425.311) -- 0:00:59
105000 -- (-1428.490) (-1436.595) (-1420.943) [-1423.045] * (-1422.504) [-1419.754] (-1420.463) (-1426.989) -- 0:00:59
Average standard deviation of split frequencies: 0.033485
105500 -- (-1428.657) [-1424.755] (-1422.615) (-1421.162) * [-1421.580] (-1421.158) (-1423.206) (-1431.667) -- 0:00:59
106000 -- [-1424.864] (-1424.266) (-1421.922) (-1419.319) * (-1423.259) [-1420.435] (-1425.763) (-1428.655) -- 0:00:59
106500 -- (-1424.295) (-1433.294) (-1421.617) [-1421.023] * (-1424.084) (-1423.828) (-1422.574) [-1423.518] -- 0:00:58
107000 -- (-1422.845) (-1423.663) (-1422.603) [-1420.627] * (-1421.762) (-1423.899) [-1422.445] (-1425.275) -- 0:00:58
107500 -- (-1429.363) [-1424.771] (-1422.538) (-1421.383) * (-1426.384) (-1422.562) (-1425.170) [-1420.917] -- 0:00:58
108000 -- (-1422.885) [-1430.835] (-1420.205) (-1425.519) * (-1422.726) (-1425.179) (-1423.148) [-1433.505] -- 0:01:06
108500 -- (-1423.618) (-1454.415) (-1421.335) [-1424.228] * (-1421.956) (-1424.732) [-1419.681] (-1428.631) -- 0:01:05
109000 -- (-1425.822) (-1425.001) (-1425.337) [-1422.566] * (-1423.403) (-1429.455) [-1420.611] (-1430.534) -- 0:01:05
109500 -- (-1423.745) (-1422.897) [-1426.181] (-1423.381) * (-1423.029) [-1420.697] (-1422.931) (-1422.674) -- 0:01:05
110000 -- (-1421.349) [-1422.325] (-1425.684) (-1423.174) * (-1424.215) (-1423.031) (-1427.680) [-1426.260] -- 0:01:04
Average standard deviation of split frequencies: 0.030068
110500 -- (-1425.969) [-1419.443] (-1424.190) (-1421.219) * (-1423.934) (-1420.597) (-1429.207) [-1425.500] -- 0:01:04
111000 -- (-1422.735) (-1425.433) [-1422.045] (-1421.585) * (-1422.141) [-1422.073] (-1423.999) (-1429.166) -- 0:01:04
111500 -- (-1422.773) [-1424.725] (-1423.473) (-1420.804) * (-1425.042) (-1422.809) (-1419.015) [-1427.896] -- 0:01:03
112000 -- (-1426.360) [-1428.406] (-1422.618) (-1422.303) * (-1426.295) (-1423.020) [-1421.068] (-1432.575) -- 0:01:03
112500 -- [-1425.271] (-1428.577) (-1425.229) (-1420.758) * (-1426.807) (-1422.548) (-1421.681) [-1427.365] -- 0:01:03
113000 -- (-1421.352) (-1423.270) [-1423.229] (-1421.985) * (-1425.452) [-1423.194] (-1424.218) (-1429.839) -- 0:01:02
113500 -- (-1422.380) (-1422.115) (-1424.050) [-1421.606] * (-1423.805) (-1424.690) (-1421.280) [-1425.363] -- 0:01:02
114000 -- [-1421.656] (-1422.427) (-1421.499) (-1425.825) * (-1421.135) (-1421.843) (-1429.198) [-1432.587] -- 0:01:02
114500 -- (-1422.122) (-1423.593) [-1420.036] (-1425.682) * (-1421.095) (-1421.344) [-1424.553] (-1425.595) -- 0:01:01
115000 -- (-1420.354) (-1429.034) (-1420.974) [-1421.342] * (-1423.674) (-1422.462) [-1419.988] (-1427.393) -- 0:01:01
Average standard deviation of split frequencies: 0.028925
115500 -- (-1422.209) (-1427.628) [-1419.817] (-1419.207) * (-1422.904) (-1421.517) [-1424.098] (-1429.196) -- 0:01:01
116000 -- (-1420.601) [-1420.390] (-1425.127) (-1421.413) * (-1424.666) (-1422.061) (-1422.137) [-1431.309] -- 0:01:00
116500 -- (-1420.425) (-1421.974) (-1422.497) [-1422.109] * (-1424.224) (-1422.147) [-1420.982] (-1430.621) -- 0:01:00
117000 -- (-1419.959) [-1419.356] (-1420.697) (-1424.456) * (-1423.931) (-1422.380) (-1423.218) [-1429.080] -- 0:01:00
117500 -- (-1421.573) [-1419.228] (-1422.407) (-1425.154) * (-1423.011) [-1421.639] (-1424.113) (-1443.114) -- 0:01:00
118000 -- (-1420.970) [-1420.361] (-1421.198) (-1430.180) * (-1423.747) (-1422.187) [-1422.382] (-1426.557) -- 0:00:59
118500 -- (-1421.999) [-1420.169] (-1422.334) (-1427.428) * (-1422.124) [-1422.039] (-1422.843) (-1428.391) -- 0:00:59
119000 -- (-1421.700) (-1421.409) (-1422.355) [-1423.025] * (-1423.747) (-1422.515) (-1423.512) [-1427.255] -- 0:00:59
119500 -- (-1420.705) [-1419.186] (-1423.064) (-1422.548) * (-1423.363) (-1425.571) [-1419.957] (-1428.997) -- 0:00:58
120000 -- (-1421.567) (-1421.302) [-1422.311] (-1424.289) * (-1422.778) (-1423.443) (-1421.289) [-1428.567] -- 0:00:58
Average standard deviation of split frequencies: 0.030602
120500 -- (-1420.256) [-1419.836] (-1423.015) (-1425.432) * (-1421.937) (-1424.247) (-1422.660) [-1428.969] -- 0:00:58
121000 -- [-1421.868] (-1424.299) (-1422.353) (-1420.201) * (-1422.903) (-1425.404) (-1421.620) [-1426.873] -- 0:00:58
121500 -- (-1419.418) [-1420.731] (-1420.900) (-1419.722) * (-1420.912) (-1423.970) (-1422.881) [-1423.943] -- 0:00:57
122000 -- [-1420.277] (-1423.586) (-1424.401) (-1421.315) * [-1420.167] (-1430.462) (-1424.879) (-1423.330) -- 0:00:57
122500 -- (-1422.441) (-1428.062) [-1423.275] (-1421.859) * (-1422.128) [-1421.390] (-1422.471) (-1427.496) -- 0:01:04
123000 -- [-1421.946] (-1420.472) (-1424.849) (-1424.530) * (-1421.258) (-1421.520) (-1423.233) [-1423.063] -- 0:01:04
123500 -- (-1422.236) (-1420.893) [-1424.125] (-1424.202) * (-1421.335) (-1420.266) (-1423.274) [-1419.566] -- 0:01:03
124000 -- [-1421.404] (-1425.278) (-1421.477) (-1424.907) * (-1427.970) [-1419.792] (-1423.081) (-1424.983) -- 0:01:03
124500 -- [-1421.641] (-1426.037) (-1425.098) (-1425.288) * (-1425.945) (-1424.192) [-1421.139] (-1425.211) -- 0:01:03
125000 -- [-1422.725] (-1422.602) (-1423.995) (-1428.031) * (-1422.262) [-1422.808] (-1420.809) (-1423.251) -- 0:01:03
Average standard deviation of split frequencies: 0.028830
125500 -- [-1423.079] (-1420.525) (-1421.207) (-1423.742) * (-1423.657) (-1421.699) (-1424.022) [-1425.823] -- 0:01:02
126000 -- [-1422.226] (-1421.801) (-1423.848) (-1422.145) * (-1422.288) [-1422.227] (-1422.220) (-1429.018) -- 0:01:02
126500 -- (-1420.198) [-1424.235] (-1421.453) (-1425.161) * (-1422.654) (-1422.287) (-1420.034) [-1426.797] -- 0:01:02
127000 -- [-1419.912] (-1420.542) (-1422.422) (-1424.452) * (-1421.477) [-1423.482] (-1418.967) (-1429.880) -- 0:01:01
127500 -- (-1419.495) [-1419.616] (-1430.565) (-1421.913) * (-1421.411) (-1421.821) [-1420.786] (-1427.754) -- 0:01:01
128000 -- (-1420.807) [-1424.258] (-1420.964) (-1422.699) * (-1422.048) (-1423.612) (-1419.196) [-1430.229] -- 0:01:01
128500 -- (-1423.806) (-1422.941) [-1421.161] (-1421.693) * (-1420.699) (-1423.775) (-1418.398) [-1427.712] -- 0:01:01
129000 -- (-1423.865) (-1422.736) [-1425.128] (-1421.773) * (-1422.070) (-1426.990) (-1419.636) [-1429.004] -- 0:01:00
129500 -- [-1421.660] (-1422.460) (-1420.593) (-1421.669) * (-1422.877) (-1425.228) (-1426.017) [-1426.173] -- 0:01:00
130000 -- [-1423.396] (-1425.095) (-1421.339) (-1420.811) * (-1423.387) (-1423.937) [-1419.792] (-1427.847) -- 0:01:00
Average standard deviation of split frequencies: 0.024193
130500 -- [-1422.853] (-1423.603) (-1423.593) (-1421.458) * [-1422.735] (-1426.353) (-1422.081) (-1428.193) -- 0:00:59
131000 -- (-1420.661) (-1420.741) [-1419.507] (-1425.366) * (-1423.303) (-1421.959) [-1422.966] (-1431.551) -- 0:00:59
131500 -- (-1420.536) [-1423.376] (-1422.143) (-1422.656) * (-1424.872) (-1423.603) (-1419.586) [-1420.740] -- 0:00:59
132000 -- [-1420.083] (-1423.116) (-1419.119) (-1422.422) * (-1425.682) [-1421.378] (-1421.111) (-1438.772) -- 0:00:59
132500 -- (-1421.509) [-1422.133] (-1420.785) (-1422.539) * (-1426.860) (-1421.411) [-1421.844] (-1425.722) -- 0:00:58
133000 -- [-1420.922] (-1422.012) (-1420.245) (-1423.496) * (-1424.224) (-1422.299) (-1421.129) [-1421.510] -- 0:00:58
133500 -- (-1424.296) (-1422.312) [-1419.024] (-1422.508) * (-1422.323) [-1422.237] (-1419.731) (-1420.235) -- 0:00:58
134000 -- [-1421.342] (-1423.197) (-1424.880) (-1425.500) * (-1421.610) (-1421.778) (-1421.417) [-1420.991] -- 0:00:58
134500 -- (-1421.328) (-1422.716) [-1421.734] (-1425.481) * (-1422.616) [-1420.691] (-1423.821) (-1422.515) -- 0:00:57
135000 -- (-1421.557) [-1422.037] (-1422.731) (-1421.826) * (-1421.782) [-1420.924] (-1422.967) (-1424.099) -- 0:00:57
Average standard deviation of split frequencies: 0.023878
135500 -- (-1423.411) [-1427.937] (-1423.921) (-1424.328) * (-1421.506) (-1423.427) [-1423.004] (-1424.952) -- 0:00:57
136000 -- [-1421.428] (-1427.524) (-1424.236) (-1427.083) * (-1423.598) (-1424.055) [-1422.962] (-1424.289) -- 0:00:57
136500 -- [-1421.636] (-1422.944) (-1421.653) (-1427.478) * (-1420.993) (-1422.981) (-1422.839) [-1423.948] -- 0:00:56
137000 -- (-1425.560) (-1421.593) [-1419.640] (-1424.561) * (-1421.842) (-1423.950) (-1419.698) [-1422.150] -- 0:00:56
137500 -- [-1427.019] (-1421.919) (-1420.074) (-1422.152) * [-1424.658] (-1422.710) (-1420.221) (-1421.550) -- 0:01:02
138000 -- [-1422.654] (-1421.123) (-1422.410) (-1421.916) * [-1425.311] (-1423.885) (-1420.602) (-1424.161) -- 0:01:02
138500 -- (-1425.180) [-1422.354] (-1419.612) (-1426.887) * (-1423.867) (-1425.032) (-1420.439) [-1423.218] -- 0:01:02
139000 -- [-1420.491] (-1420.201) (-1422.017) (-1425.023) * (-1424.103) (-1423.593) (-1421.168) [-1421.353] -- 0:01:01
139500 -- (-1423.323) (-1421.758) [-1421.473] (-1424.815) * (-1423.643) (-1423.134) (-1425.297) [-1419.598] -- 0:01:01
140000 -- (-1421.357) (-1422.735) [-1423.374] (-1423.655) * [-1425.370] (-1423.227) (-1424.093) (-1421.654) -- 0:01:01
Average standard deviation of split frequencies: 0.021597
140500 -- (-1421.230) (-1421.787) [-1420.276] (-1426.023) * (-1423.131) (-1426.034) [-1423.076] (-1421.298) -- 0:01:01
141000 -- (-1423.133) (-1421.173) [-1422.875] (-1427.339) * (-1423.692) [-1421.898] (-1423.350) (-1423.067) -- 0:01:00
141500 -- (-1425.255) (-1421.557) (-1423.184) [-1422.267] * (-1424.063) (-1421.266) (-1422.886) [-1421.881] -- 0:01:00
142000 -- (-1423.817) [-1424.278] (-1424.903) (-1422.596) * [-1422.573] (-1423.112) (-1425.294) (-1421.616) -- 0:01:00
142500 -- (-1424.825) [-1423.152] (-1426.002) (-1421.263) * (-1421.064) [-1420.245] (-1421.164) (-1422.998) -- 0:01:00
143000 -- [-1427.082] (-1422.253) (-1422.267) (-1422.477) * (-1421.575) (-1420.214) [-1420.491] (-1420.893) -- 0:00:59
143500 -- (-1425.738) (-1422.152) (-1421.079) [-1422.223] * (-1423.188) [-1420.362] (-1424.804) (-1421.573) -- 0:00:59
144000 -- (-1424.382) [-1421.891] (-1421.941) (-1421.608) * [-1421.623] (-1420.221) (-1421.806) (-1424.921) -- 0:00:59
144500 -- [-1424.001] (-1419.576) (-1421.276) (-1425.515) * (-1422.839) [-1420.932] (-1420.734) (-1427.376) -- 0:00:59
145000 -- [-1421.156] (-1425.469) (-1421.891) (-1422.817) * (-1420.847) (-1420.174) [-1422.050] (-1421.543) -- 0:00:58
Average standard deviation of split frequencies: 0.020732
145500 -- [-1421.121] (-1425.632) (-1421.579) (-1421.876) * (-1422.642) [-1420.985] (-1422.413) (-1419.404) -- 0:00:58
146000 -- (-1419.791) (-1423.737) [-1419.612] (-1424.977) * (-1422.685) (-1423.408) (-1423.767) [-1423.201] -- 0:00:58
146500 -- (-1427.707) (-1426.317) [-1422.097] (-1421.959) * [-1422.792] (-1420.650) (-1421.564) (-1420.544) -- 0:00:58
147000 -- (-1426.290) (-1421.087) [-1424.593] (-1424.018) * (-1423.569) [-1420.541] (-1422.611) (-1423.865) -- 0:00:58
147500 -- (-1422.469) (-1419.952) (-1423.248) [-1421.687] * (-1423.361) [-1422.474] (-1421.645) (-1421.533) -- 0:00:57
148000 -- (-1421.549) [-1424.537] (-1424.101) (-1422.019) * (-1424.424) (-1422.699) (-1423.882) [-1421.893] -- 0:00:57
148500 -- [-1425.167] (-1421.075) (-1421.062) (-1422.016) * (-1426.624) (-1422.996) (-1422.976) [-1420.113] -- 0:00:57
149000 -- (-1422.250) (-1419.879) (-1423.289) [-1421.824] * [-1424.916] (-1424.766) (-1422.699) (-1421.786) -- 0:00:57
149500 -- (-1423.688) (-1420.309) [-1421.718] (-1423.457) * (-1425.698) [-1423.415] (-1422.433) (-1421.634) -- 0:00:56
150000 -- [-1420.719] (-1419.813) (-1429.441) (-1422.239) * (-1423.349) (-1423.623) [-1421.465] (-1419.374) -- 0:00:56
Average standard deviation of split frequencies: 0.020163
150500 -- (-1419.930) [-1425.810] (-1428.716) (-1425.181) * (-1423.632) (-1422.081) (-1422.111) [-1422.486] -- 0:00:56
151000 -- [-1419.790] (-1426.327) (-1423.836) (-1427.824) * [-1422.498] (-1420.833) (-1423.163) (-1422.577) -- 0:00:56
151500 -- [-1420.926] (-1422.824) (-1424.336) (-1423.166) * [-1421.456] (-1425.309) (-1421.005) (-1423.113) -- 0:00:56
152000 -- (-1424.777) [-1422.816] (-1428.385) (-1424.840) * [-1423.896] (-1422.952) (-1425.023) (-1423.161) -- 0:01:01
152500 -- [-1424.473] (-1423.731) (-1422.483) (-1425.043) * (-1423.692) (-1423.165) (-1421.791) [-1422.347] -- 0:01:01
153000 -- (-1420.428) [-1423.298] (-1420.076) (-1425.854) * [-1422.235] (-1422.322) (-1422.417) (-1422.192) -- 0:01:00
153500 -- (-1421.584) (-1421.424) [-1423.417] (-1422.239) * (-1422.110) (-1423.003) [-1421.411] (-1424.839) -- 0:01:00
154000 -- (-1427.142) [-1421.562] (-1425.685) (-1422.939) * (-1424.674) (-1421.612) [-1422.830] (-1422.387) -- 0:01:00
154500 -- (-1423.361) (-1422.657) [-1422.810] (-1422.708) * [-1424.156] (-1422.821) (-1425.281) (-1422.245) -- 0:01:00
155000 -- [-1423.334] (-1427.390) (-1426.351) (-1424.724) * [-1422.305] (-1422.113) (-1421.363) (-1426.883) -- 0:00:59
Average standard deviation of split frequencies: 0.020313
155500 -- (-1420.200) (-1422.924) [-1422.641] (-1423.073) * (-1423.222) (-1428.676) [-1423.426] (-1425.151) -- 0:00:59
156000 -- (-1420.805) [-1422.765] (-1421.570) (-1423.260) * (-1425.060) (-1426.009) [-1422.219] (-1424.009) -- 0:00:59
156500 -- (-1419.927) [-1421.689] (-1421.648) (-1428.485) * (-1422.132) (-1423.760) (-1421.723) [-1423.952] -- 0:00:59
157000 -- (-1425.780) (-1422.831) (-1420.051) [-1422.402] * (-1420.970) [-1420.278] (-1424.852) (-1423.100) -- 0:00:59
157500 -- [-1422.469] (-1421.706) (-1418.863) (-1420.691) * [-1421.737] (-1424.495) (-1424.038) (-1420.888) -- 0:00:58
158000 -- (-1424.334) (-1422.859) [-1419.154] (-1422.892) * (-1425.673) (-1423.708) (-1422.816) [-1420.932] -- 0:00:58
158500 -- (-1423.730) (-1421.400) [-1421.428] (-1420.818) * (-1424.111) (-1421.765) (-1423.824) [-1422.883] -- 0:00:58
159000 -- (-1427.696) [-1421.224] (-1420.952) (-1420.510) * (-1425.261) [-1421.729] (-1421.972) (-1420.020) -- 0:00:58
159500 -- [-1420.014] (-1421.012) (-1423.104) (-1427.058) * [-1425.605] (-1422.511) (-1424.228) (-1422.428) -- 0:00:57
160000 -- (-1423.816) (-1421.717) [-1423.469] (-1423.342) * (-1425.970) (-1423.754) (-1423.620) [-1422.052] -- 0:00:57
Average standard deviation of split frequencies: 0.019560
160500 -- (-1422.413) (-1421.679) [-1421.498] (-1424.887) * (-1421.913) (-1421.568) [-1425.307] (-1420.422) -- 0:00:57
161000 -- (-1421.920) (-1420.878) [-1421.642] (-1420.526) * (-1423.755) (-1424.332) [-1425.049] (-1421.300) -- 0:00:57
161500 -- (-1421.047) (-1422.738) (-1420.391) [-1420.604] * [-1421.939] (-1425.250) (-1427.961) (-1422.941) -- 0:00:57
162000 -- (-1422.212) [-1421.620] (-1422.668) (-1420.453) * [-1420.350] (-1431.126) (-1422.998) (-1423.630) -- 0:00:56
162500 -- (-1424.388) [-1423.658] (-1420.027) (-1420.745) * [-1421.271] (-1422.270) (-1420.530) (-1420.839) -- 0:00:56
163000 -- (-1420.783) (-1420.142) (-1422.400) [-1421.824] * [-1424.005] (-1423.568) (-1424.442) (-1422.106) -- 0:00:56
163500 -- [-1420.629] (-1421.162) (-1422.479) (-1418.484) * [-1422.446] (-1422.859) (-1424.915) (-1421.788) -- 0:00:56
164000 -- (-1421.457) (-1421.553) (-1422.135) [-1421.506] * [-1423.373] (-1420.205) (-1422.558) (-1423.720) -- 0:00:56
164500 -- [-1422.378] (-1422.070) (-1421.267) (-1419.823) * [-1422.559] (-1420.631) (-1424.230) (-1423.014) -- 0:00:55
165000 -- (-1424.364) [-1422.691] (-1422.354) (-1420.418) * (-1430.037) [-1421.409] (-1423.296) (-1423.922) -- 0:00:55
Average standard deviation of split frequencies: 0.019405
165500 -- [-1422.221] (-1419.722) (-1422.998) (-1418.649) * (-1426.843) [-1419.957] (-1423.246) (-1424.563) -- 0:00:55
166000 -- (-1422.208) (-1422.032) (-1422.375) [-1422.411] * (-1425.470) (-1422.348) (-1422.831) [-1425.697] -- 0:00:55
166500 -- (-1422.009) [-1421.290] (-1423.191) (-1420.061) * (-1426.291) (-1424.116) [-1422.051] (-1419.700) -- 0:01:00
167000 -- (-1421.640) [-1421.194] (-1422.994) (-1421.534) * (-1424.051) [-1424.388] (-1422.300) (-1421.243) -- 0:00:59
167500 -- (-1421.926) [-1423.632] (-1423.106) (-1419.930) * [-1424.013] (-1421.782) (-1421.490) (-1425.627) -- 0:00:59
168000 -- [-1422.038] (-1425.351) (-1421.864) (-1420.549) * [-1420.433] (-1421.701) (-1422.829) (-1422.798) -- 0:00:59
168500 -- (-1430.967) [-1421.046] (-1419.158) (-1423.325) * (-1422.470) (-1424.704) (-1424.119) [-1421.910] -- 0:00:59
169000 -- (-1422.576) (-1422.412) [-1421.255] (-1423.764) * (-1422.168) [-1420.225] (-1424.890) (-1421.692) -- 0:00:59
169500 -- (-1423.152) (-1421.394) [-1423.029] (-1422.178) * (-1424.759) (-1421.175) (-1425.981) [-1421.275] -- 0:00:58
170000 -- (-1422.746) (-1422.276) (-1422.545) [-1422.082] * (-1423.650) (-1425.103) (-1421.201) [-1421.216] -- 0:00:58
Average standard deviation of split frequencies: 0.019181
170500 -- (-1425.894) [-1421.107] (-1425.428) (-1419.421) * (-1428.261) (-1423.011) [-1419.657] (-1418.958) -- 0:00:58
171000 -- (-1424.236) (-1420.092) [-1421.952] (-1423.721) * (-1422.750) (-1425.067) (-1421.829) [-1420.164] -- 0:00:58
171500 -- (-1423.032) [-1422.392] (-1426.387) (-1428.191) * [-1421.889] (-1423.788) (-1426.351) (-1422.154) -- 0:00:57
172000 -- [-1423.788] (-1421.851) (-1423.067) (-1421.816) * (-1423.563) (-1422.076) (-1423.118) [-1421.735] -- 0:00:57
172500 -- (-1423.286) [-1422.868] (-1423.123) (-1421.599) * [-1421.905] (-1422.181) (-1424.362) (-1421.952) -- 0:00:57
173000 -- (-1423.833) [-1420.653] (-1423.264) (-1423.593) * (-1423.889) (-1421.620) [-1423.162] (-1423.368) -- 0:00:57
173500 -- [-1420.453] (-1424.671) (-1422.166) (-1422.393) * (-1424.916) (-1421.331) [-1420.126] (-1421.774) -- 0:00:57
174000 -- (-1421.174) [-1422.204] (-1421.728) (-1422.435) * (-1421.445) (-1421.355) [-1424.477] (-1423.959) -- 0:00:56
174500 -- (-1422.892) [-1419.629] (-1420.998) (-1418.836) * [-1420.088] (-1422.265) (-1427.439) (-1421.949) -- 0:00:56
175000 -- (-1421.428) [-1420.683] (-1424.390) (-1419.811) * (-1421.739) (-1423.959) (-1422.877) [-1425.905] -- 0:00:56
Average standard deviation of split frequencies: 0.018467
175500 -- (-1424.454) (-1422.270) (-1421.135) [-1420.411] * (-1426.533) [-1423.236] (-1422.723) (-1423.746) -- 0:00:56
176000 -- (-1426.141) (-1426.012) [-1421.920] (-1421.807) * [-1422.505] (-1422.462) (-1422.257) (-1421.667) -- 0:00:56
176500 -- (-1421.407) (-1421.778) (-1422.203) [-1421.713] * (-1425.673) (-1425.515) [-1424.647] (-1422.852) -- 0:00:55
177000 -- (-1421.078) (-1424.880) (-1424.422) [-1421.884] * (-1424.242) (-1422.869) (-1426.441) [-1423.003] -- 0:00:55
177500 -- (-1422.004) (-1424.644) [-1424.753] (-1421.514) * (-1423.654) (-1424.147) (-1422.427) [-1419.206] -- 0:00:55
178000 -- (-1422.822) (-1420.098) (-1424.533) [-1420.784] * [-1422.540] (-1427.300) (-1422.012) (-1423.819) -- 0:00:55
178500 -- (-1423.921) (-1422.767) [-1424.072] (-1424.922) * (-1423.433) (-1426.292) (-1426.250) [-1421.250] -- 0:00:55
179000 -- (-1424.462) [-1421.167] (-1421.791) (-1419.656) * (-1422.139) (-1421.644) [-1422.271] (-1423.688) -- 0:00:55
179500 -- (-1420.826) (-1421.446) (-1421.907) [-1419.641] * (-1422.032) (-1420.777) (-1425.008) [-1418.780] -- 0:00:54
180000 -- (-1422.489) [-1422.325] (-1422.924) (-1419.714) * (-1422.400) (-1424.630) (-1422.873) [-1421.554] -- 0:00:54
Average standard deviation of split frequencies: 0.016891
180500 -- (-1422.305) [-1419.246] (-1421.546) (-1421.482) * [-1421.738] (-1423.551) (-1423.800) (-1421.926) -- 0:00:59
181000 -- [-1420.355] (-1420.618) (-1421.295) (-1421.550) * (-1423.158) (-1422.192) [-1422.932] (-1421.980) -- 0:00:58
181500 -- [-1421.945] (-1420.954) (-1422.869) (-1422.509) * (-1425.170) (-1422.998) [-1422.521] (-1425.100) -- 0:00:58
182000 -- (-1423.834) (-1420.657) (-1421.982) [-1421.492] * (-1425.325) (-1421.574) [-1419.635] (-1424.262) -- 0:00:58
182500 -- (-1424.755) (-1425.871) [-1420.388] (-1421.552) * (-1424.401) [-1423.444] (-1422.702) (-1425.597) -- 0:00:58
183000 -- (-1426.188) (-1428.452) [-1420.106] (-1422.345) * (-1427.112) (-1424.949) (-1420.127) [-1423.128] -- 0:00:58
183500 -- (-1424.069) [-1424.035] (-1420.177) (-1425.227) * (-1421.548) [-1421.904] (-1424.544) (-1422.994) -- 0:00:57
184000 -- (-1422.621) (-1423.841) [-1422.912] (-1422.323) * [-1422.680] (-1419.335) (-1422.588) (-1424.106) -- 0:00:57
184500 -- (-1422.524) (-1426.755) (-1420.612) [-1420.300] * (-1425.954) (-1421.314) (-1424.955) [-1423.626] -- 0:00:57
185000 -- (-1425.521) (-1423.970) (-1426.367) [-1421.472] * [-1425.327] (-1423.762) (-1424.915) (-1425.971) -- 0:00:57
Average standard deviation of split frequencies: 0.016274
185500 -- (-1423.729) (-1423.579) (-1425.568) [-1421.490] * (-1424.131) (-1421.764) (-1423.760) [-1424.086] -- 0:00:57
186000 -- [-1424.428] (-1423.691) (-1425.352) (-1420.294) * (-1418.810) (-1422.491) (-1431.892) [-1424.429] -- 0:00:56
186500 -- (-1420.369) (-1422.150) (-1420.448) [-1419.452] * (-1422.677) (-1420.794) (-1423.362) [-1422.758] -- 0:00:56
187000 -- (-1421.380) (-1424.449) (-1420.938) [-1421.257] * [-1425.430] (-1428.454) (-1422.525) (-1423.662) -- 0:00:56
187500 -- (-1421.251) (-1428.272) [-1419.907] (-1420.883) * (-1425.930) (-1433.784) [-1423.806] (-1423.088) -- 0:00:56
188000 -- (-1420.593) (-1428.163) (-1422.076) [-1421.150] * [-1421.933] (-1422.890) (-1422.356) (-1425.466) -- 0:00:56
188500 -- [-1421.516] (-1425.854) (-1422.359) (-1419.785) * (-1419.115) (-1426.087) [-1425.257] (-1428.524) -- 0:00:55
189000 -- (-1423.650) (-1421.281) (-1420.121) [-1419.199] * (-1420.024) (-1424.674) (-1426.132) [-1423.640] -- 0:00:55
189500 -- (-1424.478) (-1420.896) [-1420.148] (-1422.579) * [-1420.980] (-1424.162) (-1422.159) (-1425.377) -- 0:00:55
190000 -- (-1425.288) (-1424.404) [-1421.096] (-1428.807) * [-1420.473] (-1426.518) (-1422.105) (-1422.422) -- 0:00:55
Average standard deviation of split frequencies: 0.014834
190500 -- (-1421.267) (-1420.990) (-1420.988) [-1419.758] * [-1420.974] (-1422.861) (-1423.108) (-1420.604) -- 0:00:55
191000 -- (-1422.963) [-1422.940] (-1422.501) (-1422.224) * [-1421.677] (-1423.512) (-1422.010) (-1420.460) -- 0:00:55
191500 -- [-1426.303] (-1422.972) (-1419.123) (-1425.046) * (-1423.189) (-1425.899) (-1428.490) [-1422.118] -- 0:00:54
192000 -- (-1421.714) (-1421.708) (-1420.032) [-1422.320] * [-1420.956] (-1422.505) (-1421.483) (-1422.212) -- 0:00:54
192500 -- (-1420.901) [-1424.434] (-1420.667) (-1424.097) * (-1420.890) [-1420.863] (-1419.237) (-1423.205) -- 0:00:54
193000 -- [-1424.507] (-1422.874) (-1420.991) (-1423.260) * (-1420.471) [-1425.714] (-1419.683) (-1423.408) -- 0:00:54
193500 -- [-1422.114] (-1421.037) (-1423.098) (-1421.107) * (-1421.607) (-1422.058) [-1421.153] (-1422.492) -- 0:00:54
194000 -- (-1421.316) (-1419.939) [-1422.577] (-1421.203) * (-1422.304) [-1423.695] (-1424.191) (-1428.379) -- 0:00:54
194500 -- [-1421.459] (-1422.337) (-1423.267) (-1421.096) * (-1420.731) (-1423.343) (-1425.246) [-1422.002] -- 0:00:53
195000 -- [-1422.646] (-1421.726) (-1429.331) (-1424.155) * [-1420.888] (-1423.302) (-1423.322) (-1422.007) -- 0:00:57
Average standard deviation of split frequencies: 0.014684
195500 -- [-1420.316] (-1420.918) (-1423.746) (-1420.892) * [-1422.491] (-1419.900) (-1421.158) (-1421.254) -- 0:00:57
196000 -- (-1422.997) [-1420.850] (-1421.865) (-1422.712) * (-1421.379) [-1419.761] (-1422.716) (-1422.989) -- 0:00:57
196500 -- (-1422.489) (-1422.842) [-1420.924] (-1422.919) * (-1421.788) (-1419.327) [-1420.947] (-1424.339) -- 0:00:57
197000 -- (-1422.841) (-1424.044) [-1421.010] (-1420.074) * [-1420.883] (-1422.651) (-1420.370) (-1425.523) -- 0:00:57
197500 -- [-1421.765] (-1420.965) (-1424.094) (-1422.630) * (-1421.101) (-1422.205) (-1421.166) [-1423.828] -- 0:00:56
198000 -- (-1423.542) [-1421.832] (-1420.915) (-1423.328) * (-1420.139) (-1421.909) (-1423.319) [-1421.413] -- 0:00:56
198500 -- (-1424.146) (-1420.804) (-1420.968) [-1427.919] * (-1422.499) (-1420.395) [-1422.840] (-1421.121) -- 0:00:56
199000 -- [-1424.585] (-1423.898) (-1422.806) (-1423.675) * [-1420.510] (-1422.665) (-1421.648) (-1422.381) -- 0:00:56
199500 -- [-1422.141] (-1425.192) (-1425.210) (-1424.356) * (-1421.845) [-1421.268] (-1420.588) (-1421.669) -- 0:00:56
200000 -- (-1421.795) (-1423.012) [-1423.480] (-1425.938) * (-1424.202) (-1423.526) (-1421.192) [-1423.199] -- 0:00:55
Average standard deviation of split frequencies: 0.014917
200500 -- [-1423.456] (-1421.045) (-1422.272) (-1427.645) * (-1423.805) (-1425.414) (-1423.789) [-1423.970] -- 0:00:55
201000 -- (-1422.303) (-1423.576) [-1419.778] (-1430.095) * (-1427.194) (-1427.488) [-1422.313] (-1426.642) -- 0:00:55
201500 -- [-1421.661] (-1423.016) (-1420.347) (-1423.219) * (-1420.066) (-1426.129) (-1422.458) [-1424.247] -- 0:00:55
202000 -- (-1422.158) (-1424.754) [-1421.329] (-1422.434) * [-1421.291] (-1423.010) (-1421.425) (-1422.550) -- 0:00:55
202500 -- (-1424.466) (-1422.408) [-1422.719] (-1422.572) * [-1419.532] (-1423.141) (-1419.447) (-1421.604) -- 0:00:55
203000 -- (-1424.312) [-1422.785] (-1421.667) (-1421.418) * (-1421.872) [-1422.546] (-1419.834) (-1423.016) -- 0:00:54
203500 -- (-1425.575) (-1424.537) [-1420.276] (-1421.673) * [-1421.705] (-1422.388) (-1422.367) (-1423.297) -- 0:00:54
204000 -- (-1420.899) [-1423.187] (-1420.825) (-1424.633) * (-1425.204) [-1425.960] (-1422.138) (-1422.393) -- 0:00:54
204500 -- [-1422.678] (-1423.597) (-1421.485) (-1423.146) * (-1420.770) (-1425.072) (-1424.998) [-1422.189] -- 0:00:54
205000 -- (-1422.628) (-1422.716) [-1422.765] (-1422.615) * (-1420.790) (-1423.675) (-1422.672) [-1423.715] -- 0:00:54
Average standard deviation of split frequencies: 0.015474
205500 -- (-1424.501) [-1422.651] (-1429.484) (-1422.610) * (-1420.052) (-1421.968) [-1419.033] (-1422.796) -- 0:00:54
206000 -- (-1423.991) (-1424.339) (-1427.722) [-1421.899] * (-1420.715) [-1421.415] (-1420.771) (-1422.743) -- 0:00:53
206500 -- [-1424.990] (-1425.438) (-1422.622) (-1422.697) * (-1422.483) (-1421.667) (-1420.167) [-1421.121] -- 0:00:53
207000 -- [-1421.810] (-1426.838) (-1422.527) (-1423.630) * (-1424.243) (-1421.570) [-1421.190] (-1420.753) -- 0:00:53
207500 -- (-1427.970) (-1423.197) (-1422.670) [-1423.304] * (-1421.182) (-1429.654) (-1424.670) [-1419.464] -- 0:00:53
208000 -- (-1421.480) [-1420.095] (-1422.030) (-1423.221) * [-1419.844] (-1421.575) (-1425.174) (-1423.909) -- 0:00:53
208500 -- (-1426.547) (-1422.253) (-1421.166) [-1420.598] * (-1421.685) (-1421.769) (-1423.901) [-1423.611] -- 0:00:53
209000 -- (-1422.177) (-1421.455) [-1421.562] (-1422.788) * (-1426.195) [-1421.502] (-1422.510) (-1424.660) -- 0:00:52
209500 -- (-1424.322) (-1421.484) (-1421.317) [-1422.712] * (-1423.493) [-1420.586] (-1423.035) (-1420.447) -- 0:00:56
210000 -- [-1423.311] (-1421.521) (-1425.649) (-1420.158) * (-1427.806) [-1419.759] (-1422.369) (-1421.532) -- 0:00:56
Average standard deviation of split frequencies: 0.015216
210500 -- (-1421.054) (-1420.588) [-1424.551] (-1422.073) * (-1419.364) [-1420.769] (-1422.802) (-1422.870) -- 0:00:56
211000 -- [-1420.410] (-1420.644) (-1423.305) (-1420.540) * (-1420.343) (-1419.992) [-1424.007] (-1422.591) -- 0:00:56
211500 -- (-1423.902) (-1423.251) [-1423.424] (-1419.748) * (-1420.685) [-1420.380] (-1423.530) (-1423.823) -- 0:00:55
212000 -- (-1421.447) (-1424.837) (-1421.701) [-1422.515] * (-1421.507) [-1420.148] (-1420.867) (-1421.885) -- 0:00:55
212500 -- [-1421.112] (-1425.201) (-1424.485) (-1421.203) * [-1421.718] (-1422.400) (-1421.239) (-1419.301) -- 0:00:55
213000 -- (-1420.966) (-1425.898) (-1424.591) [-1421.084] * (-1422.062) (-1425.160) (-1423.215) [-1419.858] -- 0:00:55
213500 -- (-1421.485) [-1420.560] (-1420.844) (-1422.356) * (-1419.417) (-1422.611) (-1419.720) [-1421.241] -- 0:00:55
214000 -- (-1421.017) [-1423.726] (-1422.428) (-1425.422) * [-1420.396] (-1424.544) (-1422.160) (-1419.615) -- 0:00:55
214500 -- (-1423.773) (-1426.102) [-1422.312] (-1425.723) * (-1420.792) [-1424.220] (-1419.335) (-1425.438) -- 0:00:54
215000 -- (-1425.155) [-1420.789] (-1422.636) (-1423.330) * (-1418.622) (-1421.695) [-1422.672] (-1424.557) -- 0:00:54
Average standard deviation of split frequencies: 0.014588
215500 -- [-1423.225] (-1421.511) (-1421.808) (-1420.112) * (-1419.120) [-1420.064] (-1424.000) (-1426.115) -- 0:00:54
216000 -- (-1425.241) (-1424.351) [-1422.650] (-1422.781) * (-1421.792) (-1420.979) (-1429.549) [-1423.226] -- 0:00:54
216500 -- (-1425.408) (-1423.861) (-1424.129) [-1420.634] * (-1419.985) [-1421.904] (-1426.313) (-1422.082) -- 0:00:54
217000 -- (-1424.613) [-1421.483] (-1424.168) (-1421.390) * [-1423.467] (-1422.273) (-1424.887) (-1421.780) -- 0:00:54
217500 -- (-1422.439) (-1420.908) (-1427.138) [-1421.060] * (-1423.162) [-1421.464] (-1423.361) (-1423.151) -- 0:00:53
218000 -- (-1423.172) [-1422.605] (-1423.686) (-1419.601) * [-1424.009] (-1421.612) (-1419.688) (-1423.844) -- 0:00:53
218500 -- (-1421.001) (-1422.362) [-1421.583] (-1423.875) * (-1420.421) (-1421.442) [-1420.663] (-1422.951) -- 0:00:53
219000 -- [-1422.354] (-1428.826) (-1423.059) (-1424.977) * (-1421.045) [-1422.621] (-1420.539) (-1422.922) -- 0:00:53
219500 -- (-1421.065) (-1425.598) [-1421.596] (-1423.341) * [-1419.538] (-1422.359) (-1418.268) (-1424.327) -- 0:00:53
220000 -- (-1423.125) (-1423.254) [-1420.413] (-1423.760) * [-1421.111] (-1422.352) (-1418.803) (-1422.141) -- 0:00:53
Average standard deviation of split frequencies: 0.015915
220500 -- (-1429.121) (-1430.049) (-1421.410) [-1420.872] * (-1419.470) [-1420.971] (-1418.471) (-1422.136) -- 0:00:53
221000 -- [-1423.338] (-1421.461) (-1421.513) (-1422.005) * (-1420.450) [-1420.604] (-1427.619) (-1422.899) -- 0:00:52
221500 -- [-1424.850] (-1421.899) (-1422.996) (-1422.411) * [-1422.627] (-1422.066) (-1431.713) (-1421.184) -- 0:00:52
222000 -- (-1420.874) (-1421.112) [-1421.225] (-1424.606) * (-1424.228) [-1420.403] (-1428.051) (-1424.162) -- 0:00:52
222500 -- (-1422.526) (-1424.109) (-1421.047) [-1422.523] * (-1421.815) [-1418.966] (-1426.077) (-1421.707) -- 0:00:52
223000 -- [-1422.375] (-1424.520) (-1421.025) (-1421.556) * (-1421.625) [-1423.150] (-1422.497) (-1420.576) -- 0:00:52
223500 -- (-1425.674) (-1428.192) [-1421.547] (-1421.704) * [-1421.523] (-1422.100) (-1422.890) (-1421.237) -- 0:00:52
224000 -- (-1421.999) (-1425.282) [-1423.391] (-1424.284) * (-1420.590) (-1422.873) (-1422.197) [-1420.867] -- 0:00:55
224500 -- [-1423.203] (-1426.046) (-1420.765) (-1422.712) * (-1427.247) (-1423.213) (-1421.114) [-1422.578] -- 0:00:55
225000 -- (-1421.849) (-1422.753) [-1422.318] (-1425.647) * (-1422.537) (-1423.233) [-1424.167] (-1422.310) -- 0:00:55
Average standard deviation of split frequencies: 0.015748
225500 -- [-1420.029] (-1423.960) (-1422.188) (-1423.869) * (-1421.705) [-1420.357] (-1422.459) (-1422.077) -- 0:00:54
226000 -- [-1422.560] (-1422.099) (-1420.751) (-1422.893) * [-1420.201] (-1422.372) (-1423.274) (-1422.804) -- 0:00:54
226500 -- (-1422.856) (-1421.841) [-1420.297] (-1422.501) * (-1419.980) (-1423.341) [-1420.460] (-1425.347) -- 0:00:54
227000 -- (-1421.955) [-1422.093] (-1425.343) (-1422.900) * [-1420.998] (-1422.188) (-1424.887) (-1423.020) -- 0:00:54
227500 -- [-1422.625] (-1419.845) (-1421.859) (-1424.162) * [-1419.357] (-1422.759) (-1421.318) (-1419.717) -- 0:00:54
228000 -- (-1422.836) (-1421.353) (-1422.302) [-1422.379] * (-1419.458) (-1423.268) (-1424.792) [-1423.585] -- 0:00:54
228500 -- (-1425.690) (-1420.809) [-1421.642] (-1424.917) * (-1425.072) (-1424.755) (-1420.691) [-1425.987] -- 0:00:54
229000 -- [-1424.475] (-1432.492) (-1420.220) (-1423.993) * (-1424.951) (-1423.623) [-1422.901] (-1423.397) -- 0:00:53
229500 -- (-1424.422) (-1424.901) (-1420.433) [-1421.881] * (-1423.601) (-1422.988) [-1424.072] (-1430.467) -- 0:00:53
230000 -- (-1421.212) (-1422.466) (-1419.463) [-1422.612] * (-1424.521) [-1422.548] (-1424.140) (-1422.222) -- 0:00:53
Average standard deviation of split frequencies: 0.015327
230500 -- (-1423.290) (-1421.730) [-1421.810] (-1423.043) * [-1422.264] (-1423.596) (-1428.316) (-1425.953) -- 0:00:53
231000 -- [-1419.824] (-1422.942) (-1420.622) (-1423.399) * [-1422.175] (-1423.054) (-1422.819) (-1426.053) -- 0:00:53
231500 -- (-1420.195) [-1421.852] (-1420.731) (-1425.403) * [-1421.472] (-1422.548) (-1427.534) (-1422.404) -- 0:00:53
232000 -- (-1422.064) (-1422.697) (-1421.924) [-1425.732] * [-1419.461] (-1424.377) (-1421.362) (-1425.260) -- 0:00:52
232500 -- (-1425.057) [-1422.870] (-1422.096) (-1425.577) * (-1424.021) (-1426.104) (-1425.152) [-1423.158] -- 0:00:52
233000 -- (-1424.955) (-1422.166) [-1422.424] (-1427.830) * (-1422.665) (-1422.198) (-1423.436) [-1422.276] -- 0:00:52
233500 -- (-1422.720) [-1420.981] (-1420.563) (-1425.479) * (-1421.333) (-1422.335) (-1422.745) [-1421.678] -- 0:00:52
234000 -- (-1421.437) (-1430.784) [-1421.110] (-1424.449) * (-1421.814) (-1423.496) (-1421.742) [-1422.493] -- 0:00:52
234500 -- (-1425.471) (-1428.170) (-1424.004) [-1423.474] * [-1421.413] (-1422.727) (-1422.256) (-1422.674) -- 0:00:52
235000 -- (-1422.379) [-1423.801] (-1424.204) (-1421.881) * (-1421.566) (-1422.411) [-1421.664] (-1423.304) -- 0:00:52
Average standard deviation of split frequencies: 0.014929
235500 -- [-1421.827] (-1422.102) (-1422.946) (-1424.012) * (-1422.304) (-1425.820) [-1422.598] (-1422.293) -- 0:00:51
236000 -- (-1422.422) (-1420.384) [-1421.794] (-1427.460) * (-1421.301) [-1422.554] (-1424.321) (-1422.716) -- 0:00:51
236500 -- (-1419.617) [-1423.213] (-1422.292) (-1421.449) * (-1422.248) [-1421.330] (-1424.311) (-1422.139) -- 0:00:51
237000 -- (-1420.925) [-1422.876] (-1428.177) (-1420.845) * (-1422.570) [-1421.662] (-1420.677) (-1423.895) -- 0:00:51
237500 -- (-1425.801) (-1421.961) (-1422.919) [-1420.829] * [-1420.297] (-1424.391) (-1423.272) (-1425.078) -- 0:00:51
238000 -- (-1419.532) (-1421.376) (-1427.001) [-1421.693] * (-1419.106) [-1424.142] (-1422.053) (-1421.721) -- 0:00:54
238500 -- (-1421.434) (-1424.034) (-1419.077) [-1420.476] * (-1420.105) [-1421.911] (-1421.815) (-1421.385) -- 0:00:54
239000 -- [-1421.938] (-1423.342) (-1421.674) (-1421.499) * (-1422.018) [-1422.170] (-1424.458) (-1423.790) -- 0:00:54
239500 -- (-1423.922) [-1422.899] (-1420.471) (-1421.113) * (-1421.673) [-1419.763] (-1422.188) (-1420.206) -- 0:00:53
240000 -- (-1422.981) [-1424.153] (-1419.856) (-1423.830) * [-1420.385] (-1425.465) (-1422.571) (-1421.604) -- 0:00:53
Average standard deviation of split frequencies: 0.016804
240500 -- (-1425.155) (-1422.021) (-1419.897) [-1422.365] * (-1419.837) (-1424.929) [-1421.913] (-1421.361) -- 0:00:53
241000 -- (-1420.596) (-1426.292) [-1422.247] (-1422.036) * [-1424.226] (-1422.074) (-1422.812) (-1421.194) -- 0:00:53
241500 -- (-1421.805) (-1426.018) [-1418.886] (-1422.982) * [-1422.249] (-1428.190) (-1420.913) (-1422.276) -- 0:00:53
242000 -- (-1420.768) (-1425.617) (-1422.985) [-1423.040] * (-1418.641) (-1424.210) [-1420.610] (-1421.751) -- 0:00:53
242500 -- [-1425.377] (-1424.147) (-1426.810) (-1422.509) * (-1420.644) (-1424.475) (-1427.100) [-1422.385] -- 0:00:53
243000 -- [-1422.872] (-1421.681) (-1425.266) (-1421.138) * [-1420.155] (-1427.607) (-1422.916) (-1422.298) -- 0:00:52
243500 -- (-1419.582) (-1423.603) (-1422.224) [-1421.250] * (-1420.295) (-1423.898) (-1425.081) [-1421.413] -- 0:00:52
244000 -- [-1421.598] (-1423.230) (-1422.325) (-1418.930) * (-1421.798) (-1424.969) [-1422.768] (-1420.455) -- 0:00:52
244500 -- (-1422.082) (-1421.161) [-1420.870] (-1422.179) * (-1421.086) (-1423.562) (-1424.300) [-1422.716] -- 0:00:52
245000 -- (-1424.102) (-1422.789) (-1424.710) [-1421.957] * [-1420.425] (-1423.865) (-1423.036) (-1423.475) -- 0:00:52
Average standard deviation of split frequencies: 0.016097
245500 -- (-1425.764) (-1422.101) [-1422.452] (-1424.767) * (-1422.127) (-1427.353) (-1421.780) [-1420.785] -- 0:00:52
246000 -- (-1426.552) [-1421.967] (-1423.576) (-1420.560) * (-1424.487) (-1425.225) [-1424.119] (-1422.650) -- 0:00:52
246500 -- [-1420.889] (-1421.825) (-1423.575) (-1420.869) * (-1422.523) (-1425.996) [-1421.436] (-1424.508) -- 0:00:51
247000 -- [-1420.484] (-1421.411) (-1423.710) (-1425.512) * (-1419.602) (-1425.795) (-1421.448) [-1421.875] -- 0:00:51
247500 -- [-1420.985] (-1425.100) (-1421.940) (-1421.779) * [-1419.002] (-1425.124) (-1421.706) (-1422.548) -- 0:00:51
248000 -- (-1419.363) (-1423.279) [-1420.240] (-1423.503) * [-1422.396] (-1424.031) (-1422.324) (-1421.718) -- 0:00:51
248500 -- (-1423.039) (-1422.627) (-1421.342) [-1423.422] * [-1420.815] (-1429.542) (-1422.288) (-1422.661) -- 0:00:51
249000 -- (-1424.416) [-1419.712] (-1421.998) (-1424.061) * (-1422.914) (-1425.549) (-1423.367) [-1420.856] -- 0:00:51
249500 -- (-1425.825) (-1425.105) (-1423.257) [-1422.207] * [-1423.606] (-1423.135) (-1420.988) (-1419.853) -- 0:00:51
250000 -- (-1422.341) (-1425.241) (-1422.603) [-1423.443] * (-1421.307) (-1421.520) (-1421.991) [-1420.917] -- 0:00:51
Average standard deviation of split frequencies: 0.018336
250500 -- [-1418.468] (-1421.791) (-1421.933) (-1424.564) * [-1422.071] (-1421.697) (-1422.543) (-1423.403) -- 0:00:50
251000 -- (-1420.489) (-1421.433) [-1420.322] (-1424.238) * (-1419.795) (-1423.749) [-1419.596] (-1423.614) -- 0:00:50
251500 -- (-1423.885) (-1421.757) (-1421.244) [-1422.958] * (-1421.258) [-1421.585] (-1423.195) (-1421.818) -- 0:00:50
252000 -- (-1420.807) (-1422.837) (-1420.599) [-1420.447] * (-1422.320) (-1422.606) (-1422.510) [-1424.186] -- 0:00:50
252500 -- [-1420.003] (-1422.299) (-1421.967) (-1422.331) * (-1423.081) (-1420.389) [-1422.959] (-1424.682) -- 0:00:50
253000 -- [-1422.561] (-1420.921) (-1427.624) (-1426.881) * (-1423.877) (-1420.343) [-1423.441] (-1425.672) -- 0:00:53
253500 -- (-1424.337) [-1422.281] (-1424.145) (-1422.047) * (-1421.370) (-1420.258) (-1423.284) [-1424.625] -- 0:00:53
254000 -- [-1425.291] (-1424.049) (-1423.091) (-1422.345) * (-1423.832) [-1423.458] (-1422.787) (-1419.498) -- 0:00:52
254500 -- (-1424.879) (-1427.078) [-1422.396] (-1420.440) * [-1423.018] (-1424.307) (-1425.493) (-1420.340) -- 0:00:52
255000 -- (-1421.554) (-1425.453) [-1422.158] (-1419.723) * [-1421.869] (-1425.707) (-1425.267) (-1419.268) -- 0:00:52
Average standard deviation of split frequencies: 0.017309
255500 -- (-1420.852) (-1423.991) (-1420.060) [-1420.372] * (-1422.653) (-1422.211) (-1422.659) [-1421.466] -- 0:00:52
256000 -- [-1420.845] (-1424.213) (-1423.421) (-1421.794) * (-1418.775) [-1422.196] (-1423.721) (-1421.374) -- 0:00:52
256500 -- [-1421.317] (-1424.487) (-1425.155) (-1420.578) * [-1421.074] (-1426.833) (-1423.984) (-1422.348) -- 0:00:52
257000 -- (-1421.726) [-1421.305] (-1424.328) (-1427.672) * (-1421.056) (-1431.403) [-1424.261] (-1420.569) -- 0:00:52
257500 -- (-1424.570) [-1422.382] (-1423.099) (-1420.338) * (-1423.020) [-1424.701] (-1425.717) (-1421.817) -- 0:00:51
258000 -- (-1420.453) [-1422.722] (-1422.482) (-1421.673) * (-1422.167) (-1424.597) (-1422.862) [-1421.674] -- 0:00:51
258500 -- (-1425.005) (-1433.926) (-1423.403) [-1420.163] * [-1421.685] (-1424.031) (-1420.512) (-1423.440) -- 0:00:51
259000 -- [-1420.924] (-1424.760) (-1421.145) (-1423.413) * [-1421.371] (-1424.440) (-1422.383) (-1423.454) -- 0:00:51
259500 -- (-1419.566) (-1423.009) (-1420.794) [-1422.293] * (-1421.281) [-1423.909] (-1425.286) (-1422.144) -- 0:00:51
260000 -- (-1420.982) (-1423.829) (-1419.927) [-1422.944] * [-1419.980] (-1424.510) (-1423.756) (-1421.242) -- 0:00:51
Average standard deviation of split frequencies: 0.017609
260500 -- [-1421.004] (-1422.521) (-1421.622) (-1424.933) * (-1421.178) (-1425.485) (-1422.657) [-1424.429] -- 0:00:51
261000 -- [-1420.631] (-1425.647) (-1422.555) (-1422.555) * [-1423.408] (-1421.722) (-1423.110) (-1421.909) -- 0:00:50
261500 -- (-1422.909) (-1425.330) [-1423.828] (-1424.415) * (-1419.861) (-1420.854) [-1422.800] (-1422.895) -- 0:00:50
262000 -- (-1422.364) (-1426.638) (-1422.810) [-1420.864] * (-1421.077) (-1421.999) (-1423.077) [-1424.313] -- 0:00:50
262500 -- (-1423.733) [-1422.503] (-1424.834) (-1421.950) * (-1423.158) (-1422.069) [-1420.846] (-1422.690) -- 0:00:50
263000 -- [-1420.052] (-1422.392) (-1423.315) (-1424.574) * [-1418.961] (-1421.488) (-1423.542) (-1422.104) -- 0:00:50
263500 -- (-1427.763) (-1425.021) (-1425.790) [-1422.264] * (-1420.493) (-1423.404) (-1422.688) [-1421.894] -- 0:00:50
264000 -- (-1423.382) (-1423.326) (-1423.327) [-1423.867] * (-1420.116) (-1424.716) (-1425.193) [-1423.228] -- 0:00:50
264500 -- [-1422.645] (-1423.944) (-1420.748) (-1424.216) * (-1422.830) [-1422.241] (-1420.268) (-1422.751) -- 0:00:50
265000 -- [-1422.498] (-1423.940) (-1423.055) (-1424.998) * [-1421.780] (-1421.782) (-1423.163) (-1425.626) -- 0:00:49
Average standard deviation of split frequencies: 0.015684
265500 -- (-1424.906) (-1422.021) [-1424.038] (-1426.659) * [-1420.063] (-1423.693) (-1422.500) (-1422.091) -- 0:00:49
266000 -- (-1423.472) [-1422.025] (-1423.947) (-1423.578) * (-1423.219) (-1421.223) [-1422.428] (-1422.088) -- 0:00:49
266500 -- (-1423.317) (-1423.022) [-1424.251] (-1422.431) * (-1423.472) [-1421.259] (-1422.350) (-1421.816) -- 0:00:49
267000 -- (-1426.666) (-1424.696) (-1423.343) [-1421.432] * [-1425.064] (-1423.795) (-1423.391) (-1427.773) -- 0:00:49
267500 -- (-1428.121) (-1424.729) [-1418.978] (-1422.566) * (-1422.794) (-1423.219) [-1424.063] (-1424.867) -- 0:00:49
268000 -- (-1425.615) (-1427.928) [-1421.541] (-1426.453) * (-1424.691) (-1425.617) (-1424.703) [-1422.746] -- 0:00:51
268500 -- (-1429.896) (-1426.930) [-1421.397] (-1421.040) * [-1420.165] (-1424.375) (-1421.607) (-1425.732) -- 0:00:51
269000 -- (-1424.828) (-1424.765) [-1422.460] (-1424.612) * (-1423.500) (-1423.902) [-1420.072] (-1420.612) -- 0:00:51
269500 -- (-1421.768) (-1425.407) (-1421.485) [-1425.803] * (-1423.205) [-1421.771] (-1420.319) (-1423.113) -- 0:00:51
270000 -- (-1422.304) (-1426.573) [-1421.644] (-1424.909) * (-1424.410) (-1421.501) [-1420.906] (-1426.626) -- 0:00:51
Average standard deviation of split frequencies: 0.017029
270500 -- (-1422.060) (-1425.976) (-1422.872) [-1421.826] * (-1423.543) (-1424.745) [-1422.876] (-1422.766) -- 0:00:51
271000 -- (-1423.520) (-1423.359) (-1424.486) [-1424.346] * (-1423.933) (-1421.605) (-1423.732) [-1424.687] -- 0:00:51
271500 -- [-1422.036] (-1428.571) (-1422.232) (-1424.317) * (-1421.281) [-1422.145] (-1423.755) (-1422.255) -- 0:00:50
272000 -- (-1421.882) [-1425.851] (-1423.157) (-1425.079) * (-1419.952) (-1422.997) [-1422.305] (-1420.658) -- 0:00:50
272500 -- (-1421.140) (-1425.047) (-1422.319) [-1422.562] * (-1422.797) (-1423.439) [-1422.303] (-1421.167) -- 0:00:50
273000 -- (-1424.538) (-1424.201) [-1421.128] (-1421.298) * (-1418.597) (-1423.604) [-1424.403] (-1423.586) -- 0:00:50
273500 -- (-1422.603) (-1422.524) [-1424.259] (-1423.883) * (-1422.902) (-1422.292) (-1421.030) [-1423.719] -- 0:00:50
274000 -- (-1422.922) (-1423.059) [-1422.288] (-1421.689) * (-1420.375) [-1423.392] (-1427.658) (-1423.409) -- 0:00:50
274500 -- (-1423.394) [-1422.111] (-1421.610) (-1423.937) * (-1422.834) (-1425.043) [-1428.125] (-1424.171) -- 0:00:50
275000 -- (-1425.293) (-1425.066) [-1423.370] (-1423.453) * (-1424.188) (-1421.883) [-1420.327] (-1425.232) -- 0:00:50
Average standard deviation of split frequencies: 0.015846
275500 -- [-1425.122] (-1424.289) (-1424.206) (-1419.587) * (-1421.686) (-1419.626) [-1423.921] (-1426.413) -- 0:00:49
276000 -- (-1423.302) [-1425.104] (-1427.777) (-1420.437) * (-1419.290) [-1420.800] (-1423.280) (-1424.913) -- 0:00:49
276500 -- (-1423.195) (-1424.179) [-1422.322] (-1422.499) * (-1422.064) [-1422.134] (-1422.204) (-1421.418) -- 0:00:49
277000 -- (-1423.638) (-1423.289) [-1419.292] (-1421.886) * [-1421.065] (-1421.001) (-1420.244) (-1421.120) -- 0:00:49
277500 -- (-1422.756) (-1422.168) [-1419.391] (-1420.828) * [-1422.343] (-1420.146) (-1421.157) (-1423.397) -- 0:00:49
278000 -- [-1423.061] (-1422.165) (-1420.249) (-1423.649) * (-1421.393) (-1424.774) (-1423.273) [-1421.140] -- 0:00:49
278500 -- [-1421.551] (-1422.427) (-1420.812) (-1423.349) * (-1421.423) (-1420.721) (-1424.108) [-1422.962] -- 0:00:49
279000 -- (-1423.695) (-1424.019) [-1426.373] (-1422.889) * (-1422.347) (-1424.450) (-1420.277) [-1426.071] -- 0:00:49
279500 -- (-1422.131) [-1423.112] (-1421.313) (-1422.056) * (-1421.238) [-1422.058] (-1420.027) (-1422.767) -- 0:00:48
280000 -- (-1423.893) (-1423.628) [-1420.357] (-1418.700) * [-1424.805] (-1421.729) (-1422.854) (-1424.479) -- 0:00:48
Average standard deviation of split frequencies: 0.014128
280500 -- (-1421.307) (-1425.739) [-1423.708] (-1425.208) * (-1428.663) [-1423.859] (-1419.775) (-1421.840) -- 0:00:48
281000 -- (-1421.020) [-1422.921] (-1423.998) (-1424.383) * [-1422.012] (-1422.685) (-1421.887) (-1423.882) -- 0:00:48
281500 -- [-1422.870] (-1422.926) (-1421.594) (-1421.440) * (-1423.517) (-1422.409) (-1422.960) [-1424.497] -- 0:00:48
282000 -- [-1422.851] (-1423.610) (-1421.445) (-1425.560) * (-1422.955) (-1422.638) (-1420.041) [-1422.556] -- 0:00:48
282500 -- [-1422.802] (-1421.649) (-1423.013) (-1418.918) * [-1422.279] (-1420.779) (-1421.483) (-1423.870) -- 0:00:50
283000 -- [-1423.800] (-1425.352) (-1423.150) (-1423.379) * (-1422.814) [-1420.724] (-1419.996) (-1420.762) -- 0:00:50
283500 -- (-1421.820) (-1422.824) [-1422.628] (-1420.360) * (-1421.783) (-1427.059) (-1420.548) [-1420.010] -- 0:00:50
284000 -- [-1422.550] (-1423.504) (-1425.756) (-1420.616) * (-1424.577) (-1424.130) [-1422.103] (-1422.780) -- 0:00:50
284500 -- (-1425.226) [-1422.016] (-1422.808) (-1420.978) * (-1422.833) (-1421.366) [-1421.712] (-1421.108) -- 0:00:50
285000 -- (-1423.687) [-1422.031] (-1422.725) (-1419.801) * (-1420.613) [-1422.224] (-1422.454) (-1422.091) -- 0:00:50
Average standard deviation of split frequencies: 0.014253
285500 -- [-1425.103] (-1422.526) (-1422.721) (-1422.053) * (-1421.148) (-1425.096) (-1422.774) [-1420.698] -- 0:00:50
286000 -- [-1422.287] (-1425.249) (-1424.045) (-1424.243) * (-1426.058) [-1422.725] (-1422.687) (-1420.270) -- 0:00:49
286500 -- (-1425.595) (-1422.980) [-1420.563] (-1424.409) * (-1422.832) (-1424.334) (-1425.352) [-1422.636] -- 0:00:49
287000 -- (-1422.497) (-1422.677) (-1422.315) [-1420.795] * (-1418.412) [-1421.835] (-1425.038) (-1424.992) -- 0:00:49
287500 -- (-1423.385) (-1423.140) [-1420.474] (-1421.042) * [-1422.687] (-1427.453) (-1423.565) (-1423.999) -- 0:00:49
288000 -- [-1423.896] (-1421.626) (-1424.439) (-1424.542) * (-1422.776) (-1420.592) (-1424.019) [-1422.498] -- 0:00:49
288500 -- [-1428.378] (-1422.839) (-1421.802) (-1421.423) * (-1419.957) [-1424.759] (-1423.227) (-1421.449) -- 0:00:49
289000 -- (-1422.311) (-1425.739) (-1421.490) [-1419.510] * [-1420.856] (-1422.916) (-1421.784) (-1425.882) -- 0:00:49
289500 -- (-1420.517) (-1423.057) (-1422.301) [-1418.392] * (-1419.105) (-1424.747) (-1421.051) [-1424.528] -- 0:00:49
290000 -- (-1421.570) (-1419.975) (-1420.777) [-1421.118] * (-1421.189) (-1420.514) [-1421.771] (-1419.539) -- 0:00:48
Average standard deviation of split frequencies: 0.013515
290500 -- [-1425.579] (-1423.103) (-1421.127) (-1423.106) * (-1422.186) (-1424.455) [-1420.986] (-1419.925) -- 0:00:48
291000 -- [-1422.050] (-1421.648) (-1423.956) (-1420.646) * (-1421.634) (-1421.233) (-1423.064) [-1420.876] -- 0:00:48
291500 -- [-1421.515] (-1422.371) (-1427.548) (-1421.334) * [-1420.327] (-1420.017) (-1420.586) (-1421.212) -- 0:00:48
292000 -- (-1426.792) (-1421.817) [-1422.560] (-1421.031) * [-1421.079] (-1426.071) (-1421.169) (-1422.370) -- 0:00:48
292500 -- (-1424.986) (-1422.291) [-1421.364] (-1422.905) * [-1420.506] (-1422.040) (-1420.945) (-1421.096) -- 0:00:48
293000 -- (-1423.552) (-1421.908) (-1426.737) [-1427.430] * [-1420.028] (-1421.955) (-1425.954) (-1421.292) -- 0:00:48
293500 -- (-1422.802) (-1422.292) [-1421.823] (-1423.082) * (-1420.323) (-1422.898) [-1425.748] (-1422.048) -- 0:00:48
294000 -- (-1422.919) (-1422.507) [-1423.685] (-1421.409) * (-1421.545) [-1421.706] (-1423.729) (-1422.823) -- 0:00:48
294500 -- [-1421.961] (-1422.241) (-1422.193) (-1420.147) * [-1420.349] (-1420.551) (-1421.946) (-1420.979) -- 0:00:47
295000 -- (-1420.017) (-1422.326) (-1422.139) [-1422.955] * [-1420.660] (-1420.455) (-1423.578) (-1426.741) -- 0:00:47
Average standard deviation of split frequencies: 0.012475
295500 -- (-1421.703) [-1422.388] (-1422.834) (-1422.750) * (-1421.548) (-1424.543) [-1427.508] (-1428.636) -- 0:00:47
296000 -- (-1422.594) (-1425.415) (-1424.011) [-1421.572] * (-1425.201) [-1419.513] (-1426.861) (-1422.584) -- 0:00:47
296500 -- (-1422.071) (-1421.216) [-1421.866] (-1422.495) * (-1421.055) (-1422.517) (-1423.480) [-1419.376] -- 0:00:47
297000 -- (-1425.043) (-1428.731) [-1421.499] (-1425.092) * (-1419.960) (-1421.843) (-1421.726) [-1419.719] -- 0:00:47
297500 -- [-1421.989] (-1422.295) (-1423.590) (-1424.978) * (-1419.608) [-1423.060] (-1422.492) (-1421.964) -- 0:00:49
298000 -- (-1420.951) (-1424.858) [-1421.809] (-1420.582) * (-1421.591) (-1422.714) (-1422.656) [-1423.462] -- 0:00:49
298500 -- (-1420.076) (-1423.449) [-1421.656] (-1420.817) * (-1421.419) (-1426.097) (-1424.028) [-1421.601] -- 0:00:49
299000 -- (-1421.985) (-1422.490) (-1421.277) [-1423.388] * (-1421.113) [-1421.598] (-1423.822) (-1423.567) -- 0:00:49
299500 -- [-1422.713] (-1426.041) (-1421.872) (-1423.283) * (-1421.390) (-1422.287) (-1423.612) [-1419.972] -- 0:00:49
300000 -- (-1422.339) (-1423.258) (-1425.855) [-1421.026] * (-1420.537) (-1423.755) (-1420.397) [-1421.331] -- 0:00:48
Average standard deviation of split frequencies: 0.012727
300500 -- (-1421.149) [-1420.575] (-1422.519) (-1422.065) * [-1419.813] (-1423.901) (-1422.686) (-1421.365) -- 0:00:48
301000 -- (-1422.889) (-1426.903) (-1423.535) [-1428.498] * (-1421.427) (-1425.174) (-1425.818) [-1421.909] -- 0:00:48
301500 -- (-1425.386) (-1425.791) (-1423.841) [-1422.985] * (-1425.634) [-1422.545] (-1423.641) (-1420.849) -- 0:00:48
302000 -- (-1424.678) (-1423.070) (-1423.137) [-1425.442] * [-1419.665] (-1421.851) (-1423.384) (-1419.970) -- 0:00:48
302500 -- [-1422.575] (-1421.776) (-1422.891) (-1422.171) * (-1422.708) [-1423.267] (-1422.370) (-1424.173) -- 0:00:48
303000 -- (-1421.184) [-1421.552] (-1422.138) (-1422.805) * (-1422.434) (-1425.022) [-1422.310] (-1420.761) -- 0:00:48
303500 -- (-1422.329) [-1420.558] (-1424.237) (-1421.631) * (-1426.042) (-1422.036) (-1419.006) [-1423.218] -- 0:00:48
304000 -- (-1427.978) (-1420.747) (-1424.275) [-1421.677] * (-1421.820) (-1421.984) [-1420.983] (-1421.472) -- 0:00:48
304500 -- (-1422.248) (-1422.839) [-1424.633] (-1422.194) * (-1421.664) (-1423.067) (-1421.813) [-1422.590] -- 0:00:47
305000 -- [-1424.672] (-1421.341) (-1422.957) (-1421.722) * [-1423.224] (-1422.707) (-1422.202) (-1420.757) -- 0:00:47
Average standard deviation of split frequencies: 0.012153
305500 -- (-1423.199) (-1421.703) (-1424.786) [-1420.719] * (-1422.300) [-1422.727] (-1419.246) (-1419.469) -- 0:00:47
306000 -- (-1422.349) (-1421.249) [-1420.719] (-1420.149) * (-1422.784) [-1422.684] (-1421.996) (-1420.030) -- 0:00:47
306500 -- [-1419.587] (-1419.559) (-1426.362) (-1421.288) * [-1422.659] (-1427.861) (-1422.497) (-1420.137) -- 0:00:47
307000 -- (-1425.576) (-1422.100) [-1427.351] (-1422.333) * (-1422.564) (-1425.574) (-1421.892) [-1422.443] -- 0:00:47
307500 -- (-1424.635) [-1421.428] (-1422.657) (-1424.262) * (-1421.085) (-1428.284) (-1420.636) [-1421.217] -- 0:00:47
308000 -- (-1423.707) [-1421.493] (-1422.973) (-1428.030) * (-1422.363) (-1425.857) [-1422.986] (-1424.019) -- 0:00:47
308500 -- (-1425.874) (-1422.892) (-1422.202) [-1421.966] * (-1420.371) (-1422.487) [-1420.385] (-1424.071) -- 0:00:47
309000 -- [-1421.268] (-1422.452) (-1423.845) (-1424.264) * [-1418.598] (-1421.515) (-1423.131) (-1421.169) -- 0:00:46
309500 -- (-1421.625) [-1422.604] (-1424.345) (-1422.131) * [-1419.210] (-1422.906) (-1420.136) (-1420.738) -- 0:00:46
310000 -- [-1422.262] (-1427.253) (-1424.839) (-1422.237) * [-1422.417] (-1420.848) (-1421.214) (-1422.310) -- 0:00:46
Average standard deviation of split frequencies: 0.011549
310500 -- (-1422.036) (-1424.483) [-1422.419] (-1423.742) * (-1421.290) [-1422.709] (-1425.694) (-1422.765) -- 0:00:46
311000 -- (-1420.666) (-1423.400) (-1420.238) [-1421.385] * (-1422.849) [-1427.338] (-1420.381) (-1426.516) -- 0:00:46
311500 -- (-1421.762) (-1422.231) (-1421.788) [-1420.377] * [-1421.767] (-1423.622) (-1421.415) (-1425.058) -- 0:00:46
312000 -- (-1422.033) [-1422.155] (-1424.055) (-1423.372) * [-1422.600] (-1423.400) (-1422.883) (-1427.070) -- 0:00:48
312500 -- [-1420.698] (-1422.220) (-1422.032) (-1420.351) * (-1421.745) (-1424.638) [-1423.115] (-1421.194) -- 0:00:48
313000 -- (-1422.551) (-1422.432) [-1423.564] (-1420.337) * (-1424.416) (-1424.045) [-1421.415] (-1421.687) -- 0:00:48
313500 -- (-1425.456) [-1422.333] (-1424.566) (-1422.316) * [-1422.478] (-1424.415) (-1422.860) (-1420.354) -- 0:00:48
314000 -- (-1422.794) [-1423.435] (-1425.895) (-1420.690) * (-1422.690) [-1420.157] (-1422.425) (-1421.201) -- 0:00:48
314500 -- (-1424.662) [-1424.353] (-1423.710) (-1422.462) * (-1421.554) (-1427.768) [-1421.270] (-1419.886) -- 0:00:47
315000 -- (-1423.159) [-1422.237] (-1423.524) (-1421.372) * (-1421.199) (-1427.943) [-1421.684] (-1423.820) -- 0:00:47
Average standard deviation of split frequencies: 0.010691
315500 -- (-1420.835) (-1425.379) (-1423.354) [-1420.779] * (-1425.027) [-1426.806] (-1424.962) (-1420.809) -- 0:00:47
316000 -- (-1425.741) (-1424.854) [-1423.452] (-1421.647) * (-1424.756) (-1422.671) (-1424.020) [-1422.525] -- 0:00:47
316500 -- (-1422.015) (-1419.836) (-1426.681) [-1425.609] * (-1424.453) (-1425.438) (-1420.176) [-1422.388] -- 0:00:47
317000 -- [-1423.290] (-1419.920) (-1424.117) (-1422.953) * [-1423.606] (-1421.872) (-1423.193) (-1420.078) -- 0:00:47
317500 -- [-1422.898] (-1424.148) (-1424.051) (-1424.643) * [-1419.917] (-1421.098) (-1424.662) (-1419.497) -- 0:00:47
318000 -- [-1422.682] (-1420.774) (-1422.547) (-1422.905) * (-1425.991) (-1428.441) [-1425.411] (-1421.447) -- 0:00:47
318500 -- (-1421.527) (-1427.059) (-1424.783) [-1424.843] * [-1420.782] (-1425.640) (-1420.413) (-1420.820) -- 0:00:47
319000 -- [-1422.325] (-1422.520) (-1426.155) (-1423.013) * (-1420.077) (-1422.097) (-1421.114) [-1420.142] -- 0:00:46
319500 -- [-1419.761] (-1420.923) (-1422.247) (-1424.262) * (-1420.623) [-1422.235] (-1423.184) (-1421.960) -- 0:00:46
320000 -- (-1423.828) [-1425.754] (-1421.825) (-1420.205) * (-1420.654) (-1419.953) (-1424.795) [-1420.229] -- 0:00:46
Average standard deviation of split frequencies: 0.009372
320500 -- [-1426.583] (-1425.687) (-1421.635) (-1420.450) * (-1421.547) [-1425.348] (-1423.733) (-1425.993) -- 0:00:46
321000 -- (-1421.823) [-1420.883] (-1422.454) (-1421.791) * (-1422.258) [-1421.684] (-1424.751) (-1422.698) -- 0:00:46
321500 -- (-1423.941) (-1418.572) (-1424.115) [-1419.579] * (-1424.080) (-1421.585) (-1426.622) [-1423.061] -- 0:00:46
322000 -- (-1422.511) (-1423.708) [-1422.361] (-1420.037) * (-1426.606) (-1422.411) [-1420.624] (-1421.704) -- 0:00:46
322500 -- (-1423.971) (-1421.750) (-1422.900) [-1419.223] * [-1424.182] (-1422.038) (-1420.620) (-1421.316) -- 0:00:46
323000 -- (-1422.980) (-1421.755) (-1432.462) [-1420.348] * [-1421.237] (-1423.920) (-1421.909) (-1423.219) -- 0:00:46
323500 -- (-1424.031) [-1420.226] (-1423.329) (-1422.509) * (-1421.022) (-1422.831) [-1419.800] (-1427.546) -- 0:00:46
324000 -- (-1423.557) (-1419.703) (-1427.354) [-1419.734] * (-1422.340) [-1421.915] (-1419.712) (-1425.383) -- 0:00:45
324500 -- (-1424.176) [-1423.570] (-1421.551) (-1421.192) * (-1420.129) [-1429.673] (-1423.370) (-1423.012) -- 0:00:45
325000 -- [-1421.257] (-1426.851) (-1422.884) (-1420.800) * [-1422.074] (-1421.847) (-1428.940) (-1422.870) -- 0:00:45
Average standard deviation of split frequencies: 0.010444
325500 -- (-1422.978) [-1421.668] (-1420.155) (-1418.830) * (-1422.972) (-1422.450) [-1424.569] (-1421.473) -- 0:00:45
326000 -- (-1422.581) (-1422.811) (-1420.968) [-1420.865] * (-1424.484) (-1424.398) (-1422.240) [-1422.822] -- 0:00:45
326500 -- (-1422.674) [-1423.061] (-1424.117) (-1423.508) * (-1420.422) [-1422.108] (-1422.917) (-1424.871) -- 0:00:47
327000 -- (-1426.946) [-1420.199] (-1422.873) (-1424.610) * (-1420.260) [-1426.856] (-1419.980) (-1424.099) -- 0:00:47
327500 -- (-1427.390) [-1422.664] (-1423.387) (-1421.549) * [-1419.367] (-1422.784) (-1422.228) (-1422.556) -- 0:00:47
328000 -- (-1420.957) (-1421.639) [-1428.982] (-1423.000) * (-1420.126) [-1423.476] (-1423.096) (-1422.239) -- 0:00:47
328500 -- [-1420.338] (-1420.391) (-1422.595) (-1424.666) * (-1424.405) [-1422.441] (-1421.574) (-1421.482) -- 0:00:47
329000 -- (-1419.031) [-1421.993] (-1425.214) (-1420.721) * (-1424.066) [-1422.981] (-1422.828) (-1426.257) -- 0:00:46
329500 -- [-1419.971] (-1422.746) (-1421.358) (-1426.189) * (-1423.550) (-1425.553) [-1421.281] (-1422.765) -- 0:00:46
330000 -- [-1422.257] (-1421.219) (-1421.700) (-1422.960) * [-1422.911] (-1423.004) (-1424.681) (-1422.872) -- 0:00:46
Average standard deviation of split frequencies: 0.009392
330500 -- (-1426.492) (-1420.593) (-1422.897) [-1423.041] * (-1422.735) (-1420.689) [-1426.415] (-1423.749) -- 0:00:46
331000 -- [-1421.954] (-1420.263) (-1426.116) (-1428.017) * (-1427.685) [-1421.115] (-1424.752) (-1425.244) -- 0:00:46
331500 -- (-1422.518) [-1421.773] (-1428.669) (-1425.084) * (-1420.549) [-1420.766] (-1421.941) (-1431.480) -- 0:00:46
332000 -- [-1422.615] (-1420.143) (-1422.903) (-1424.923) * (-1422.822) [-1425.247] (-1423.087) (-1421.467) -- 0:00:46
332500 -- [-1424.658] (-1419.864) (-1422.201) (-1421.408) * [-1419.528] (-1424.116) (-1420.465) (-1421.094) -- 0:00:46
333000 -- (-1421.588) [-1423.656] (-1422.367) (-1421.550) * (-1422.122) (-1428.094) [-1423.879] (-1422.522) -- 0:00:46
333500 -- (-1419.137) [-1423.046] (-1424.161) (-1420.078) * (-1421.338) [-1424.518] (-1429.483) (-1426.095) -- 0:00:45
334000 -- (-1419.325) [-1422.526] (-1418.914) (-1424.579) * [-1425.232] (-1422.139) (-1425.401) (-1422.200) -- 0:00:45
334500 -- (-1421.656) (-1422.795) (-1423.776) [-1420.652] * (-1422.892) (-1421.450) (-1424.540) [-1425.520] -- 0:00:45
335000 -- (-1424.168) [-1424.360] (-1423.201) (-1424.165) * [-1422.677] (-1423.812) (-1424.094) (-1430.059) -- 0:00:45
Average standard deviation of split frequencies: 0.010069
335500 -- (-1426.178) [-1422.429] (-1418.877) (-1426.782) * [-1422.854] (-1421.742) (-1424.638) (-1422.438) -- 0:00:45
336000 -- (-1422.826) (-1420.860) [-1420.771] (-1424.170) * (-1425.193) (-1424.118) [-1421.303] (-1421.761) -- 0:00:45
336500 -- (-1426.232) [-1419.852] (-1424.073) (-1422.901) * (-1422.372) (-1423.546) [-1418.895] (-1420.590) -- 0:00:45
337000 -- [-1422.023] (-1419.538) (-1421.454) (-1420.474) * (-1420.243) (-1426.806) [-1423.978] (-1421.491) -- 0:00:45
337500 -- (-1421.525) (-1419.742) [-1419.758] (-1421.778) * (-1419.615) (-1430.781) [-1421.044] (-1424.625) -- 0:00:45
338000 -- (-1421.055) (-1426.003) (-1421.423) [-1421.188] * (-1424.460) (-1422.466) (-1418.289) [-1423.277] -- 0:00:45
338500 -- [-1421.652] (-1420.677) (-1422.620) (-1424.261) * [-1423.226] (-1422.784) (-1419.346) (-1423.509) -- 0:00:44
339000 -- (-1422.768) [-1422.246] (-1426.271) (-1422.334) * (-1423.781) [-1423.034] (-1428.619) (-1423.510) -- 0:00:44
339500 -- [-1422.087] (-1419.931) (-1423.599) (-1422.037) * (-1423.586) [-1422.211] (-1423.452) (-1427.832) -- 0:00:46
340000 -- (-1421.333) [-1422.338] (-1423.665) (-1422.161) * [-1420.525] (-1423.468) (-1422.426) (-1427.075) -- 0:00:46
Average standard deviation of split frequencies: 0.010205
340500 -- (-1421.843) (-1421.854) [-1424.741] (-1421.756) * (-1423.042) (-1421.622) [-1421.227] (-1422.172) -- 0:00:46
341000 -- [-1421.484] (-1422.719) (-1422.723) (-1421.576) * (-1426.432) (-1421.673) (-1422.171) [-1423.909] -- 0:00:46
341500 -- (-1425.949) [-1423.331] (-1419.914) (-1424.260) * (-1424.623) (-1420.851) [-1424.559] (-1424.400) -- 0:00:46
342000 -- [-1423.334] (-1420.114) (-1423.544) (-1422.548) * (-1424.059) (-1424.636) (-1423.566) [-1424.219] -- 0:00:46
342500 -- (-1426.107) (-1421.355) (-1420.649) [-1422.723] * [-1421.909] (-1423.373) (-1424.826) (-1422.889) -- 0:00:46
343000 -- (-1420.590) (-1424.694) [-1420.564] (-1422.761) * [-1421.202] (-1422.034) (-1420.995) (-1423.859) -- 0:00:45
343500 -- (-1419.904) [-1423.559] (-1419.755) (-1422.334) * (-1424.127) (-1421.824) [-1422.283] (-1427.881) -- 0:00:45
344000 -- [-1421.093] (-1421.506) (-1419.852) (-1423.782) * (-1421.510) (-1423.208) [-1420.546] (-1424.548) -- 0:00:45
344500 -- (-1420.455) (-1421.849) (-1422.108) [-1422.781] * [-1420.914] (-1422.942) (-1422.657) (-1423.464) -- 0:00:45
345000 -- (-1419.831) (-1424.272) (-1420.950) [-1421.947] * [-1426.725] (-1422.372) (-1421.919) (-1423.131) -- 0:00:45
Average standard deviation of split frequencies: 0.011300
345500 -- (-1422.084) (-1422.993) (-1423.441) [-1422.686] * [-1422.138] (-1421.919) (-1423.035) (-1420.537) -- 0:00:45
346000 -- (-1423.222) (-1422.011) (-1422.402) [-1423.004] * [-1422.971] (-1420.167) (-1425.240) (-1427.793) -- 0:00:45
346500 -- (-1425.361) [-1418.757] (-1420.480) (-1421.463) * [-1423.835] (-1422.742) (-1421.720) (-1423.512) -- 0:00:45
347000 -- [-1422.953] (-1420.523) (-1420.532) (-1421.805) * (-1422.609) (-1423.875) (-1421.645) [-1423.270] -- 0:00:45
347500 -- (-1423.424) (-1421.904) [-1421.300] (-1422.940) * (-1422.646) (-1422.113) [-1420.049] (-1424.735) -- 0:00:45
348000 -- (-1422.934) (-1422.792) (-1423.463) [-1422.161] * (-1426.902) (-1422.410) [-1424.383] (-1424.888) -- 0:00:44
348500 -- (-1421.561) (-1422.212) [-1423.783] (-1423.513) * [-1423.976] (-1422.007) (-1422.565) (-1421.235) -- 0:00:44
349000 -- (-1423.069) [-1422.062] (-1422.418) (-1422.259) * (-1423.816) (-1423.441) (-1421.929) [-1421.141] -- 0:00:44
349500 -- (-1425.825) (-1423.397) [-1419.921] (-1422.025) * [-1420.931] (-1423.992) (-1421.583) (-1422.502) -- 0:00:44
350000 -- (-1423.206) [-1423.881] (-1420.120) (-1422.139) * (-1420.271) (-1424.573) (-1425.311) [-1421.529] -- 0:00:44
Average standard deviation of split frequencies: 0.009964
350500 -- [-1418.336] (-1422.368) (-1421.585) (-1421.398) * [-1419.947] (-1430.206) (-1422.919) (-1421.528) -- 0:00:44
351000 -- (-1421.432) (-1423.365) (-1421.981) [-1421.782] * (-1422.837) (-1424.259) (-1423.097) [-1421.812] -- 0:00:44
351500 -- (-1420.544) (-1423.548) (-1421.996) [-1420.502] * [-1423.521] (-1421.925) (-1429.925) (-1421.961) -- 0:00:44
352000 -- (-1420.900) (-1421.907) [-1420.346] (-1427.399) * (-1423.302) (-1422.932) [-1431.131] (-1420.897) -- 0:00:44
352500 -- (-1424.975) (-1423.833) [-1421.004] (-1422.440) * (-1423.351) (-1422.825) (-1430.675) [-1421.441] -- 0:00:44
353000 -- (-1422.340) (-1420.032) (-1420.407) [-1420.267] * [-1422.667] (-1418.899) (-1420.345) (-1421.151) -- 0:00:43
353500 -- (-1425.731) (-1421.502) (-1421.695) [-1425.631] * (-1426.519) (-1423.907) [-1421.081] (-1426.477) -- 0:00:45
354000 -- (-1420.603) [-1422.099] (-1421.274) (-1423.713) * (-1421.838) (-1420.267) [-1419.859] (-1423.702) -- 0:00:45
354500 -- (-1423.968) (-1423.461) (-1421.774) [-1422.355] * (-1422.420) [-1423.365] (-1421.235) (-1422.719) -- 0:00:45
355000 -- (-1420.464) (-1425.257) (-1420.293) [-1422.540] * (-1425.224) (-1424.128) (-1421.433) [-1427.169] -- 0:00:45
Average standard deviation of split frequencies: 0.009186
355500 -- (-1421.844) [-1423.853] (-1421.087) (-1422.426) * [-1420.836] (-1422.656) (-1422.221) (-1424.136) -- 0:00:45
356000 -- (-1424.208) (-1422.499) (-1423.849) [-1421.178] * (-1422.671) (-1429.802) [-1423.011] (-1421.670) -- 0:00:45
356500 -- (-1422.700) (-1423.970) (-1425.168) [-1421.627] * (-1423.981) (-1429.808) [-1422.713] (-1421.860) -- 0:00:45
357000 -- (-1425.623) (-1420.812) (-1424.632) [-1420.494] * [-1421.838] (-1420.716) (-1420.006) (-1425.514) -- 0:00:45
357500 -- [-1422.407] (-1421.729) (-1425.523) (-1422.410) * [-1423.497] (-1421.247) (-1423.560) (-1422.628) -- 0:00:44
358000 -- (-1425.627) [-1421.075] (-1422.890) (-1423.276) * (-1422.578) (-1427.511) [-1424.610] (-1422.572) -- 0:00:44
358500 -- [-1422.546] (-1424.681) (-1421.353) (-1424.339) * (-1423.778) (-1423.354) [-1422.226] (-1423.574) -- 0:00:44
359000 -- [-1421.808] (-1423.613) (-1422.850) (-1423.690) * (-1424.805) (-1421.979) (-1424.961) [-1423.585] -- 0:00:44
359500 -- (-1424.908) (-1424.541) (-1425.404) [-1422.918] * (-1427.715) [-1423.084] (-1424.389) (-1425.133) -- 0:00:44
360000 -- (-1421.291) (-1425.375) [-1420.134] (-1422.813) * (-1427.168) (-1425.068) (-1423.847) [-1424.034] -- 0:00:44
Average standard deviation of split frequencies: 0.009313
360500 -- (-1421.837) (-1422.919) (-1423.507) [-1419.877] * (-1425.753) (-1424.593) (-1421.992) [-1423.742] -- 0:00:44
361000 -- (-1425.970) (-1421.698) [-1421.289] (-1421.751) * (-1422.106) [-1422.944] (-1428.328) (-1423.459) -- 0:00:44
361500 -- [-1421.036] (-1421.737) (-1423.962) (-1423.832) * [-1422.978] (-1421.280) (-1423.886) (-1422.804) -- 0:00:44
362000 -- (-1423.782) (-1424.104) [-1424.253] (-1424.580) * (-1424.971) (-1422.670) [-1422.127] (-1421.267) -- 0:00:44
362500 -- (-1423.659) (-1421.956) (-1422.378) [-1421.208] * (-1424.938) (-1424.925) (-1423.475) [-1419.884] -- 0:00:43
363000 -- (-1422.395) (-1423.578) [-1421.998] (-1424.366) * [-1423.061] (-1424.870) (-1423.285) (-1422.407) -- 0:00:43
363500 -- (-1420.954) (-1424.302) [-1423.028] (-1422.846) * (-1422.065) [-1423.862] (-1423.106) (-1422.748) -- 0:00:43
364000 -- [-1422.317] (-1423.673) (-1422.227) (-1421.804) * [-1420.767] (-1421.789) (-1424.457) (-1421.523) -- 0:00:43
364500 -- (-1422.747) (-1422.666) [-1421.272] (-1423.363) * (-1421.663) (-1427.640) (-1423.603) [-1421.679] -- 0:00:43
365000 -- (-1425.415) (-1422.669) (-1423.876) [-1426.548] * [-1423.620] (-1426.425) (-1422.414) (-1422.826) -- 0:00:43
Average standard deviation of split frequencies: 0.010304
365500 -- (-1426.141) [-1423.657] (-1426.221) (-1428.637) * (-1423.047) (-1435.876) (-1421.883) [-1426.138] -- 0:00:43
366000 -- (-1421.857) (-1425.380) (-1423.023) [-1425.615] * [-1421.922] (-1426.834) (-1419.654) (-1424.498) -- 0:00:43
366500 -- (-1425.749) (-1424.288) [-1420.229] (-1418.756) * (-1422.523) (-1425.411) (-1422.360) [-1423.408] -- 0:00:43
367000 -- (-1423.863) (-1425.609) (-1420.030) [-1419.890] * (-1425.294) (-1422.192) [-1420.700] (-1420.390) -- 0:00:43
367500 -- (-1423.688) [-1422.956] (-1421.947) (-1422.396) * (-1423.097) [-1423.431] (-1423.180) (-1423.190) -- 0:00:43
368000 -- (-1425.708) [-1421.166] (-1424.982) (-1420.578) * (-1420.556) (-1425.616) [-1422.391] (-1422.425) -- 0:00:44
368500 -- (-1424.917) [-1421.710] (-1421.850) (-1418.645) * (-1421.374) (-1421.843) (-1424.127) [-1421.757] -- 0:00:44
369000 -- (-1421.833) (-1420.522) (-1422.211) [-1419.286] * (-1420.326) (-1422.383) (-1425.111) [-1423.226] -- 0:00:44
369500 -- (-1420.479) (-1425.197) (-1423.254) [-1420.906] * (-1424.232) (-1423.347) (-1423.290) [-1422.233] -- 0:00:44
370000 -- (-1424.805) (-1421.573) (-1424.759) [-1421.045] * (-1421.034) (-1422.192) (-1425.931) [-1424.308] -- 0:00:44
Average standard deviation of split frequencies: 0.010773
370500 -- (-1425.288) [-1421.768] (-1423.320) (-1422.351) * (-1421.773) [-1421.766] (-1423.834) (-1422.225) -- 0:00:44
371000 -- (-1424.115) (-1424.687) [-1423.601] (-1420.180) * (-1422.210) (-1424.227) (-1423.197) [-1421.523] -- 0:00:44
371500 -- (-1422.316) [-1423.176] (-1421.903) (-1421.783) * [-1424.052] (-1422.467) (-1421.782) (-1421.546) -- 0:00:43
372000 -- (-1425.914) [-1423.247] (-1423.126) (-1422.480) * (-1421.220) (-1422.595) [-1421.236] (-1422.041) -- 0:00:43
372500 -- [-1420.993] (-1423.875) (-1420.359) (-1422.262) * (-1423.592) [-1425.616] (-1424.667) (-1422.271) -- 0:00:43
373000 -- (-1423.985) (-1424.204) (-1421.493) [-1419.792] * (-1423.791) (-1428.768) [-1421.288] (-1422.283) -- 0:00:43
373500 -- (-1427.031) (-1422.585) [-1422.210] (-1422.208) * [-1421.399] (-1426.336) (-1420.389) (-1423.811) -- 0:00:43
374000 -- (-1421.636) [-1424.421] (-1420.005) (-1423.121) * [-1419.801] (-1423.567) (-1421.581) (-1423.444) -- 0:00:43
374500 -- [-1423.470] (-1423.687) (-1420.791) (-1421.695) * (-1422.728) (-1424.442) (-1422.892) [-1422.705] -- 0:00:43
375000 -- (-1424.722) [-1424.070] (-1425.710) (-1421.966) * (-1421.792) [-1431.878] (-1422.183) (-1424.790) -- 0:00:43
Average standard deviation of split frequencies: 0.009716
375500 -- [-1420.995] (-1423.480) (-1422.647) (-1419.575) * (-1421.948) (-1429.875) (-1420.942) [-1423.314] -- 0:00:43
376000 -- (-1421.809) [-1426.025] (-1421.944) (-1422.661) * (-1421.423) (-1423.542) (-1421.049) [-1422.233] -- 0:00:43
376500 -- (-1420.607) [-1423.677] (-1423.171) (-1421.225) * [-1421.439] (-1423.212) (-1422.925) (-1422.309) -- 0:00:43
377000 -- (-1421.940) (-1422.626) (-1422.649) [-1421.831] * [-1419.913] (-1421.588) (-1421.498) (-1424.237) -- 0:00:42
377500 -- (-1422.170) (-1425.134) [-1422.194] (-1422.160) * (-1422.101) (-1423.457) (-1422.353) [-1422.018] -- 0:00:42
378000 -- (-1421.813) (-1423.578) [-1421.541] (-1422.829) * (-1418.722) [-1422.215] (-1423.421) (-1423.208) -- 0:00:42
378500 -- (-1424.905) [-1427.509] (-1423.490) (-1419.012) * (-1424.731) [-1422.928] (-1422.439) (-1421.897) -- 0:00:42
379000 -- (-1427.032) (-1424.080) [-1421.800] (-1421.402) * (-1421.453) (-1421.461) (-1423.612) [-1420.484] -- 0:00:42
379500 -- (-1423.271) (-1423.451) [-1421.893] (-1419.109) * [-1421.966] (-1421.508) (-1428.003) (-1421.748) -- 0:00:42
380000 -- (-1425.568) (-1424.890) [-1421.603] (-1421.517) * (-1424.547) (-1421.643) [-1422.650] (-1424.785) -- 0:00:42
Average standard deviation of split frequencies: 0.009830
380500 -- (-1425.472) [-1421.908] (-1423.056) (-1425.176) * (-1422.172) [-1421.129] (-1426.751) (-1420.152) -- 0:00:42
381000 -- [-1421.620] (-1422.274) (-1424.997) (-1419.760) * (-1422.938) [-1423.657] (-1422.092) (-1421.717) -- 0:00:42
381500 -- (-1421.074) (-1422.659) [-1421.220] (-1419.611) * (-1421.795) [-1421.930] (-1422.427) (-1421.437) -- 0:00:42
382000 -- (-1421.799) (-1423.437) [-1421.831] (-1421.124) * [-1421.742] (-1420.884) (-1420.969) (-1425.347) -- 0:00:42
382500 -- [-1422.629] (-1421.154) (-1419.662) (-1422.790) * (-1421.599) (-1421.419) [-1422.075] (-1421.122) -- 0:00:41
383000 -- (-1423.775) (-1423.406) (-1422.665) [-1422.199] * (-1424.399) (-1420.037) [-1424.247] (-1421.552) -- 0:00:43
383500 -- (-1422.209) (-1422.062) [-1423.652] (-1427.621) * (-1423.032) (-1423.542) (-1424.002) [-1423.612] -- 0:00:43
384000 -- (-1423.482) (-1420.002) [-1425.478] (-1421.802) * [-1422.009] (-1421.262) (-1424.715) (-1427.924) -- 0:00:43
384500 -- (-1423.271) (-1420.437) (-1423.159) [-1420.055] * (-1422.469) [-1422.190] (-1423.924) (-1423.326) -- 0:00:43
385000 -- (-1426.789) [-1421.324] (-1423.509) (-1421.013) * (-1421.363) [-1422.583] (-1421.771) (-1421.850) -- 0:00:43
Average standard deviation of split frequencies: 0.009465
385500 -- (-1423.838) (-1425.529) (-1424.666) [-1420.353] * (-1422.346) (-1423.344) (-1423.911) [-1425.712] -- 0:00:43
386000 -- (-1422.487) (-1421.828) [-1428.353] (-1421.800) * (-1420.425) [-1425.236] (-1422.006) (-1423.816) -- 0:00:42
386500 -- (-1425.391) (-1420.632) (-1423.585) [-1421.452] * [-1422.408] (-1422.736) (-1429.649) (-1424.346) -- 0:00:42
387000 -- (-1425.688) (-1421.016) (-1423.388) [-1420.234] * [-1421.900] (-1423.856) (-1421.782) (-1422.864) -- 0:00:42
387500 -- [-1423.683] (-1427.759) (-1424.477) (-1423.225) * [-1427.211] (-1423.183) (-1426.044) (-1421.908) -- 0:00:42
388000 -- (-1422.010) (-1427.146) (-1423.459) [-1420.512] * (-1423.726) (-1427.577) [-1423.045] (-1425.526) -- 0:00:42
388500 -- (-1425.499) (-1421.230) (-1423.022) [-1423.541] * (-1425.002) (-1421.293) [-1419.851] (-1422.612) -- 0:00:42
389000 -- (-1423.207) [-1420.956] (-1420.555) (-1422.495) * (-1424.605) (-1422.319) [-1420.965] (-1423.378) -- 0:00:42
389500 -- (-1420.970) [-1419.258] (-1424.641) (-1421.147) * [-1423.760] (-1419.984) (-1422.034) (-1426.198) -- 0:00:42
390000 -- (-1424.038) (-1423.194) [-1424.698] (-1423.405) * (-1424.894) (-1421.842) (-1423.739) [-1421.687] -- 0:00:42
Average standard deviation of split frequencies: 0.009352
390500 -- (-1422.303) (-1423.315) [-1422.809] (-1423.903) * (-1424.110) [-1420.782] (-1422.957) (-1421.555) -- 0:00:42
391000 -- (-1421.622) (-1426.059) [-1421.591] (-1422.318) * [-1423.485] (-1421.786) (-1425.435) (-1421.615) -- 0:00:42
391500 -- [-1423.378] (-1423.778) (-1419.501) (-1421.001) * [-1422.947] (-1423.654) (-1428.001) (-1422.184) -- 0:00:41
392000 -- (-1423.953) (-1421.456) (-1422.347) [-1421.844] * (-1422.075) (-1425.586) [-1425.185] (-1425.188) -- 0:00:41
392500 -- (-1423.872) (-1425.504) (-1420.473) [-1421.530] * [-1421.925] (-1423.927) (-1422.065) (-1424.627) -- 0:00:41
393000 -- (-1424.106) [-1422.403] (-1423.120) (-1425.808) * [-1422.218] (-1424.354) (-1422.685) (-1422.963) -- 0:00:41
393500 -- (-1422.344) (-1420.919) [-1421.745] (-1422.232) * (-1421.822) (-1421.867) [-1421.993] (-1425.499) -- 0:00:41
394000 -- [-1422.358] (-1420.980) (-1423.385) (-1420.359) * (-1425.038) [-1421.299] (-1426.798) (-1425.134) -- 0:00:41
394500 -- [-1427.218] (-1420.046) (-1427.805) (-1421.424) * (-1423.619) [-1423.348] (-1425.929) (-1421.956) -- 0:00:41
395000 -- (-1422.199) [-1422.392] (-1421.142) (-1424.150) * [-1426.640] (-1423.753) (-1422.482) (-1424.318) -- 0:00:41
Average standard deviation of split frequencies: 0.009803
395500 -- (-1422.252) [-1419.925] (-1420.120) (-1422.062) * [-1426.934] (-1422.401) (-1422.021) (-1424.947) -- 0:00:41
396000 -- [-1422.640] (-1421.339) (-1421.180) (-1423.532) * (-1423.693) [-1424.309] (-1421.808) (-1421.372) -- 0:00:41
396500 -- [-1421.046] (-1422.132) (-1421.251) (-1421.690) * [-1425.142] (-1422.388) (-1422.821) (-1424.005) -- 0:00:41
397000 -- (-1421.960) (-1423.928) [-1422.992] (-1422.732) * (-1423.168) (-1421.623) (-1422.811) [-1421.544] -- 0:00:41
397500 -- (-1421.363) (-1420.609) [-1421.211] (-1423.641) * [-1421.713] (-1422.457) (-1423.880) (-1425.769) -- 0:00:42
398000 -- (-1423.245) (-1423.144) [-1420.485] (-1432.354) * (-1423.099) (-1421.924) (-1423.504) [-1420.934] -- 0:00:42
398500 -- (-1421.771) [-1418.615] (-1420.210) (-1427.450) * (-1426.074) (-1421.657) (-1423.468) [-1423.867] -- 0:00:42
399000 -- (-1424.353) [-1418.340] (-1424.347) (-1425.425) * (-1427.989) [-1421.311] (-1422.377) (-1426.252) -- 0:00:42
399500 -- (-1425.590) (-1423.865) (-1421.529) [-1422.652] * [-1422.123] (-1422.082) (-1421.565) (-1426.412) -- 0:00:42
400000 -- (-1424.797) [-1423.287] (-1420.416) (-1424.994) * (-1421.262) (-1422.765) [-1420.999] (-1429.781) -- 0:00:41
Average standard deviation of split frequencies: 0.009274
400500 -- (-1426.119) [-1421.046] (-1422.161) (-1424.610) * (-1422.031) (-1423.087) (-1423.811) [-1422.089] -- 0:00:41
401000 -- (-1423.701) (-1424.146) [-1421.469] (-1421.688) * (-1422.018) (-1423.524) (-1422.492) [-1422.793] -- 0:00:41
401500 -- (-1422.583) (-1421.253) (-1424.168) [-1422.318] * [-1423.662] (-1424.643) (-1422.703) (-1420.862) -- 0:00:41
402000 -- [-1423.287] (-1421.142) (-1427.330) (-1422.812) * (-1423.699) (-1422.544) (-1422.000) [-1422.068] -- 0:00:41
402500 -- [-1421.696] (-1421.704) (-1422.362) (-1421.892) * (-1421.909) (-1423.000) [-1421.784] (-1422.486) -- 0:00:41
403000 -- [-1421.469] (-1423.951) (-1422.567) (-1422.152) * [-1425.249] (-1422.379) (-1425.238) (-1426.941) -- 0:00:41
403500 -- (-1420.880) [-1421.639] (-1423.700) (-1424.452) * (-1422.579) [-1421.611] (-1425.328) (-1420.610) -- 0:00:41
404000 -- [-1425.690] (-1420.974) (-1422.742) (-1424.057) * (-1422.420) (-1423.352) [-1423.338] (-1421.657) -- 0:00:41
404500 -- (-1423.009) (-1425.389) [-1422.468] (-1424.719) * (-1422.876) [-1421.539] (-1421.054) (-1425.023) -- 0:00:41
405000 -- (-1420.964) (-1422.571) [-1421.217] (-1424.876) * (-1422.762) [-1426.437] (-1422.896) (-1422.517) -- 0:00:41
Average standard deviation of split frequencies: 0.009425
405500 -- (-1421.929) [-1420.476] (-1422.113) (-1419.119) * (-1419.723) (-1423.686) [-1423.003] (-1426.009) -- 0:00:41
406000 -- (-1422.525) (-1423.087) (-1422.841) [-1420.744] * [-1422.338] (-1423.153) (-1423.008) (-1424.150) -- 0:00:40
406500 -- (-1422.629) [-1424.648] (-1421.412) (-1421.750) * (-1422.257) [-1423.302] (-1421.151) (-1424.813) -- 0:00:40
407000 -- (-1423.009) [-1420.496] (-1421.967) (-1423.457) * (-1420.874) (-1422.590) [-1421.798] (-1422.121) -- 0:00:40
407500 -- (-1424.052) (-1421.097) (-1420.384) [-1420.704] * (-1421.969) [-1426.609] (-1421.290) (-1420.879) -- 0:00:40
408000 -- (-1423.198) (-1421.385) [-1422.695] (-1421.501) * (-1423.429) (-1423.068) [-1421.970] (-1421.097) -- 0:00:40
408500 -- (-1423.367) (-1420.993) [-1424.155] (-1423.473) * (-1426.053) (-1421.794) [-1419.934] (-1420.547) -- 0:00:40
409000 -- [-1422.505] (-1423.394) (-1420.559) (-1423.827) * (-1422.504) (-1421.616) (-1424.184) [-1421.483] -- 0:00:40
409500 -- (-1419.115) [-1422.378] (-1419.912) (-1422.044) * (-1423.824) (-1422.194) (-1420.154) [-1421.846] -- 0:00:40
410000 -- (-1424.367) (-1425.734) (-1418.420) [-1424.689] * (-1427.522) [-1422.912] (-1422.929) (-1421.315) -- 0:00:40
Average standard deviation of split frequencies: 0.008846
410500 -- (-1422.995) [-1425.929] (-1422.400) (-1425.868) * [-1424.578] (-1422.894) (-1422.031) (-1420.493) -- 0:00:40
411000 -- (-1420.183) [-1423.796] (-1420.855) (-1426.761) * (-1422.412) (-1424.290) [-1419.412] (-1425.413) -- 0:00:40
411500 -- (-1420.863) (-1421.012) [-1421.659] (-1427.932) * (-1425.580) (-1423.247) [-1423.100] (-1422.624) -- 0:00:40
412000 -- (-1421.322) [-1420.143] (-1420.982) (-1428.454) * (-1422.733) [-1424.926] (-1425.057) (-1422.895) -- 0:00:41
412500 -- (-1425.961) (-1424.730) (-1422.227) [-1422.839] * [-1421.005] (-1423.502) (-1423.271) (-1422.476) -- 0:00:41
413000 -- (-1424.077) (-1421.107) [-1420.650] (-1422.427) * (-1424.370) [-1422.801] (-1426.491) (-1423.875) -- 0:00:41
413500 -- (-1420.430) (-1418.660) [-1422.498] (-1421.370) * (-1426.254) (-1421.736) (-1419.612) [-1422.049] -- 0:00:41
414000 -- [-1421.984] (-1422.085) (-1420.568) (-1421.845) * (-1422.558) (-1422.392) (-1420.011) [-1422.281] -- 0:00:41
414500 -- (-1429.958) (-1425.380) [-1419.528] (-1431.186) * (-1422.412) (-1426.864) (-1421.593) [-1421.547] -- 0:00:40
415000 -- (-1423.999) (-1421.776) (-1422.430) [-1428.740] * (-1423.784) (-1421.506) (-1422.646) [-1421.452] -- 0:00:40
Average standard deviation of split frequencies: 0.009065
415500 -- (-1421.535) (-1426.956) (-1424.363) [-1424.963] * (-1422.181) (-1423.974) (-1423.067) [-1421.779] -- 0:00:40
416000 -- (-1422.416) [-1421.801] (-1419.918) (-1423.181) * (-1424.884) (-1422.937) [-1421.483] (-1422.538) -- 0:00:40
416500 -- [-1422.190] (-1422.891) (-1421.512) (-1424.386) * [-1423.495] (-1425.303) (-1423.299) (-1424.170) -- 0:00:40
417000 -- (-1425.345) (-1422.099) (-1421.492) [-1420.633] * (-1424.941) (-1422.746) (-1425.860) [-1424.039] -- 0:00:40
417500 -- [-1424.311] (-1420.102) (-1420.427) (-1422.330) * (-1423.552) [-1427.453] (-1426.412) (-1420.064) -- 0:00:40
418000 -- (-1422.233) [-1421.829] (-1418.914) (-1425.754) * (-1422.347) (-1423.643) [-1425.302] (-1420.909) -- 0:00:40
418500 -- (-1422.254) (-1420.414) [-1419.577] (-1421.344) * (-1420.726) (-1423.279) [-1424.803] (-1423.427) -- 0:00:40
419000 -- (-1424.183) (-1424.599) (-1427.029) [-1422.496] * [-1422.127] (-1424.677) (-1424.808) (-1422.885) -- 0:00:40
419500 -- (-1424.589) (-1422.657) (-1421.685) [-1420.856] * (-1421.936) (-1424.496) [-1424.659] (-1422.854) -- 0:00:40
420000 -- [-1423.168] (-1421.748) (-1424.075) (-1422.458) * (-1421.741) [-1424.095] (-1421.745) (-1420.842) -- 0:00:40
Average standard deviation of split frequencies: 0.008833
420500 -- (-1421.770) [-1424.837] (-1422.804) (-1421.556) * (-1420.862) (-1423.863) [-1420.867] (-1423.322) -- 0:00:39
421000 -- [-1421.375] (-1424.128) (-1422.588) (-1422.081) * (-1421.648) (-1424.428) (-1420.542) [-1419.852] -- 0:00:39
421500 -- [-1419.649] (-1420.903) (-1422.593) (-1422.167) * (-1424.327) (-1423.561) [-1421.059] (-1420.943) -- 0:00:39
422000 -- (-1422.169) [-1422.242] (-1423.376) (-1421.648) * (-1423.870) (-1422.382) (-1422.871) [-1422.026] -- 0:00:39
422500 -- (-1422.227) (-1421.750) (-1421.937) [-1421.001] * (-1424.488) [-1421.826] (-1426.253) (-1425.428) -- 0:00:39
423000 -- (-1421.602) (-1421.049) [-1425.768] (-1422.137) * (-1421.184) [-1422.102] (-1426.241) (-1421.385) -- 0:00:39
423500 -- [-1429.191] (-1421.732) (-1426.044) (-1420.292) * [-1421.196] (-1424.132) (-1422.742) (-1422.271) -- 0:00:39
424000 -- (-1423.061) [-1421.505] (-1421.930) (-1421.134) * (-1424.232) [-1422.684] (-1424.203) (-1420.373) -- 0:00:39
424500 -- [-1423.792] (-1425.177) (-1422.078) (-1423.848) * (-1421.647) [-1424.533] (-1423.644) (-1427.684) -- 0:00:39
425000 -- (-1422.753) [-1424.744] (-1424.923) (-1427.286) * (-1425.286) [-1422.097] (-1423.960) (-1424.990) -- 0:00:39
Average standard deviation of split frequencies: 0.009373
425500 -- (-1422.171) (-1424.490) (-1424.656) [-1420.453] * (-1422.039) [-1420.513] (-1421.802) (-1419.727) -- 0:00:39
426000 -- [-1419.113] (-1421.901) (-1424.816) (-1422.535) * (-1426.170) (-1422.226) (-1427.760) [-1419.927] -- 0:00:39
426500 -- [-1421.329] (-1423.881) (-1423.926) (-1421.179) * [-1424.952] (-1422.959) (-1422.260) (-1419.786) -- 0:00:40
427000 -- (-1423.980) [-1423.288] (-1420.822) (-1426.099) * (-1425.049) (-1422.511) [-1421.104] (-1421.290) -- 0:00:40
427500 -- (-1421.630) [-1420.866] (-1420.221) (-1422.098) * (-1426.935) (-1419.465) [-1420.679] (-1421.894) -- 0:00:40
428000 -- [-1421.934] (-1421.573) (-1421.921) (-1424.080) * (-1428.155) [-1421.469] (-1421.907) (-1422.659) -- 0:00:40
428500 -- (-1422.612) [-1421.909] (-1429.461) (-1423.184) * (-1419.416) (-1422.088) [-1423.313] (-1422.676) -- 0:00:40
429000 -- (-1419.457) (-1421.196) (-1426.297) [-1423.225] * [-1424.135] (-1420.453) (-1423.046) (-1425.149) -- 0:00:39
429500 -- (-1420.403) [-1420.633] (-1422.184) (-1422.131) * (-1427.630) [-1422.841] (-1422.290) (-1423.325) -- 0:00:39
430000 -- (-1420.128) [-1419.667] (-1422.389) (-1422.826) * (-1426.279) (-1421.374) (-1420.688) [-1421.124] -- 0:00:39
Average standard deviation of split frequencies: 0.009851
430500 -- (-1421.836) (-1421.733) [-1422.449] (-1422.348) * [-1424.316] (-1420.477) (-1423.521) (-1419.537) -- 0:00:39
431000 -- (-1424.757) (-1421.313) [-1422.126] (-1424.985) * [-1422.981] (-1422.582) (-1424.533) (-1422.962) -- 0:00:39
431500 -- [-1418.495] (-1423.005) (-1419.894) (-1423.985) * [-1419.483] (-1423.258) (-1423.989) (-1423.122) -- 0:00:39
432000 -- [-1420.431] (-1422.455) (-1423.015) (-1426.325) * (-1423.352) [-1420.568] (-1423.911) (-1422.143) -- 0:00:39
432500 -- (-1426.898) (-1419.532) (-1424.335) [-1423.290] * (-1422.818) (-1420.055) (-1426.011) [-1420.580] -- 0:00:39
433000 -- (-1423.319) (-1423.040) (-1421.869) [-1418.990] * (-1424.918) (-1422.583) (-1422.497) [-1419.372] -- 0:00:39
433500 -- (-1422.704) (-1421.337) (-1422.645) [-1423.018] * (-1421.910) [-1426.082] (-1423.222) (-1422.800) -- 0:00:39
434000 -- (-1421.078) [-1420.123] (-1427.521) (-1422.196) * (-1424.953) (-1426.761) (-1424.404) [-1423.338] -- 0:00:39
434500 -- [-1422.570] (-1420.374) (-1422.093) (-1423.283) * (-1420.622) (-1421.674) (-1423.045) [-1421.178] -- 0:00:39
435000 -- [-1421.017] (-1422.488) (-1421.055) (-1424.463) * [-1421.554] (-1424.727) (-1422.581) (-1422.256) -- 0:00:38
Average standard deviation of split frequencies: 0.009922
435500 -- (-1423.292) (-1422.799) (-1424.223) [-1424.865] * [-1421.435] (-1423.141) (-1421.433) (-1421.694) -- 0:00:38
436000 -- (-1423.380) (-1419.142) (-1419.769) [-1422.165] * (-1424.349) (-1420.783) [-1420.958] (-1421.897) -- 0:00:38
436500 -- (-1425.733) [-1420.354] (-1421.151) (-1422.460) * (-1426.968) (-1423.253) (-1422.167) [-1422.758] -- 0:00:38
437000 -- (-1421.185) (-1427.015) [-1421.875] (-1421.819) * (-1424.842) (-1423.338) [-1421.581] (-1421.881) -- 0:00:38
437500 -- [-1422.745] (-1422.346) (-1425.029) (-1421.268) * (-1423.936) (-1423.977) [-1423.043] (-1421.051) -- 0:00:38
438000 -- (-1424.175) [-1419.264] (-1424.131) (-1422.775) * [-1420.633] (-1422.399) (-1422.032) (-1422.312) -- 0:00:38
438500 -- (-1421.883) [-1422.400] (-1423.797) (-1424.959) * (-1422.917) [-1422.613] (-1425.185) (-1421.739) -- 0:00:38
439000 -- (-1420.722) (-1421.182) [-1420.771] (-1421.313) * (-1425.814) (-1421.937) (-1421.757) [-1422.788] -- 0:00:38
439500 -- (-1421.595) (-1423.913) [-1421.392] (-1421.306) * (-1427.522) (-1424.350) [-1422.818] (-1422.106) -- 0:00:38
440000 -- (-1421.622) (-1424.369) [-1422.252] (-1424.366) * (-1424.039) (-1423.949) [-1422.216] (-1423.733) -- 0:00:38
Average standard deviation of split frequencies: 0.009093
440500 -- (-1421.347) (-1422.812) [-1421.897] (-1426.652) * [-1422.441] (-1423.031) (-1420.986) (-1425.681) -- 0:00:38
441000 -- (-1421.761) [-1424.994] (-1421.847) (-1421.509) * (-1423.883) (-1423.151) (-1421.776) [-1421.274] -- 0:00:38
441500 -- (-1422.208) (-1424.753) (-1422.066) [-1421.581] * (-1422.077) (-1427.428) (-1422.944) [-1422.929] -- 0:00:39
442000 -- (-1422.416) [-1421.881] (-1424.315) (-1422.081) * [-1423.121] (-1422.605) (-1426.891) (-1425.464) -- 0:00:39
442500 -- (-1424.220) [-1424.764] (-1422.079) (-1422.108) * [-1421.824] (-1421.301) (-1422.443) (-1420.078) -- 0:00:39
443000 -- [-1422.001] (-1424.773) (-1424.840) (-1424.319) * [-1422.329] (-1423.358) (-1424.331) (-1423.522) -- 0:00:38
443500 -- [-1421.501] (-1423.455) (-1421.162) (-1422.433) * [-1422.380] (-1428.307) (-1422.044) (-1422.904) -- 0:00:38
444000 -- (-1420.153) (-1424.531) (-1421.274) [-1426.665] * (-1423.459) (-1426.211) [-1419.975] (-1422.232) -- 0:00:38
444500 -- [-1419.676] (-1422.767) (-1420.491) (-1423.197) * (-1420.905) (-1424.507) [-1423.945] (-1421.701) -- 0:00:38
445000 -- (-1421.126) (-1423.593) (-1424.336) [-1421.548] * (-1422.716) (-1425.618) (-1422.269) [-1421.883] -- 0:00:38
Average standard deviation of split frequencies: 0.009761
445500 -- [-1421.416] (-1422.830) (-1423.788) (-1427.068) * (-1421.545) [-1422.724] (-1424.715) (-1425.123) -- 0:00:38
446000 -- (-1423.353) [-1425.035] (-1424.134) (-1426.673) * [-1426.091] (-1424.228) (-1424.140) (-1423.639) -- 0:00:38
446500 -- (-1425.471) [-1422.754] (-1424.360) (-1421.929) * (-1422.092) [-1424.613] (-1422.394) (-1423.509) -- 0:00:38
447000 -- (-1422.157) (-1429.280) (-1422.481) [-1422.286] * [-1419.382] (-1424.148) (-1423.892) (-1421.591) -- 0:00:38
447500 -- (-1423.277) (-1424.620) (-1423.572) [-1423.414] * [-1422.360] (-1423.100) (-1423.489) (-1423.674) -- 0:00:38
448000 -- (-1421.938) (-1422.687) [-1425.688] (-1426.392) * (-1423.221) [-1422.490] (-1424.441) (-1423.092) -- 0:00:38
448500 -- (-1422.092) (-1425.371) (-1425.085) [-1425.747] * (-1419.949) (-1421.881) (-1421.616) [-1424.108] -- 0:00:38
449000 -- (-1421.427) (-1424.014) (-1422.877) [-1421.364] * [-1421.302] (-1423.242) (-1421.918) (-1423.878) -- 0:00:38
449500 -- (-1424.654) [-1427.719] (-1421.806) (-1424.003) * (-1421.558) [-1421.450] (-1421.878) (-1426.353) -- 0:00:37
450000 -- (-1418.482) (-1428.810) [-1422.499] (-1421.882) * (-1424.374) [-1419.808] (-1421.878) (-1421.740) -- 0:00:37
Average standard deviation of split frequencies: 0.009783
450500 -- (-1421.960) (-1425.005) [-1421.929] (-1423.665) * (-1422.109) [-1423.356] (-1422.882) (-1423.809) -- 0:00:37
451000 -- (-1423.292) (-1423.143) (-1421.976) [-1421.513] * (-1423.254) [-1422.118] (-1421.494) (-1421.421) -- 0:00:37
451500 -- (-1421.537) (-1423.929) (-1423.315) [-1427.086] * (-1419.815) (-1422.543) (-1423.237) [-1423.218] -- 0:00:37
452000 -- [-1424.158] (-1424.743) (-1426.822) (-1424.602) * (-1419.147) (-1422.468) (-1422.708) [-1422.615] -- 0:00:37
452500 -- [-1422.950] (-1422.696) (-1423.377) (-1421.621) * (-1421.216) [-1422.826] (-1424.055) (-1421.130) -- 0:00:37
453000 -- (-1422.377) (-1421.816) (-1421.083) [-1421.496] * [-1422.478] (-1421.041) (-1422.541) (-1422.789) -- 0:00:37
453500 -- [-1421.237] (-1421.555) (-1421.718) (-1423.991) * (-1423.508) [-1422.682] (-1420.906) (-1425.241) -- 0:00:37
454000 -- (-1425.010) [-1421.637] (-1424.399) (-1425.021) * (-1421.656) (-1429.067) (-1429.174) [-1428.919] -- 0:00:37
454500 -- (-1421.802) (-1422.460) [-1421.953] (-1426.022) * (-1422.824) (-1425.711) (-1425.306) [-1427.544] -- 0:00:37
455000 -- (-1423.119) (-1424.474) [-1427.349] (-1426.019) * (-1421.193) (-1424.554) [-1421.656] (-1420.854) -- 0:00:37
Average standard deviation of split frequencies: 0.009912
455500 -- (-1421.099) (-1424.757) [-1425.051] (-1424.674) * (-1421.750) (-1426.390) [-1422.702] (-1424.330) -- 0:00:37
456000 -- (-1423.562) (-1427.163) (-1424.554) [-1422.916] * (-1422.290) [-1423.858] (-1423.201) (-1424.744) -- 0:00:36
456500 -- (-1419.181) (-1423.864) [-1421.081] (-1424.542) * [-1420.206] (-1423.955) (-1422.659) (-1424.190) -- 0:00:38
457000 -- (-1419.553) [-1423.226] (-1426.628) (-1422.141) * [-1425.224] (-1423.503) (-1422.398) (-1428.775) -- 0:00:38
457500 -- (-1420.156) [-1422.872] (-1427.947) (-1421.114) * (-1422.186) [-1422.965] (-1423.193) (-1425.724) -- 0:00:37
458000 -- (-1419.733) (-1422.923) [-1424.949] (-1422.409) * [-1422.186] (-1422.577) (-1423.135) (-1425.073) -- 0:00:37
458500 -- [-1423.433] (-1425.102) (-1423.224) (-1422.262) * (-1423.251) (-1422.388) [-1422.651] (-1423.205) -- 0:00:37
459000 -- (-1422.009) (-1426.911) [-1422.411] (-1423.205) * (-1423.521) (-1423.435) [-1423.011] (-1423.833) -- 0:00:37
459500 -- [-1420.056] (-1428.536) (-1422.978) (-1422.605) * [-1422.699] (-1425.090) (-1420.707) (-1422.134) -- 0:00:37
460000 -- (-1420.731) (-1424.779) [-1424.482] (-1422.349) * (-1424.478) (-1424.364) [-1418.724] (-1423.223) -- 0:00:37
Average standard deviation of split frequencies: 0.009752
460500 -- (-1422.406) (-1425.259) [-1421.749] (-1425.327) * (-1426.625) [-1424.124] (-1420.651) (-1422.321) -- 0:00:37
461000 -- (-1421.145) (-1426.017) (-1423.055) [-1423.515] * [-1425.128] (-1424.748) (-1423.839) (-1423.386) -- 0:00:37
461500 -- (-1420.009) (-1424.891) [-1422.440] (-1423.911) * (-1423.226) (-1421.640) [-1425.206] (-1423.763) -- 0:00:37
462000 -- (-1421.241) (-1426.443) [-1421.966] (-1422.612) * (-1421.438) (-1421.409) [-1425.701] (-1419.408) -- 0:00:37
462500 -- (-1418.837) (-1425.385) (-1426.163) [-1422.224] * [-1421.643] (-1423.451) (-1420.460) (-1424.372) -- 0:00:37
463000 -- (-1421.063) [-1422.932] (-1426.888) (-1421.937) * (-1419.837) [-1422.640] (-1426.732) (-1425.328) -- 0:00:37
463500 -- [-1421.070] (-1421.603) (-1421.274) (-1422.826) * (-1423.890) (-1422.272) [-1427.649] (-1421.367) -- 0:00:37
464000 -- (-1420.302) (-1421.995) [-1423.870] (-1420.924) * [-1421.118] (-1423.216) (-1421.441) (-1426.173) -- 0:00:36
464500 -- (-1417.975) (-1421.668) [-1419.920] (-1426.516) * (-1424.082) (-1422.757) [-1421.722] (-1424.225) -- 0:00:36
465000 -- (-1419.857) (-1420.468) [-1421.592] (-1427.145) * (-1420.587) (-1422.835) (-1423.714) [-1422.180] -- 0:00:36
Average standard deviation of split frequencies: 0.009342
465500 -- (-1421.448) [-1425.795] (-1422.511) (-1421.443) * (-1422.806) (-1425.683) [-1420.617] (-1421.559) -- 0:00:36
466000 -- [-1421.680] (-1425.629) (-1425.131) (-1421.800) * (-1422.569) (-1426.454) [-1419.427] (-1422.829) -- 0:00:36
466500 -- (-1422.490) [-1425.492] (-1427.596) (-1421.735) * [-1423.616] (-1424.533) (-1421.061) (-1424.881) -- 0:00:36
467000 -- (-1419.769) [-1422.973] (-1426.520) (-1422.780) * (-1424.443) (-1422.290) [-1421.098] (-1421.110) -- 0:00:36
467500 -- [-1420.120] (-1422.236) (-1422.046) (-1421.714) * (-1421.970) (-1423.701) [-1422.464] (-1419.315) -- 0:00:36
468000 -- (-1422.932) (-1420.472) [-1424.770] (-1424.126) * [-1423.100] (-1420.561) (-1421.040) (-1423.174) -- 0:00:36
468500 -- (-1423.427) (-1422.353) (-1422.833) [-1423.183] * (-1422.718) (-1421.546) (-1421.330) [-1425.660] -- 0:00:36
469000 -- (-1422.006) (-1424.043) [-1420.594] (-1422.583) * (-1420.885) (-1423.603) [-1421.990] (-1427.036) -- 0:00:36
469500 -- (-1419.753) (-1427.671) (-1421.953) [-1426.006] * (-1421.571) [-1423.767] (-1425.016) (-1426.065) -- 0:00:36
470000 -- (-1422.460) (-1423.341) [-1420.544] (-1424.853) * (-1420.598) [-1424.219] (-1421.430) (-1424.151) -- 0:00:36
Average standard deviation of split frequencies: 0.009485
470500 -- (-1418.651) (-1422.472) [-1423.015] (-1424.429) * (-1423.028) (-1424.385) (-1426.315) [-1424.237] -- 0:00:36
471000 -- (-1422.192) [-1422.502] (-1423.757) (-1425.045) * (-1422.873) (-1423.691) [-1419.983] (-1423.191) -- 0:00:35
471500 -- (-1421.438) (-1422.434) (-1422.869) [-1421.630] * (-1421.536) [-1422.258] (-1421.605) (-1424.750) -- 0:00:36
472000 -- (-1423.811) (-1422.396) [-1421.952] (-1420.031) * [-1422.408] (-1422.024) (-1419.779) (-1421.965) -- 0:00:36
472500 -- (-1422.715) (-1421.702) [-1420.178] (-1424.190) * (-1423.570) [-1424.633] (-1422.653) (-1419.652) -- 0:00:36
473000 -- (-1422.079) (-1423.071) (-1424.558) [-1429.698] * (-1422.012) [-1422.648] (-1424.339) (-1422.073) -- 0:00:36
473500 -- [-1421.849] (-1421.846) (-1422.114) (-1427.509) * (-1421.864) [-1422.389] (-1424.286) (-1423.015) -- 0:00:36
474000 -- [-1423.760] (-1424.736) (-1424.324) (-1423.074) * (-1424.056) [-1424.245] (-1423.379) (-1424.503) -- 0:00:36
474500 -- (-1428.715) [-1426.815] (-1422.256) (-1422.443) * (-1422.000) (-1421.918) [-1423.478] (-1425.325) -- 0:00:36
475000 -- [-1424.165] (-1421.935) (-1423.102) (-1426.033) * (-1422.776) (-1423.391) (-1425.559) [-1422.814] -- 0:00:36
Average standard deviation of split frequencies: 0.009321
475500 -- [-1419.923] (-1420.152) (-1421.663) (-1423.757) * (-1422.182) [-1428.695] (-1425.200) (-1422.907) -- 0:00:36
476000 -- (-1419.595) (-1422.353) (-1420.608) [-1422.465] * (-1424.671) [-1422.365] (-1423.700) (-1423.838) -- 0:00:36
476500 -- (-1420.039) (-1421.492) (-1421.526) [-1419.524] * [-1422.889] (-1422.800) (-1424.411) (-1422.564) -- 0:00:36
477000 -- (-1422.988) (-1422.526) [-1421.762] (-1418.913) * (-1424.693) (-1428.296) (-1424.124) [-1421.726] -- 0:00:36
477500 -- [-1421.589] (-1421.306) (-1421.966) (-1421.945) * (-1421.549) (-1425.047) [-1420.832] (-1421.899) -- 0:00:36
478000 -- [-1423.422] (-1422.474) (-1421.407) (-1421.498) * (-1421.760) (-1423.453) [-1420.807] (-1422.681) -- 0:00:36
478500 -- [-1423.823] (-1422.512) (-1422.101) (-1419.523) * (-1422.882) [-1422.232] (-1427.440) (-1422.314) -- 0:00:35
479000 -- (-1421.570) (-1422.029) (-1422.300) [-1420.509] * (-1423.171) (-1421.719) (-1423.030) [-1421.360] -- 0:00:35
479500 -- (-1421.364) [-1421.349] (-1422.625) (-1423.293) * (-1424.640) (-1423.603) [-1421.291] (-1421.344) -- 0:00:35
480000 -- [-1421.492] (-1419.877) (-1421.848) (-1424.560) * (-1421.067) (-1425.450) [-1419.878] (-1421.951) -- 0:00:35
Average standard deviation of split frequencies: 0.009194
480500 -- (-1422.230) (-1421.503) (-1424.828) [-1423.044] * (-1421.372) (-1421.680) (-1420.459) [-1420.651] -- 0:00:35
481000 -- (-1424.955) [-1422.429] (-1425.008) (-1420.975) * (-1421.861) [-1421.482] (-1419.903) (-1423.451) -- 0:00:35
481500 -- (-1426.163) [-1419.594] (-1422.967) (-1427.308) * (-1425.396) (-1423.399) [-1420.039] (-1423.636) -- 0:00:35
482000 -- (-1425.491) [-1421.461] (-1422.013) (-1423.352) * (-1423.777) [-1423.291] (-1421.956) (-1427.499) -- 0:00:35
482500 -- [-1421.563] (-1423.207) (-1424.820) (-1423.809) * (-1426.071) (-1424.366) [-1421.737] (-1425.434) -- 0:00:35
483000 -- (-1421.049) [-1423.761] (-1423.942) (-1421.557) * (-1425.438) [-1423.597] (-1423.888) (-1422.323) -- 0:00:35
483500 -- [-1424.213] (-1422.196) (-1421.324) (-1421.621) * (-1422.155) (-1424.925) [-1426.802] (-1419.997) -- 0:00:35
484000 -- (-1429.413) [-1420.521] (-1422.098) (-1422.669) * (-1421.012) (-1426.738) (-1422.603) [-1422.718] -- 0:00:35
484500 -- [-1420.181] (-1426.110) (-1421.859) (-1424.165) * (-1420.729) (-1425.873) (-1423.651) [-1426.676] -- 0:00:35
485000 -- [-1420.533] (-1422.876) (-1423.469) (-1424.534) * (-1421.552) (-1421.600) (-1421.253) [-1421.739] -- 0:00:35
Average standard deviation of split frequencies: 0.008790
485500 -- (-1423.678) (-1422.608) [-1422.819] (-1423.799) * [-1422.711] (-1423.576) (-1421.755) (-1422.447) -- 0:00:34
486000 -- [-1420.248] (-1421.223) (-1423.499) (-1422.065) * (-1424.021) [-1422.610] (-1423.354) (-1424.372) -- 0:00:35
486500 -- [-1422.138] (-1423.124) (-1422.959) (-1425.016) * (-1421.642) (-1423.070) [-1422.106] (-1424.279) -- 0:00:35
487000 -- (-1422.982) [-1422.096] (-1430.481) (-1422.050) * (-1421.997) (-1422.403) (-1422.353) [-1422.302] -- 0:00:35
487500 -- (-1423.091) [-1420.751] (-1425.726) (-1425.065) * (-1421.666) (-1422.080) (-1422.010) [-1421.988] -- 0:00:35
488000 -- [-1420.984] (-1420.521) (-1429.078) (-1422.604) * [-1422.063] (-1422.069) (-1427.258) (-1423.189) -- 0:00:35
488500 -- (-1422.001) [-1423.659] (-1426.288) (-1422.629) * (-1422.215) (-1422.677) (-1421.665) [-1424.848] -- 0:00:35
489000 -- [-1421.540] (-1425.554) (-1424.134) (-1425.169) * (-1420.489) (-1421.380) (-1419.524) [-1422.739] -- 0:00:35
489500 -- (-1425.414) (-1424.030) (-1425.559) [-1422.585] * [-1421.002] (-1428.619) (-1424.398) (-1428.180) -- 0:00:35
490000 -- (-1424.104) (-1424.471) (-1419.713) [-1422.277] * (-1421.244) (-1424.542) [-1420.315] (-1428.921) -- 0:00:35
Average standard deviation of split frequencies: 0.008346
490500 -- [-1421.779] (-1421.837) (-1423.517) (-1424.495) * (-1426.720) (-1426.143) (-1420.601) [-1423.789] -- 0:00:35
491000 -- (-1424.377) [-1419.203] (-1423.660) (-1423.070) * (-1422.833) (-1422.488) [-1421.094] (-1422.476) -- 0:00:35
491500 -- (-1425.319) [-1420.755] (-1422.506) (-1424.445) * (-1422.993) (-1425.396) (-1421.793) [-1422.517] -- 0:00:35
492000 -- (-1423.974) (-1423.005) [-1419.372] (-1423.764) * [-1421.063] (-1421.389) (-1419.898) (-1420.887) -- 0:00:35
492500 -- (-1421.669) [-1423.079] (-1421.816) (-1424.740) * (-1422.574) (-1421.637) (-1428.009) [-1424.114] -- 0:00:35
493000 -- [-1422.913] (-1424.761) (-1420.111) (-1424.385) * (-1421.401) (-1425.840) [-1423.006] (-1425.128) -- 0:00:34
493500 -- (-1424.356) (-1421.786) [-1419.765] (-1422.353) * (-1420.586) [-1425.100] (-1424.243) (-1420.072) -- 0:00:34
494000 -- (-1422.656) [-1419.599] (-1423.478) (-1422.228) * (-1425.599) (-1422.188) (-1429.129) [-1423.183] -- 0:00:34
494500 -- [-1421.007] (-1423.471) (-1422.676) (-1424.467) * (-1424.770) (-1420.950) [-1420.582] (-1422.431) -- 0:00:34
495000 -- (-1422.633) (-1424.142) [-1425.658] (-1422.991) * (-1428.249) (-1421.060) [-1419.984] (-1422.090) -- 0:00:34
Average standard deviation of split frequencies: 0.008257
495500 -- (-1421.306) [-1422.777] (-1423.856) (-1423.316) * (-1426.235) (-1422.068) (-1422.679) [-1423.893] -- 0:00:34
496000 -- (-1421.844) [-1420.577] (-1423.833) (-1424.938) * (-1423.232) (-1420.980) [-1421.744] (-1425.154) -- 0:00:34
496500 -- (-1419.980) (-1422.697) (-1421.165) [-1422.219] * (-1425.950) (-1420.925) [-1419.817] (-1422.019) -- 0:00:34
497000 -- (-1421.657) (-1421.029) (-1421.737) [-1422.176] * (-1422.833) (-1423.682) (-1421.404) [-1421.614] -- 0:00:34
497500 -- (-1423.342) (-1422.649) (-1421.093) [-1420.774] * (-1421.931) (-1425.348) [-1422.282] (-1423.935) -- 0:00:34
498000 -- (-1421.254) (-1422.615) (-1421.407) [-1421.152] * (-1423.194) [-1422.234] (-1422.095) (-1425.824) -- 0:00:34
498500 -- (-1421.331) [-1420.742] (-1422.516) (-1420.087) * [-1422.996] (-1420.091) (-1422.890) (-1422.139) -- 0:00:34
499000 -- [-1420.859] (-1428.195) (-1422.279) (-1421.564) * (-1423.332) (-1422.909) (-1423.750) [-1421.924] -- 0:00:34
499500 -- (-1427.709) [-1422.087] (-1420.315) (-1420.098) * (-1424.230) [-1426.229] (-1427.405) (-1422.684) -- 0:00:34
500000 -- (-1420.922) (-1423.510) [-1422.533] (-1424.476) * [-1422.624] (-1424.206) (-1426.960) (-1422.875) -- 0:00:35
Average standard deviation of split frequencies: 0.007415
500500 -- [-1421.570] (-1421.497) (-1423.815) (-1422.609) * [-1422.187] (-1421.593) (-1423.272) (-1422.810) -- 0:00:34
501000 -- (-1422.407) [-1423.763] (-1423.338) (-1422.854) * [-1422.452] (-1423.169) (-1422.313) (-1425.015) -- 0:00:34
501500 -- (-1422.026) (-1423.947) [-1423.751] (-1424.696) * [-1422.172] (-1425.856) (-1420.186) (-1425.568) -- 0:00:34
502000 -- [-1421.480] (-1422.138) (-1422.518) (-1420.458) * (-1420.614) [-1421.869] (-1421.972) (-1424.031) -- 0:00:34
502500 -- (-1420.954) (-1422.353) (-1422.967) [-1420.998] * (-1422.032) [-1422.393] (-1419.214) (-1424.458) -- 0:00:34
503000 -- (-1422.824) [-1421.653] (-1425.662) (-1421.854) * [-1423.065] (-1421.138) (-1422.704) (-1422.251) -- 0:00:34
503500 -- (-1423.020) (-1421.509) (-1422.574) [-1420.474] * (-1422.363) (-1426.173) (-1424.404) [-1422.189] -- 0:00:34
504000 -- (-1422.943) (-1424.698) [-1422.751] (-1423.357) * [-1418.884] (-1426.370) (-1420.520) (-1422.168) -- 0:00:34
504500 -- (-1423.376) (-1420.465) [-1420.544] (-1424.448) * (-1422.446) (-1423.211) [-1422.889] (-1424.544) -- 0:00:34
505000 -- (-1426.496) [-1420.259] (-1422.135) (-1422.152) * [-1427.471] (-1421.602) (-1427.691) (-1427.909) -- 0:00:34
Average standard deviation of split frequencies: 0.007837
505500 -- [-1426.406] (-1422.700) (-1420.961) (-1420.831) * (-1421.647) (-1420.476) [-1428.882] (-1423.649) -- 0:00:34
506000 -- [-1427.062] (-1422.139) (-1424.098) (-1423.352) * [-1422.501] (-1423.059) (-1424.576) (-1426.683) -- 0:00:34
506500 -- (-1422.844) [-1420.920] (-1421.715) (-1420.526) * (-1422.346) [-1422.361] (-1422.563) (-1424.006) -- 0:00:34
507000 -- [-1421.949] (-1421.950) (-1420.235) (-1421.638) * (-1421.953) (-1420.198) [-1423.578] (-1423.667) -- 0:00:34
507500 -- (-1421.258) (-1424.778) [-1422.806] (-1420.779) * (-1423.339) (-1420.989) [-1419.967] (-1422.723) -- 0:00:33
508000 -- (-1422.985) (-1421.332) (-1421.301) [-1419.016] * (-1426.106) [-1422.490] (-1420.657) (-1426.796) -- 0:00:33
508500 -- (-1423.100) (-1419.089) [-1420.903] (-1424.528) * (-1422.033) (-1421.958) (-1425.548) [-1420.371] -- 0:00:33
509000 -- (-1420.131) (-1418.628) [-1422.149] (-1426.041) * [-1422.620] (-1421.316) (-1422.236) (-1427.386) -- 0:00:33
509500 -- [-1422.215] (-1419.984) (-1427.520) (-1420.020) * (-1423.122) (-1422.024) (-1423.055) [-1421.559] -- 0:00:33
510000 -- (-1423.215) (-1420.603) [-1420.389] (-1421.148) * (-1421.272) (-1423.269) (-1422.840) [-1420.718] -- 0:00:33
Average standard deviation of split frequencies: 0.007113
510500 -- (-1422.935) (-1420.495) [-1421.029] (-1422.793) * (-1421.704) [-1424.435] (-1424.557) (-1424.626) -- 0:00:33
511000 -- [-1423.608] (-1422.360) (-1421.407) (-1421.141) * (-1419.979) (-1427.175) (-1424.277) [-1421.911] -- 0:00:33
511500 -- (-1421.722) (-1423.548) (-1421.569) [-1420.626] * (-1423.514) (-1430.139) [-1423.154] (-1422.239) -- 0:00:33
512000 -- (-1421.160) [-1422.026] (-1423.868) (-1422.091) * (-1424.423) (-1426.005) [-1424.486] (-1427.026) -- 0:00:33
512500 -- (-1423.300) (-1426.221) (-1422.015) [-1421.487] * [-1420.541] (-1423.894) (-1422.120) (-1423.911) -- 0:00:33
513000 -- (-1422.149) (-1421.248) (-1420.051) [-1420.350] * (-1422.857) [-1421.304] (-1421.926) (-1420.290) -- 0:00:33
513500 -- [-1424.135] (-1422.793) (-1419.735) (-1424.039) * (-1422.664) [-1422.332] (-1422.221) (-1424.616) -- 0:00:33
514000 -- (-1423.167) (-1422.508) (-1421.759) [-1421.583] * (-1423.078) [-1420.402] (-1424.240) (-1423.294) -- 0:00:34
514500 -- (-1422.251) (-1423.341) [-1422.117] (-1420.133) * [-1424.396] (-1420.472) (-1424.168) (-1420.501) -- 0:00:33
515000 -- (-1421.406) (-1424.231) [-1420.271] (-1420.022) * (-1420.846) (-1422.935) [-1420.770] (-1420.469) -- 0:00:33
Average standard deviation of split frequencies: 0.007309
515500 -- [-1426.240] (-1423.947) (-1426.153) (-1423.797) * (-1422.218) (-1422.402) (-1422.429) [-1421.590] -- 0:00:33
516000 -- (-1426.194) (-1425.346) (-1422.465) [-1422.360] * (-1427.464) (-1420.719) (-1426.113) [-1423.422] -- 0:00:33
516500 -- [-1426.254] (-1422.727) (-1420.543) (-1424.200) * (-1431.222) [-1420.377] (-1422.864) (-1421.258) -- 0:00:33
517000 -- (-1424.791) (-1421.439) (-1420.644) [-1424.444] * (-1422.982) (-1421.723) [-1423.455] (-1421.990) -- 0:00:33
517500 -- [-1423.568] (-1421.941) (-1421.491) (-1425.119) * (-1429.157) [-1423.083] (-1423.826) (-1422.883) -- 0:00:33
518000 -- (-1428.755) (-1424.278) (-1422.541) [-1424.541] * (-1424.948) [-1420.044] (-1420.843) (-1420.187) -- 0:00:33
518500 -- [-1421.539] (-1424.768) (-1422.703) (-1427.019) * (-1422.877) [-1423.302] (-1422.683) (-1423.039) -- 0:00:33
519000 -- [-1422.927] (-1421.558) (-1425.830) (-1430.832) * [-1422.914] (-1420.610) (-1422.826) (-1422.676) -- 0:00:33
519500 -- (-1423.888) (-1422.015) [-1423.350] (-1425.873) * (-1424.862) (-1421.966) [-1423.334] (-1422.205) -- 0:00:33
520000 -- (-1422.229) (-1424.538) (-1424.504) [-1422.379] * [-1423.749] (-1421.882) (-1421.180) (-1421.770) -- 0:00:33
Average standard deviation of split frequencies: 0.007300
520500 -- (-1425.319) [-1423.054] (-1424.189) (-1422.297) * (-1420.573) (-1420.179) (-1423.384) [-1423.797] -- 0:00:33
521000 -- (-1426.253) [-1421.219] (-1425.048) (-1421.967) * (-1422.514) (-1423.250) [-1420.815] (-1422.411) -- 0:00:33
521500 -- [-1428.293] (-1422.314) (-1424.210) (-1422.688) * [-1421.573] (-1421.428) (-1421.607) (-1424.732) -- 0:00:33
522000 -- [-1427.105] (-1421.424) (-1422.263) (-1423.831) * (-1421.669) [-1419.741] (-1425.703) (-1422.443) -- 0:00:32
522500 -- (-1423.808) [-1420.710] (-1424.327) (-1425.250) * [-1424.790] (-1423.173) (-1427.339) (-1426.300) -- 0:00:32
523000 -- (-1425.377) (-1422.615) [-1424.381] (-1428.651) * [-1421.846] (-1423.529) (-1426.651) (-1424.304) -- 0:00:32
523500 -- (-1421.947) (-1420.592) (-1422.678) [-1421.936] * [-1429.264] (-1425.013) (-1420.114) (-1423.950) -- 0:00:32
524000 -- (-1422.220) [-1419.888] (-1422.569) (-1423.713) * (-1422.444) [-1422.756] (-1425.681) (-1421.575) -- 0:00:32
524500 -- (-1422.096) [-1423.112] (-1424.953) (-1427.846) * [-1422.165] (-1420.802) (-1422.053) (-1423.071) -- 0:00:32
525000 -- [-1420.874] (-1423.191) (-1422.038) (-1424.085) * (-1422.188) (-1419.260) [-1422.361] (-1420.287) -- 0:00:32
Average standard deviation of split frequencies: 0.007908
525500 -- [-1423.631] (-1422.417) (-1422.227) (-1421.804) * (-1424.934) (-1420.105) (-1424.908) [-1424.967] -- 0:00:32
526000 -- (-1423.760) (-1422.855) (-1422.346) [-1420.691] * (-1423.356) (-1420.024) [-1424.527] (-1420.512) -- 0:00:32
526500 -- (-1421.549) (-1422.917) [-1421.593] (-1422.227) * (-1421.539) (-1419.157) (-1418.516) [-1419.432] -- 0:00:32
527000 -- (-1423.388) [-1425.190] (-1422.043) (-1422.576) * (-1421.651) (-1420.243) [-1419.884] (-1421.233) -- 0:00:32
527500 -- (-1430.329) (-1420.836) [-1420.943] (-1422.891) * (-1423.385) [-1420.592] (-1422.567) (-1421.707) -- 0:00:32
528000 -- (-1430.026) (-1420.972) (-1420.311) [-1425.079] * [-1421.563] (-1420.599) (-1423.408) (-1420.004) -- 0:00:32
528500 -- (-1424.692) (-1423.233) [-1422.913] (-1420.685) * [-1421.806] (-1423.443) (-1430.026) (-1421.993) -- 0:00:32
529000 -- (-1425.411) [-1421.893] (-1421.769) (-1420.187) * (-1422.353) [-1419.938] (-1423.322) (-1421.338) -- 0:00:32
529500 -- (-1423.179) (-1420.757) (-1422.523) [-1420.605] * (-1424.857) [-1420.023] (-1422.759) (-1423.826) -- 0:00:32
530000 -- (-1422.278) (-1422.922) [-1422.180] (-1423.453) * (-1426.832) (-1419.355) (-1422.649) [-1422.053] -- 0:00:32
Average standard deviation of split frequencies: 0.007420
530500 -- (-1425.529) (-1421.979) (-1422.606) [-1423.077] * (-1422.674) [-1419.043] (-1422.948) (-1426.280) -- 0:00:32
531000 -- [-1424.298] (-1422.171) (-1425.951) (-1421.930) * (-1421.686) (-1421.725) (-1421.812) [-1421.324] -- 0:00:32
531500 -- (-1422.156) (-1423.291) [-1422.384] (-1424.649) * (-1422.937) [-1420.747] (-1423.955) (-1421.126) -- 0:00:32
532000 -- (-1422.612) (-1424.999) [-1421.052] (-1423.121) * (-1421.627) [-1425.259] (-1421.734) (-1422.664) -- 0:00:32
532500 -- (-1422.325) [-1422.294] (-1422.165) (-1424.271) * (-1423.565) (-1421.397) [-1419.159] (-1422.926) -- 0:00:32
533000 -- (-1422.524) [-1421.477] (-1422.598) (-1420.750) * [-1422.649] (-1421.291) (-1423.761) (-1421.762) -- 0:00:32
533500 -- (-1424.336) (-1421.288) [-1421.840] (-1421.579) * (-1423.056) (-1421.125) [-1420.289] (-1419.363) -- 0:00:32
534000 -- (-1426.523) (-1421.220) (-1422.384) [-1422.410] * [-1422.299] (-1420.682) (-1419.580) (-1423.501) -- 0:00:32
534500 -- [-1426.735] (-1421.626) (-1421.682) (-1423.944) * (-1420.475) (-1421.512) (-1421.634) [-1424.745] -- 0:00:32
535000 -- (-1425.893) (-1426.434) [-1421.319] (-1419.524) * [-1422.343] (-1421.716) (-1424.404) (-1420.611) -- 0:00:32
Average standard deviation of split frequencies: 0.007812
535500 -- [-1424.328] (-1425.426) (-1421.892) (-1421.291) * [-1423.089] (-1420.834) (-1420.774) (-1421.637) -- 0:00:32
536000 -- (-1423.275) (-1423.347) [-1423.708] (-1422.217) * (-1423.401) [-1420.777] (-1421.129) (-1423.792) -- 0:00:32
536500 -- (-1422.682) (-1422.113) [-1420.894] (-1423.450) * (-1422.042) (-1422.110) [-1424.293] (-1423.331) -- 0:00:31
537000 -- [-1420.739] (-1425.707) (-1423.032) (-1422.408) * [-1420.655] (-1423.360) (-1424.214) (-1423.905) -- 0:00:31
537500 -- (-1421.957) (-1422.138) (-1424.507) [-1420.558] * [-1419.217] (-1422.496) (-1424.203) (-1421.581) -- 0:00:31
538000 -- (-1427.894) [-1420.782] (-1421.997) (-1421.766) * (-1422.493) (-1420.872) (-1423.762) [-1421.137] -- 0:00:31
538500 -- (-1424.137) (-1422.235) [-1421.904] (-1419.664) * (-1422.595) (-1420.343) [-1422.492] (-1419.725) -- 0:00:31
539000 -- (-1422.874) (-1428.630) [-1421.653] (-1423.139) * (-1420.395) (-1421.715) [-1423.403] (-1421.075) -- 0:00:31
539500 -- (-1422.545) (-1427.829) (-1422.354) [-1427.502] * [-1421.526] (-1419.621) (-1423.438) (-1422.648) -- 0:00:31
540000 -- (-1423.455) (-1425.041) (-1423.353) [-1420.301] * (-1424.395) (-1422.877) (-1423.719) [-1421.101] -- 0:00:31
Average standard deviation of split frequencies: 0.007847
540500 -- (-1423.165) [-1427.716] (-1423.223) (-1423.598) * (-1420.602) (-1421.344) (-1424.250) [-1419.789] -- 0:00:31
541000 -- (-1422.602) [-1421.880] (-1423.684) (-1422.382) * [-1422.183] (-1424.977) (-1425.881) (-1420.413) -- 0:00:31
541500 -- (-1423.465) (-1422.143) [-1418.543] (-1423.759) * [-1420.563] (-1423.057) (-1421.653) (-1421.103) -- 0:00:31
542000 -- [-1420.892] (-1423.518) (-1422.500) (-1421.163) * (-1423.604) (-1422.169) (-1422.804) [-1420.203] -- 0:00:31
542500 -- [-1421.162] (-1426.390) (-1420.696) (-1424.942) * (-1421.802) (-1420.626) (-1422.086) [-1420.189] -- 0:00:31
543000 -- (-1422.653) (-1421.111) [-1422.582] (-1422.287) * [-1421.610] (-1422.259) (-1423.080) (-1423.366) -- 0:00:31
543500 -- (-1421.825) (-1427.419) [-1421.659] (-1418.722) * [-1422.698] (-1423.188) (-1423.041) (-1421.072) -- 0:00:31
544000 -- (-1423.748) (-1421.010) [-1420.014] (-1422.640) * (-1421.549) (-1421.836) [-1421.072] (-1423.616) -- 0:00:31
544500 -- (-1421.227) (-1420.125) (-1421.447) [-1420.380] * [-1421.526] (-1420.961) (-1423.515) (-1422.247) -- 0:00:31
545000 -- (-1421.663) (-1422.466) [-1421.126] (-1421.198) * (-1421.313) (-1422.427) (-1421.264) [-1423.058] -- 0:00:31
Average standard deviation of split frequencies: 0.006907
545500 -- [-1422.484] (-1420.748) (-1423.514) (-1423.622) * (-1422.596) [-1422.924] (-1421.682) (-1422.041) -- 0:00:31
546000 -- (-1423.338) [-1422.657] (-1421.645) (-1427.218) * (-1419.932) [-1421.916] (-1420.738) (-1425.869) -- 0:00:31
546500 -- [-1421.682] (-1427.106) (-1424.205) (-1423.072) * (-1422.486) (-1425.119) (-1421.166) [-1422.279] -- 0:00:31
547000 -- (-1421.620) (-1421.971) (-1423.463) [-1422.186] * (-1419.890) [-1422.461] (-1422.644) (-1423.296) -- 0:00:31
547500 -- (-1424.805) [-1423.298] (-1421.885) (-1425.332) * (-1419.600) (-1423.629) (-1422.309) [-1422.427] -- 0:00:31
548000 -- [-1420.378] (-1422.731) (-1423.321) (-1425.702) * [-1420.933] (-1423.928) (-1420.945) (-1421.897) -- 0:00:31
548500 -- [-1420.712] (-1422.969) (-1419.778) (-1423.000) * (-1421.997) (-1423.675) (-1422.444) [-1420.660] -- 0:00:31
549000 -- (-1420.040) (-1424.404) (-1423.320) [-1426.386] * (-1424.211) (-1422.630) (-1424.681) [-1419.209] -- 0:00:31
549500 -- (-1421.565) (-1426.862) (-1420.746) [-1423.345] * (-1421.409) (-1421.637) (-1423.248) [-1420.598] -- 0:00:31
550000 -- (-1420.169) (-1422.968) [-1421.592] (-1419.865) * (-1422.123) (-1422.064) (-1424.811) [-1420.681] -- 0:00:31
Average standard deviation of split frequencies: 0.007503
550500 -- (-1422.349) (-1420.916) [-1423.227] (-1422.687) * (-1423.285) (-1423.960) [-1422.585] (-1421.973) -- 0:00:31
551000 -- (-1421.948) (-1421.252) (-1420.638) [-1423.966] * [-1422.496] (-1422.968) (-1428.190) (-1421.372) -- 0:00:30
551500 -- (-1422.315) (-1420.531) (-1421.482) [-1422.899] * (-1423.432) (-1424.346) (-1428.882) [-1421.087] -- 0:00:30
552000 -- (-1424.116) (-1420.975) [-1421.051] (-1421.731) * (-1424.886) [-1427.786] (-1423.542) (-1420.649) -- 0:00:30
552500 -- (-1423.820) [-1420.303] (-1423.281) (-1424.541) * (-1421.814) [-1421.659] (-1423.415) (-1420.132) -- 0:00:30
553000 -- (-1419.315) (-1422.351) [-1422.501] (-1427.297) * (-1420.730) (-1421.561) [-1423.181] (-1420.827) -- 0:00:30
553500 -- [-1423.827] (-1422.907) (-1420.083) (-1426.588) * [-1420.429] (-1421.161) (-1423.964) (-1421.692) -- 0:00:30
554000 -- [-1422.902] (-1422.185) (-1425.881) (-1421.557) * (-1420.639) [-1421.688] (-1424.037) (-1421.726) -- 0:00:30
554500 -- [-1423.356] (-1421.743) (-1422.720) (-1422.476) * (-1425.039) (-1422.529) (-1424.513) [-1419.375] -- 0:00:30
555000 -- (-1423.541) (-1422.680) (-1422.654) [-1422.784] * [-1420.867] (-1423.556) (-1424.000) (-1424.016) -- 0:00:30
Average standard deviation of split frequencies: 0.007232
555500 -- (-1425.286) (-1422.313) [-1421.721] (-1425.160) * (-1422.320) (-1421.879) (-1426.989) [-1421.316] -- 0:00:30
556000 -- (-1422.055) [-1423.574] (-1424.193) (-1423.020) * (-1420.370) [-1422.270] (-1427.116) (-1424.264) -- 0:00:30
556500 -- (-1419.424) (-1423.190) (-1423.374) [-1421.673] * [-1420.230] (-1422.545) (-1421.259) (-1426.902) -- 0:00:30
557000 -- [-1420.839] (-1422.747) (-1422.565) (-1423.035) * (-1420.656) (-1421.806) [-1425.735] (-1420.031) -- 0:00:30
557500 -- (-1419.185) [-1424.198] (-1421.765) (-1426.236) * (-1420.955) (-1422.607) [-1420.213] (-1421.933) -- 0:00:30
558000 -- [-1419.555] (-1427.069) (-1422.732) (-1423.530) * [-1418.522] (-1422.527) (-1420.621) (-1422.168) -- 0:00:30
558500 -- (-1425.645) (-1422.574) [-1421.799] (-1424.027) * (-1422.596) (-1424.040) (-1422.775) [-1421.495] -- 0:00:30
559000 -- (-1425.142) [-1420.923] (-1425.665) (-1427.971) * [-1419.806] (-1421.963) (-1426.033) (-1422.967) -- 0:00:30
559500 -- (-1425.958) [-1421.602] (-1420.446) (-1422.069) * (-1420.633) (-1422.934) (-1420.084) [-1422.238] -- 0:00:30
560000 -- (-1422.222) (-1421.950) (-1421.484) [-1421.638] * [-1420.418] (-1422.181) (-1419.513) (-1421.402) -- 0:00:30
Average standard deviation of split frequencies: 0.007419
560500 -- [-1421.528] (-1421.637) (-1421.662) (-1423.013) * [-1420.227] (-1425.396) (-1419.942) (-1421.134) -- 0:00:30
561000 -- (-1420.271) [-1420.024] (-1421.478) (-1421.183) * [-1421.602] (-1423.746) (-1421.085) (-1422.412) -- 0:00:30
561500 -- (-1421.055) [-1421.667] (-1421.668) (-1421.743) * (-1423.221) (-1423.861) (-1420.765) [-1420.231] -- 0:00:30
562000 -- (-1420.715) (-1423.470) [-1420.830] (-1422.583) * (-1423.676) [-1422.418] (-1420.048) (-1423.372) -- 0:00:30
562500 -- (-1420.703) (-1432.082) (-1424.494) [-1419.995] * (-1424.287) (-1423.115) (-1421.453) [-1422.669] -- 0:00:30
563000 -- (-1419.481) (-1422.844) (-1420.645) [-1422.039] * (-1419.572) (-1423.922) (-1421.615) [-1421.713] -- 0:00:30
563500 -- [-1422.622] (-1421.622) (-1421.918) (-1423.271) * (-1421.490) (-1422.759) [-1419.952] (-1422.000) -- 0:00:30
564000 -- (-1423.640) (-1424.349) (-1423.906) [-1418.910] * (-1423.054) [-1421.208] (-1421.961) (-1421.388) -- 0:00:30
564500 -- (-1427.370) (-1421.443) (-1422.165) [-1422.138] * (-1421.937) [-1422.391] (-1427.248) (-1422.792) -- 0:00:30
565000 -- (-1422.890) (-1422.984) (-1421.798) [-1420.920] * [-1421.875] (-1422.762) (-1424.555) (-1427.072) -- 0:00:30
Average standard deviation of split frequencies: 0.007006
565500 -- [-1425.157] (-1421.900) (-1421.648) (-1431.365) * (-1421.188) (-1421.111) (-1423.840) [-1423.223] -- 0:00:29
566000 -- (-1420.461) (-1421.769) [-1421.585] (-1423.591) * (-1419.462) (-1421.537) (-1422.070) [-1422.561] -- 0:00:29
566500 -- (-1421.725) (-1423.608) [-1422.150] (-1422.039) * (-1422.554) [-1422.615] (-1421.423) (-1425.024) -- 0:00:29
567000 -- (-1421.570) (-1423.289) (-1420.762) [-1420.058] * [-1423.609] (-1423.641) (-1423.076) (-1421.099) -- 0:00:29
567500 -- (-1423.815) (-1420.572) [-1422.997] (-1419.258) * [-1422.156] (-1421.151) (-1419.890) (-1421.609) -- 0:00:29
568000 -- (-1423.104) [-1420.903] (-1420.866) (-1421.610) * (-1420.433) (-1425.959) [-1423.475] (-1423.529) -- 0:00:29
568500 -- (-1424.924) (-1420.689) (-1419.474) [-1423.064] * (-1421.580) (-1422.484) [-1422.226] (-1421.493) -- 0:00:29
569000 -- (-1421.297) [-1420.259] (-1420.827) (-1423.289) * (-1424.872) (-1421.238) [-1425.349] (-1421.101) -- 0:00:29
569500 -- (-1421.299) (-1424.382) (-1423.870) [-1422.362] * [-1423.305] (-1425.927) (-1423.707) (-1421.902) -- 0:00:29
570000 -- (-1421.715) (-1423.895) (-1420.163) [-1421.698] * (-1422.836) [-1425.368] (-1420.111) (-1427.495) -- 0:00:29
Average standard deviation of split frequencies: 0.007046
570500 -- [-1424.090] (-1422.561) (-1423.522) (-1425.155) * (-1423.844) [-1423.137] (-1423.488) (-1425.904) -- 0:00:29
571000 -- (-1421.801) (-1424.194) (-1420.165) [-1420.298] * (-1423.081) [-1424.657] (-1422.168) (-1423.470) -- 0:00:29
571500 -- (-1421.044) (-1422.003) (-1422.450) [-1421.162] * [-1422.166] (-1422.085) (-1420.640) (-1423.869) -- 0:00:29
572000 -- (-1421.938) [-1422.178] (-1424.122) (-1421.828) * (-1426.227) [-1421.279] (-1422.760) (-1424.590) -- 0:00:29
572500 -- (-1424.055) (-1421.335) (-1424.060) [-1421.281] * (-1423.620) (-1421.174) [-1421.311] (-1423.168) -- 0:00:29
573000 -- (-1424.789) [-1422.696] (-1420.439) (-1420.137) * (-1422.195) [-1421.496] (-1420.727) (-1423.515) -- 0:00:29
573500 -- (-1421.554) [-1425.625] (-1421.970) (-1426.010) * (-1421.148) [-1423.912] (-1419.938) (-1420.457) -- 0:00:29
574000 -- (-1421.054) (-1425.518) [-1420.801] (-1422.218) * (-1420.964) (-1423.171) [-1419.675] (-1419.881) -- 0:00:29
574500 -- (-1425.671) [-1424.464] (-1424.463) (-1423.191) * [-1423.035] (-1425.163) (-1423.072) (-1422.741) -- 0:00:29
575000 -- (-1424.592) (-1423.816) [-1420.610] (-1422.701) * (-1420.390) [-1421.354] (-1422.673) (-1421.064) -- 0:00:29
Average standard deviation of split frequencies: 0.006932
575500 -- (-1420.981) (-1423.893) (-1422.102) [-1423.016] * (-1426.041) (-1422.271) (-1423.920) [-1420.562] -- 0:00:29
576000 -- (-1423.984) [-1421.457] (-1421.846) (-1424.755) * (-1424.954) (-1424.277) [-1423.869] (-1421.670) -- 0:00:29
576500 -- (-1425.245) [-1420.965] (-1422.120) (-1422.413) * (-1424.838) (-1426.328) [-1423.617] (-1420.278) -- 0:00:29
577000 -- (-1423.531) (-1421.365) [-1422.326] (-1423.642) * [-1419.653] (-1425.003) (-1422.474) (-1422.958) -- 0:00:29
577500 -- (-1420.986) (-1422.795) (-1429.672) [-1425.175] * [-1423.075] (-1423.346) (-1426.243) (-1422.223) -- 0:00:29
578000 -- (-1419.866) (-1421.568) (-1420.769) [-1421.401] * (-1424.377) [-1420.819] (-1425.004) (-1422.527) -- 0:00:29
578500 -- (-1425.472) (-1423.776) [-1420.526] (-1423.960) * (-1418.098) (-1422.313) [-1422.949] (-1421.118) -- 0:00:29
579000 -- (-1422.444) [-1420.873] (-1422.421) (-1422.955) * (-1421.541) [-1422.141] (-1425.152) (-1425.875) -- 0:00:29
579500 -- [-1422.875] (-1423.783) (-1420.364) (-1423.250) * (-1421.696) (-1421.771) [-1424.143] (-1424.313) -- 0:00:29
580000 -- [-1423.871] (-1423.223) (-1420.346) (-1422.453) * [-1422.396] (-1419.569) (-1426.183) (-1426.287) -- 0:00:28
Average standard deviation of split frequencies: 0.006542
580500 -- (-1422.019) (-1421.649) (-1421.369) [-1424.326] * (-1422.332) (-1420.352) (-1425.265) [-1423.492] -- 0:00:28
581000 -- (-1422.360) (-1422.272) (-1424.257) [-1424.094] * (-1423.857) (-1422.152) (-1421.674) [-1422.828] -- 0:00:28
581500 -- (-1422.962) [-1420.924] (-1423.864) (-1422.204) * (-1425.053) [-1422.715] (-1421.268) (-1422.944) -- 0:00:28
582000 -- (-1421.188) (-1421.934) (-1421.343) [-1419.535] * (-1423.655) (-1424.160) (-1422.165) [-1421.332] -- 0:00:28
582500 -- (-1421.264) (-1420.942) (-1422.980) [-1422.285] * [-1423.005] (-1423.775) (-1422.869) (-1419.304) -- 0:00:28
583000 -- (-1421.160) (-1420.779) (-1421.951) [-1421.892] * [-1421.630] (-1423.888) (-1419.585) (-1426.487) -- 0:00:28
583500 -- (-1423.861) (-1423.149) [-1421.784] (-1422.237) * (-1423.444) (-1422.874) [-1423.059] (-1421.950) -- 0:00:28
584000 -- (-1423.145) (-1419.906) [-1422.829] (-1421.914) * (-1423.926) (-1430.730) [-1422.681] (-1423.843) -- 0:00:28
584500 -- (-1426.333) (-1422.046) (-1422.254) [-1419.858] * (-1421.325) (-1421.384) [-1421.195] (-1424.164) -- 0:00:28
585000 -- (-1424.787) (-1421.550) [-1420.449] (-1423.980) * [-1423.326] (-1423.339) (-1420.002) (-1421.462) -- 0:00:28
Average standard deviation of split frequencies: 0.006909
585500 -- (-1425.656) (-1421.660) [-1422.321] (-1420.045) * [-1425.889] (-1421.177) (-1422.418) (-1421.777) -- 0:00:28
586000 -- [-1424.791] (-1423.042) (-1421.790) (-1419.565) * [-1421.771] (-1425.092) (-1422.583) (-1421.921) -- 0:00:28
586500 -- (-1422.465) [-1424.738] (-1420.122) (-1418.413) * (-1421.256) (-1422.204) (-1425.136) [-1420.568] -- 0:00:28
587000 -- (-1421.856) (-1422.369) [-1426.127] (-1419.466) * (-1422.469) (-1423.242) (-1421.536) [-1422.659] -- 0:00:28
587500 -- (-1421.761) (-1420.226) [-1424.463] (-1422.118) * (-1422.617) (-1427.308) (-1422.433) [-1422.618] -- 0:00:28
588000 -- (-1423.383) [-1421.452] (-1422.532) (-1423.289) * (-1424.908) (-1427.942) (-1420.860) [-1422.073] -- 0:00:28
588500 -- (-1423.700) (-1425.814) [-1420.962] (-1419.076) * [-1426.802] (-1425.158) (-1428.597) (-1422.354) -- 0:00:28
589000 -- (-1423.018) [-1423.005] (-1420.869) (-1420.448) * (-1425.755) [-1422.406] (-1424.829) (-1422.454) -- 0:00:28
589500 -- (-1423.277) [-1423.634] (-1422.568) (-1419.229) * (-1422.599) (-1424.453) [-1422.989] (-1422.953) -- 0:00:28
590000 -- (-1419.924) (-1423.278) (-1421.873) [-1418.890] * [-1422.059] (-1422.922) (-1422.493) (-1423.298) -- 0:00:28
Average standard deviation of split frequencies: 0.006235
590500 -- (-1426.194) (-1423.020) [-1420.281] (-1422.145) * [-1423.377] (-1425.734) (-1423.078) (-1422.907) -- 0:00:28
591000 -- (-1424.518) [-1422.350] (-1421.195) (-1420.223) * [-1422.696] (-1425.268) (-1424.491) (-1426.340) -- 0:00:28
591500 -- (-1426.517) (-1423.697) [-1420.873] (-1421.109) * [-1421.102] (-1425.137) (-1421.660) (-1424.147) -- 0:00:28
592000 -- (-1425.910) (-1422.717) [-1419.866] (-1424.627) * (-1420.003) (-1421.849) (-1426.323) [-1420.419] -- 0:00:28
592500 -- [-1426.203] (-1422.922) (-1421.492) (-1425.550) * (-1421.640) [-1420.607] (-1421.836) (-1422.105) -- 0:00:28
593000 -- [-1420.725] (-1421.535) (-1421.465) (-1422.394) * [-1421.146] (-1419.994) (-1421.250) (-1421.795) -- 0:00:28
593500 -- (-1427.717) (-1422.122) (-1422.196) [-1422.771] * (-1423.027) [-1423.438] (-1421.378) (-1424.544) -- 0:00:28
594000 -- (-1425.821) (-1419.681) (-1424.028) [-1422.701] * (-1426.607) [-1421.716] (-1422.533) (-1422.431) -- 0:00:28
594500 -- [-1421.172] (-1422.488) (-1427.011) (-1420.957) * (-1421.769) (-1422.473) [-1422.068] (-1422.414) -- 0:00:27
595000 -- [-1420.467] (-1421.698) (-1424.565) (-1425.657) * (-1422.391) (-1423.427) (-1423.304) [-1422.531] -- 0:00:27
Average standard deviation of split frequencies: 0.006772
595500 -- [-1421.969] (-1424.505) (-1422.655) (-1421.077) * (-1423.340) (-1423.423) (-1424.045) [-1423.276] -- 0:00:27
596000 -- (-1421.290) [-1421.957] (-1422.930) (-1422.523) * (-1424.025) [-1423.188] (-1421.198) (-1422.815) -- 0:00:27
596500 -- (-1421.457) (-1424.061) [-1420.915] (-1422.663) * (-1424.050) (-1423.310) [-1421.598] (-1422.396) -- 0:00:27
597000 -- [-1421.844] (-1422.672) (-1422.110) (-1422.088) * [-1422.084] (-1421.645) (-1423.205) (-1425.615) -- 0:00:27
597500 -- (-1422.169) (-1420.447) [-1422.625] (-1423.997) * [-1425.788] (-1429.634) (-1422.240) (-1423.215) -- 0:00:27
598000 -- (-1422.490) (-1420.848) [-1422.119] (-1423.159) * (-1423.833) (-1422.866) (-1420.878) [-1423.327] -- 0:00:27
598500 -- [-1420.840] (-1425.106) (-1423.171) (-1424.435) * (-1424.080) (-1420.718) [-1422.837] (-1421.670) -- 0:00:27
599000 -- (-1419.683) (-1425.389) [-1422.968] (-1423.138) * [-1422.742] (-1424.305) (-1423.819) (-1421.109) -- 0:00:27
599500 -- (-1422.615) (-1424.784) (-1423.036) [-1421.059] * (-1424.327) (-1423.503) (-1422.600) [-1420.242] -- 0:00:27
600000 -- (-1422.158) [-1421.095] (-1424.371) (-1422.065) * (-1423.490) (-1421.270) [-1423.291] (-1423.367) -- 0:00:27
Average standard deviation of split frequencies: 0.006278
600500 -- [-1421.214] (-1424.751) (-1422.245) (-1426.288) * [-1420.961] (-1419.848) (-1424.524) (-1422.809) -- 0:00:27
601000 -- [-1421.099] (-1424.519) (-1424.507) (-1436.757) * (-1422.203) (-1422.612) (-1427.176) [-1423.468] -- 0:00:27
601500 -- (-1425.417) (-1424.610) (-1423.185) [-1422.031] * (-1421.020) (-1424.428) (-1426.180) [-1423.777] -- 0:00:27
602000 -- (-1424.341) [-1420.219] (-1423.032) (-1422.414) * (-1422.675) (-1421.616) (-1424.136) [-1422.675] -- 0:00:27
602500 -- [-1421.226] (-1422.780) (-1424.508) (-1421.625) * [-1422.670] (-1423.256) (-1423.973) (-1421.639) -- 0:00:27
603000 -- (-1422.769) (-1420.051) (-1423.758) [-1424.182] * [-1420.276] (-1422.786) (-1425.533) (-1422.034) -- 0:00:27
603500 -- (-1421.649) (-1425.278) (-1420.385) [-1420.560] * (-1424.766) (-1423.393) [-1423.950] (-1422.313) -- 0:00:27
604000 -- (-1421.195) (-1420.021) (-1422.826) [-1422.742] * (-1422.705) (-1425.479) [-1423.091] (-1420.710) -- 0:00:27
604500 -- (-1424.467) (-1424.115) [-1426.792] (-1427.747) * (-1420.830) (-1424.637) [-1422.269] (-1424.350) -- 0:00:27
605000 -- (-1420.679) (-1422.656) (-1427.439) [-1422.066] * (-1422.044) (-1422.518) (-1422.769) [-1421.844] -- 0:00:27
Average standard deviation of split frequencies: 0.006589
605500 -- [-1423.302] (-1424.098) (-1423.833) (-1422.692) * (-1422.662) [-1420.983] (-1425.520) (-1427.329) -- 0:00:27
606000 -- (-1422.216) [-1421.858] (-1422.830) (-1427.634) * (-1421.215) (-1421.739) [-1421.776] (-1422.591) -- 0:00:27
606500 -- [-1422.978] (-1422.981) (-1431.091) (-1424.152) * (-1422.733) (-1423.258) (-1422.521) [-1423.025] -- 0:00:27
607000 -- (-1422.904) (-1425.993) (-1430.924) [-1422.316] * [-1422.162] (-1426.178) (-1420.996) (-1423.199) -- 0:00:27
607500 -- [-1421.372] (-1421.095) (-1420.106) (-1422.107) * [-1421.688] (-1425.086) (-1425.754) (-1420.426) -- 0:00:27
608000 -- (-1427.192) (-1422.059) (-1421.850) [-1423.381] * (-1421.994) (-1423.177) [-1425.302] (-1423.115) -- 0:00:27
608500 -- (-1424.005) (-1426.814) [-1422.057] (-1424.994) * (-1422.055) (-1424.048) (-1425.358) [-1421.445] -- 0:00:27
609000 -- (-1424.024) [-1420.443] (-1421.358) (-1422.914) * (-1422.993) (-1425.043) [-1423.984] (-1421.800) -- 0:00:26
609500 -- (-1426.575) [-1423.530] (-1423.065) (-1424.091) * (-1425.879) [-1423.978] (-1422.053) (-1420.750) -- 0:00:26
610000 -- [-1422.838] (-1424.409) (-1422.626) (-1423.403) * [-1426.881] (-1423.871) (-1422.701) (-1423.626) -- 0:00:26
Average standard deviation of split frequencies: 0.005790
610500 -- (-1423.361) (-1424.225) (-1422.974) [-1422.627] * [-1424.472] (-1422.767) (-1423.876) (-1423.746) -- 0:00:26
611000 -- (-1420.218) [-1422.096] (-1421.482) (-1425.955) * (-1423.949) (-1423.494) [-1425.540] (-1421.703) -- 0:00:26
611500 -- (-1423.525) (-1422.162) (-1422.970) [-1423.482] * (-1420.592) (-1423.338) [-1423.591] (-1421.484) -- 0:00:26
612000 -- (-1421.492) (-1423.605) (-1421.117) [-1421.460] * (-1421.260) (-1423.412) [-1422.491] (-1422.995) -- 0:00:26
612500 -- (-1421.649) (-1422.491) (-1422.343) [-1422.873] * (-1420.826) (-1422.209) (-1422.225) [-1422.464] -- 0:00:26
613000 -- (-1422.026) (-1422.380) [-1423.172] (-1422.091) * [-1420.984] (-1421.608) (-1426.892) (-1420.136) -- 0:00:26
613500 -- (-1419.910) (-1424.385) [-1423.423] (-1423.901) * (-1420.663) [-1421.871] (-1420.272) (-1419.475) -- 0:00:26
614000 -- (-1423.161) (-1422.893) (-1421.561) [-1426.026] * (-1422.580) [-1422.816] (-1424.526) (-1420.467) -- 0:00:26
614500 -- [-1422.132] (-1423.281) (-1422.950) (-1422.982) * [-1421.079] (-1423.852) (-1427.062) (-1422.127) -- 0:00:26
615000 -- [-1421.583] (-1423.843) (-1421.786) (-1425.881) * [-1420.008] (-1426.383) (-1424.677) (-1422.288) -- 0:00:26
Average standard deviation of split frequencies: 0.005692
615500 -- (-1422.114) (-1421.671) (-1424.357) [-1422.656] * [-1422.473] (-1426.485) (-1426.916) (-1422.424) -- 0:00:26
616000 -- (-1424.215) (-1421.791) [-1422.752] (-1424.207) * [-1421.559] (-1424.942) (-1425.162) (-1424.751) -- 0:00:26
616500 -- (-1421.497) (-1425.092) (-1424.032) [-1422.628] * (-1422.651) (-1427.803) (-1422.125) [-1419.693] -- 0:00:26
617000 -- (-1423.562) [-1421.811] (-1421.609) (-1425.440) * (-1423.528) [-1423.246] (-1422.862) (-1419.697) -- 0:00:26
617500 -- (-1421.130) (-1419.883) (-1422.824) [-1423.422] * (-1424.329) [-1424.029] (-1423.757) (-1435.105) -- 0:00:26
618000 -- (-1422.981) (-1422.098) [-1422.109] (-1422.742) * (-1423.057) (-1426.350) (-1423.805) [-1424.784] -- 0:00:26
618500 -- (-1423.564) (-1418.662) (-1423.965) [-1422.054] * [-1422.305] (-1422.190) (-1422.681) (-1424.552) -- 0:00:26
619000 -- (-1418.866) (-1423.384) (-1425.208) [-1421.849] * [-1421.962] (-1422.665) (-1420.479) (-1420.425) -- 0:00:26
619500 -- (-1423.381) [-1421.717] (-1423.513) (-1419.385) * [-1420.846] (-1429.347) (-1425.671) (-1422.191) -- 0:00:26
620000 -- [-1422.328] (-1422.853) (-1424.396) (-1420.614) * (-1421.851) (-1422.287) (-1423.910) [-1421.605] -- 0:00:26
Average standard deviation of split frequencies: 0.005519
620500 -- [-1421.581] (-1423.804) (-1424.054) (-1422.587) * (-1420.445) (-1424.479) (-1419.875) [-1420.195] -- 0:00:26
621000 -- [-1423.658] (-1422.556) (-1423.267) (-1422.716) * (-1422.574) (-1421.875) (-1418.729) [-1422.402] -- 0:00:26
621500 -- [-1423.943] (-1421.267) (-1422.132) (-1420.392) * (-1422.910) (-1427.167) [-1421.955] (-1423.660) -- 0:00:26
622000 -- (-1422.073) (-1429.036) (-1419.548) [-1424.172] * (-1421.559) [-1423.380] (-1420.605) (-1424.121) -- 0:00:26
622500 -- (-1421.350) (-1435.220) [-1421.818] (-1426.452) * [-1422.111] (-1425.402) (-1420.925) (-1423.597) -- 0:00:26
623000 -- (-1430.289) (-1421.660) (-1423.519) [-1425.780] * (-1423.754) (-1426.930) [-1419.469] (-1422.061) -- 0:00:26
623500 -- [-1422.822] (-1422.351) (-1425.080) (-1425.794) * (-1424.899) (-1423.890) [-1422.799] (-1422.678) -- 0:00:25
624000 -- [-1422.449] (-1422.838) (-1428.603) (-1422.196) * (-1420.651) (-1424.329) [-1420.464] (-1422.889) -- 0:00:25
624500 -- (-1425.144) [-1428.678] (-1425.621) (-1421.617) * (-1421.681) (-1423.498) (-1423.661) [-1422.022] -- 0:00:25
625000 -- (-1425.571) (-1425.519) [-1423.921] (-1422.699) * [-1420.581] (-1425.503) (-1420.371) (-1425.860) -- 0:00:25
Average standard deviation of split frequencies: 0.005472
625500 -- (-1422.736) (-1425.711) [-1418.936] (-1421.899) * (-1422.559) (-1422.342) (-1423.376) [-1420.965] -- 0:00:25
626000 -- (-1421.041) (-1422.506) (-1422.463) [-1421.929] * (-1422.145) (-1421.941) [-1425.648] (-1421.899) -- 0:00:25
626500 -- (-1423.575) (-1423.275) (-1422.360) [-1424.415] * (-1422.707) [-1423.444] (-1422.848) (-1419.678) -- 0:00:25
627000 -- (-1423.305) [-1419.960] (-1423.909) (-1423.372) * (-1420.910) [-1421.171] (-1422.386) (-1421.892) -- 0:00:25
627500 -- [-1420.403] (-1421.832) (-1422.464) (-1426.014) * (-1421.777) [-1421.270] (-1420.522) (-1420.344) -- 0:00:25
628000 -- [-1421.606] (-1421.497) (-1423.677) (-1421.144) * (-1422.796) [-1423.387] (-1423.811) (-1419.597) -- 0:00:25
628500 -- [-1425.825] (-1423.285) (-1422.621) (-1422.165) * (-1421.724) [-1420.588] (-1423.003) (-1421.175) -- 0:00:25
629000 -- (-1422.978) (-1421.744) (-1425.413) [-1422.097] * (-1425.210) [-1419.613] (-1421.243) (-1422.261) -- 0:00:25
629500 -- (-1421.812) [-1423.995] (-1425.425) (-1422.794) * (-1427.203) (-1420.095) (-1420.200) [-1421.956] -- 0:00:25
630000 -- (-1421.759) [-1423.260] (-1423.891) (-1426.476) * (-1422.152) (-1428.449) [-1421.136] (-1422.005) -- 0:00:25
Average standard deviation of split frequencies: 0.005332
630500 -- (-1425.407) (-1422.947) [-1423.671] (-1422.693) * (-1424.175) (-1425.173) (-1428.503) [-1422.705] -- 0:00:25
631000 -- (-1424.417) (-1424.619) [-1427.248] (-1429.084) * [-1422.836] (-1427.318) (-1424.226) (-1422.449) -- 0:00:25
631500 -- (-1424.532) [-1421.615] (-1426.522) (-1421.859) * [-1420.404] (-1424.034) (-1422.327) (-1422.233) -- 0:00:25
632000 -- (-1422.412) (-1422.006) [-1420.448] (-1425.886) * [-1421.428] (-1423.320) (-1422.136) (-1421.581) -- 0:00:25
632500 -- [-1422.792] (-1419.967) (-1420.619) (-1424.380) * (-1425.193) (-1426.546) [-1423.002] (-1423.697) -- 0:00:25
633000 -- (-1423.083) (-1420.935) [-1421.523] (-1422.694) * [-1424.846] (-1423.630) (-1425.150) (-1427.277) -- 0:00:25
633500 -- (-1424.173) (-1421.951) [-1420.958] (-1424.667) * [-1421.290] (-1425.291) (-1422.693) (-1422.921) -- 0:00:25
634000 -- (-1422.388) [-1421.178] (-1421.424) (-1424.477) * (-1424.685) (-1422.562) [-1423.983] (-1425.787) -- 0:00:25
634500 -- (-1423.431) (-1423.881) (-1434.042) [-1423.030] * (-1420.814) (-1422.825) [-1420.949] (-1420.748) -- 0:00:25
635000 -- [-1422.966] (-1422.278) (-1424.838) (-1423.268) * (-1421.320) (-1422.953) (-1423.434) [-1421.719] -- 0:00:25
Average standard deviation of split frequencies: 0.005188
635500 -- (-1424.968) (-1423.652) (-1423.347) [-1423.119] * (-1421.226) (-1427.365) [-1421.976] (-1423.159) -- 0:00:25
636000 -- (-1422.070) (-1423.171) (-1419.757) [-1425.920] * [-1423.486] (-1424.010) (-1420.948) (-1423.623) -- 0:00:25
636500 -- [-1424.311] (-1419.764) (-1420.275) (-1427.957) * (-1421.229) (-1421.550) [-1420.994] (-1422.203) -- 0:00:25
637000 -- (-1423.252) (-1422.374) [-1421.985] (-1423.116) * (-1423.443) (-1426.657) (-1422.208) [-1420.268] -- 0:00:25
637500 -- (-1421.754) [-1420.419] (-1424.646) (-1423.567) * (-1420.394) [-1429.002] (-1420.385) (-1422.989) -- 0:00:25
638000 -- (-1428.512) [-1421.396] (-1426.008) (-1426.608) * (-1424.016) (-1423.551) [-1421.360] (-1423.551) -- 0:00:24
638500 -- [-1419.277] (-1422.420) (-1426.597) (-1421.898) * (-1422.639) (-1422.391) (-1421.479) [-1420.309] -- 0:00:24
639000 -- (-1421.731) (-1422.710) [-1423.150] (-1422.283) * (-1423.955) (-1422.983) [-1422.579] (-1422.713) -- 0:00:24
639500 -- (-1422.664) (-1424.983) (-1423.950) [-1422.703] * (-1424.031) (-1422.284) [-1420.071] (-1422.954) -- 0:00:24
640000 -- (-1424.974) [-1421.044] (-1420.337) (-1424.593) * (-1423.208) (-1423.637) [-1420.074] (-1422.421) -- 0:00:24
Average standard deviation of split frequencies: 0.005151
640500 -- (-1423.191) (-1423.535) (-1423.935) [-1424.860] * [-1423.378] (-1421.965) (-1421.727) (-1424.151) -- 0:00:24
641000 -- [-1422.764] (-1422.250) (-1422.451) (-1425.006) * (-1421.911) (-1423.223) (-1419.487) [-1422.935] -- 0:00:24
641500 -- (-1423.170) (-1425.322) [-1420.865] (-1422.209) * [-1422.061] (-1422.620) (-1423.224) (-1424.859) -- 0:00:24
642000 -- (-1422.158) (-1423.565) (-1423.412) [-1420.594] * [-1422.078] (-1422.248) (-1423.386) (-1421.927) -- 0:00:24
642500 -- (-1423.038) (-1424.522) (-1421.551) [-1423.651] * (-1421.619) [-1423.124] (-1423.094) (-1421.038) -- 0:00:24
643000 -- (-1421.363) [-1423.529] (-1422.627) (-1424.221) * (-1421.614) (-1423.401) [-1420.870] (-1422.565) -- 0:00:24
643500 -- (-1423.109) (-1423.961) [-1423.696] (-1421.605) * (-1420.905) [-1422.621] (-1419.489) (-1420.176) -- 0:00:24
644000 -- (-1421.618) (-1424.318) (-1422.217) [-1422.680] * (-1421.375) (-1424.297) [-1423.512] (-1421.265) -- 0:00:24
644500 -- [-1421.850] (-1421.031) (-1422.188) (-1424.233) * (-1424.721) (-1424.111) (-1420.713) [-1418.976] -- 0:00:24
645000 -- (-1422.099) [-1423.786] (-1420.631) (-1425.708) * (-1423.425) [-1423.456] (-1421.210) (-1423.687) -- 0:00:24
Average standard deviation of split frequencies: 0.005205
645500 -- [-1421.284] (-1421.280) (-1422.598) (-1421.869) * [-1424.542] (-1424.046) (-1422.755) (-1422.987) -- 0:00:24
646000 -- (-1419.720) (-1425.629) (-1423.213) [-1423.766] * (-1421.694) (-1421.395) (-1421.087) [-1425.597] -- 0:00:24
646500 -- (-1421.345) (-1421.922) [-1423.027] (-1421.525) * (-1422.786) (-1422.231) [-1420.555] (-1422.607) -- 0:00:24
647000 -- (-1422.740) [-1422.823] (-1422.499) (-1423.838) * (-1422.725) (-1422.108) (-1424.156) [-1420.415] -- 0:00:24
647500 -- [-1424.939] (-1421.972) (-1420.948) (-1423.634) * (-1422.682) [-1423.853] (-1422.381) (-1427.310) -- 0:00:24
648000 -- (-1421.221) (-1423.204) (-1422.270) [-1425.469] * (-1423.343) [-1423.109] (-1422.058) (-1425.040) -- 0:00:24
648500 -- [-1421.801] (-1422.967) (-1423.056) (-1421.453) * (-1420.992) (-1423.148) (-1421.420) [-1425.299] -- 0:00:24
649000 -- (-1424.063) (-1423.436) (-1428.199) [-1425.531] * (-1422.763) [-1420.957] (-1421.467) (-1423.205) -- 0:00:24
649500 -- (-1424.168) [-1423.823] (-1426.031) (-1424.476) * (-1422.337) (-1420.872) [-1421.752] (-1423.645) -- 0:00:24
650000 -- (-1424.653) (-1424.632) (-1423.921) [-1422.489] * (-1419.721) [-1420.000] (-1421.396) (-1420.501) -- 0:00:24
Average standard deviation of split frequencies: 0.004685
650500 -- [-1422.901] (-1422.940) (-1424.827) (-1418.321) * (-1427.593) (-1426.495) [-1421.761] (-1423.020) -- 0:00:24
651000 -- (-1420.985) (-1425.726) [-1422.214] (-1422.067) * (-1421.461) (-1424.799) (-1422.854) [-1424.820] -- 0:00:24
651500 -- (-1421.770) (-1423.525) [-1425.022] (-1421.605) * (-1427.546) (-1421.805) (-1422.082) [-1422.736] -- 0:00:24
652000 -- (-1425.614) (-1424.173) [-1421.756] (-1422.382) * (-1422.535) (-1422.991) (-1423.073) [-1421.922] -- 0:00:24
652500 -- [-1419.852] (-1424.200) (-1426.432) (-1423.367) * [-1423.567] (-1424.033) (-1422.136) (-1421.996) -- 0:00:23
653000 -- (-1422.355) (-1423.935) [-1422.520] (-1424.246) * (-1424.284) (-1420.096) [-1420.783] (-1421.988) -- 0:00:23
653500 -- (-1421.948) (-1424.725) [-1423.435] (-1430.558) * (-1428.428) (-1421.605) [-1424.183] (-1420.892) -- 0:00:23
654000 -- [-1428.318] (-1423.243) (-1421.591) (-1426.655) * (-1423.408) (-1420.682) (-1423.310) [-1421.804] -- 0:00:23
654500 -- (-1422.602) (-1424.897) [-1422.282] (-1427.471) * (-1426.903) [-1422.019] (-1421.768) (-1423.267) -- 0:00:23
655000 -- (-1422.889) (-1422.327) (-1422.660) [-1422.277] * (-1426.446) (-1425.188) [-1419.234] (-1421.921) -- 0:00:23
Average standard deviation of split frequencies: 0.004791
655500 -- (-1421.914) (-1422.536) [-1421.831] (-1424.041) * (-1422.583) (-1420.282) [-1421.417] (-1422.683) -- 0:00:23
656000 -- (-1423.185) (-1423.179) [-1421.075] (-1423.341) * (-1419.736) [-1421.515] (-1422.639) (-1423.773) -- 0:00:23
656500 -- (-1425.712) (-1426.131) [-1420.933] (-1421.858) * (-1423.495) (-1425.174) [-1422.144] (-1423.220) -- 0:00:23
657000 -- (-1422.722) (-1422.856) [-1422.742] (-1421.652) * (-1422.690) (-1422.818) [-1420.499] (-1421.796) -- 0:00:23
657500 -- (-1421.357) [-1422.425] (-1424.843) (-1424.296) * [-1421.363] (-1423.931) (-1420.358) (-1426.150) -- 0:00:23
658000 -- (-1422.810) (-1425.269) [-1422.255] (-1422.233) * (-1425.694) (-1422.590) (-1421.970) [-1423.587] -- 0:00:23
658500 -- (-1422.009) (-1425.693) [-1420.871] (-1424.933) * (-1428.040) [-1425.129] (-1425.634) (-1423.218) -- 0:00:23
659000 -- (-1421.754) [-1424.302] (-1422.298) (-1421.233) * (-1425.347) (-1424.306) [-1425.423] (-1424.466) -- 0:00:23
659500 -- [-1423.102] (-1421.592) (-1423.952) (-1424.193) * (-1422.783) (-1419.959) [-1422.528] (-1422.653) -- 0:00:23
660000 -- (-1425.263) (-1421.990) (-1424.533) [-1421.689] * (-1422.426) (-1418.710) [-1421.686] (-1422.902) -- 0:00:23
Average standard deviation of split frequencies: 0.005566
660500 -- (-1422.069) (-1422.080) (-1423.866) [-1421.961] * [-1422.373] (-1421.176) (-1422.468) (-1421.243) -- 0:00:23
661000 -- (-1420.595) [-1422.931] (-1425.272) (-1422.995) * (-1422.850) [-1422.056] (-1421.016) (-1423.539) -- 0:00:23
661500 -- [-1420.189] (-1422.347) (-1425.130) (-1427.644) * (-1422.709) [-1422.160] (-1422.106) (-1422.807) -- 0:00:23
662000 -- [-1421.511] (-1423.630) (-1421.772) (-1423.811) * (-1421.568) [-1423.129] (-1422.133) (-1422.804) -- 0:00:23
662500 -- (-1421.061) (-1422.442) (-1421.703) [-1422.867] * (-1421.854) [-1422.166] (-1421.104) (-1422.055) -- 0:00:23
663000 -- [-1422.975] (-1420.367) (-1423.945) (-1422.717) * [-1420.429] (-1421.130) (-1422.854) (-1422.184) -- 0:00:23
663500 -- (-1424.020) (-1422.369) (-1422.003) [-1422.698] * (-1421.122) [-1420.423] (-1421.463) (-1421.841) -- 0:00:23
664000 -- (-1423.116) (-1421.581) (-1422.778) [-1421.651] * (-1422.354) (-1426.845) [-1419.792] (-1422.344) -- 0:00:23
664500 -- [-1420.364] (-1422.877) (-1421.268) (-1422.101) * [-1422.747] (-1423.060) (-1425.517) (-1424.321) -- 0:00:23
665000 -- (-1421.250) (-1419.093) (-1424.145) [-1424.260] * (-1424.266) (-1422.926) [-1427.088] (-1424.249) -- 0:00:23
Average standard deviation of split frequencies: 0.005285
665500 -- [-1421.987] (-1423.603) (-1422.906) (-1424.150) * (-1425.230) (-1424.113) [-1428.749] (-1420.495) -- 0:00:23
666000 -- (-1424.409) (-1424.980) [-1423.936] (-1422.404) * (-1427.190) (-1424.781) (-1426.510) [-1421.149] -- 0:00:23
666500 -- [-1420.009] (-1423.924) (-1423.854) (-1422.888) * (-1424.395) [-1422.777] (-1423.981) (-1422.417) -- 0:00:23
667000 -- (-1428.087) (-1423.368) (-1422.679) [-1421.334] * (-1425.131) [-1423.471] (-1421.577) (-1423.199) -- 0:00:22
667500 -- [-1426.863] (-1421.316) (-1422.349) (-1422.442) * (-1420.957) (-1419.947) [-1420.859] (-1422.999) -- 0:00:22
668000 -- (-1422.603) [-1420.517] (-1421.498) (-1420.999) * (-1420.999) (-1421.594) (-1425.379) [-1420.776] -- 0:00:22
668500 -- [-1422.142] (-1421.724) (-1424.835) (-1429.547) * (-1421.454) (-1421.278) [-1423.612] (-1424.612) -- 0:00:22
669000 -- [-1421.236] (-1424.021) (-1422.515) (-1422.779) * (-1422.614) (-1421.637) [-1423.850] (-1424.297) -- 0:00:22
669500 -- (-1423.413) [-1421.085] (-1421.923) (-1425.711) * [-1422.041] (-1421.665) (-1422.871) (-1421.971) -- 0:00:22
670000 -- (-1423.347) (-1422.317) (-1424.605) [-1422.419] * [-1422.623] (-1425.999) (-1424.668) (-1421.529) -- 0:00:22
Average standard deviation of split frequencies: 0.005389
670500 -- [-1421.366] (-1422.871) (-1422.777) (-1425.396) * (-1422.047) (-1422.745) [-1424.582] (-1422.283) -- 0:00:22
671000 -- (-1420.871) [-1420.679] (-1424.042) (-1425.118) * [-1419.876] (-1420.511) (-1421.661) (-1421.993) -- 0:00:22
671500 -- (-1425.610) (-1421.181) (-1424.236) [-1422.707] * [-1420.199] (-1430.089) (-1420.253) (-1422.548) -- 0:00:22
672000 -- (-1420.806) (-1419.752) [-1421.690] (-1423.885) * (-1423.245) (-1421.708) [-1420.963] (-1422.514) -- 0:00:22
672500 -- (-1423.624) (-1421.823) [-1424.313] (-1423.396) * (-1421.447) (-1423.494) [-1419.676] (-1424.304) -- 0:00:22
673000 -- (-1424.040) (-1423.939) [-1422.069] (-1422.027) * (-1423.105) [-1422.597] (-1421.381) (-1423.591) -- 0:00:22
673500 -- (-1422.500) (-1424.052) (-1425.155) [-1422.605] * (-1420.865) (-1424.643) [-1424.482] (-1422.378) -- 0:00:22
674000 -- (-1423.298) (-1422.019) (-1423.132) [-1423.670] * (-1421.332) (-1425.021) (-1422.789) [-1423.618] -- 0:00:22
674500 -- (-1422.390) [-1422.121] (-1424.807) (-1423.954) * [-1422.078] (-1427.789) (-1423.999) (-1422.975) -- 0:00:22
675000 -- (-1423.801) [-1420.993] (-1428.281) (-1424.564) * [-1420.918] (-1421.667) (-1425.422) (-1423.983) -- 0:00:22
Average standard deviation of split frequencies: 0.005997
675500 -- (-1423.124) (-1421.926) [-1423.288] (-1424.776) * (-1420.751) (-1421.593) [-1421.527] (-1426.555) -- 0:00:22
676000 -- (-1422.398) (-1421.850) (-1422.229) [-1422.850] * (-1424.332) (-1421.674) [-1419.511] (-1422.405) -- 0:00:22
676500 -- [-1420.093] (-1421.642) (-1426.677) (-1422.937) * (-1422.946) (-1424.557) (-1421.703) [-1426.219] -- 0:00:21
677000 -- (-1427.016) (-1424.325) (-1426.523) [-1420.027] * [-1421.901] (-1423.316) (-1421.379) (-1423.694) -- 0:00:22
677500 -- [-1422.947] (-1426.854) (-1423.276) (-1419.677) * (-1423.978) [-1422.229] (-1421.677) (-1425.480) -- 0:00:22
678000 -- [-1421.962] (-1425.886) (-1421.500) (-1421.105) * (-1422.642) (-1421.751) (-1421.634) [-1423.728] -- 0:00:22
678500 -- [-1420.825] (-1423.221) (-1421.599) (-1424.396) * (-1422.367) [-1421.575] (-1423.825) (-1424.654) -- 0:00:22
679000 -- (-1421.538) (-1424.157) [-1422.416] (-1423.345) * [-1420.853] (-1422.981) (-1420.896) (-1421.092) -- 0:00:22
679500 -- [-1422.014] (-1422.856) (-1423.478) (-1419.642) * (-1421.375) (-1423.597) (-1424.822) [-1420.768] -- 0:00:22
680000 -- [-1424.459] (-1424.064) (-1423.260) (-1423.965) * (-1423.239) (-1423.824) (-1423.008) [-1421.255] -- 0:00:22
Average standard deviation of split frequencies: 0.005587
680500 -- (-1426.232) [-1420.484] (-1422.965) (-1420.032) * (-1421.858) (-1422.966) [-1419.092] (-1421.502) -- 0:00:22
681000 -- (-1421.927) [-1422.220] (-1421.922) (-1420.528) * (-1423.640) [-1423.265] (-1421.693) (-1423.979) -- 0:00:22
681500 -- (-1423.522) (-1423.442) (-1423.467) [-1421.094] * (-1422.026) (-1420.387) (-1422.701) [-1421.119] -- 0:00:21
682000 -- (-1421.218) (-1423.229) (-1428.049) [-1419.778] * [-1419.263] (-1423.703) (-1421.607) (-1421.765) -- 0:00:21
682500 -- (-1426.298) [-1423.339] (-1420.774) (-1422.994) * (-1423.558) (-1421.703) (-1419.349) [-1419.264] -- 0:00:21
683000 -- (-1424.332) (-1421.461) [-1421.610] (-1422.895) * (-1420.699) (-1424.388) [-1424.043] (-1425.373) -- 0:00:21
683500 -- (-1422.316) [-1422.017] (-1422.504) (-1423.418) * (-1421.894) [-1421.480] (-1422.847) (-1424.007) -- 0:00:21
684000 -- (-1421.449) (-1425.295) [-1420.740] (-1421.011) * (-1422.551) (-1420.925) [-1423.521] (-1419.113) -- 0:00:21
684500 -- [-1418.745] (-1422.422) (-1421.606) (-1425.193) * (-1418.625) (-1419.893) (-1422.777) [-1424.212] -- 0:00:21
685000 -- (-1421.218) [-1419.876] (-1422.162) (-1421.511) * (-1420.839) (-1421.530) (-1422.062) [-1422.707] -- 0:00:21
Average standard deviation of split frequencies: 0.005452
685500 -- (-1421.357) [-1419.555] (-1425.622) (-1420.749) * (-1420.803) (-1426.398) (-1423.719) [-1424.023] -- 0:00:21
686000 -- (-1422.597) (-1422.383) [-1426.995] (-1423.034) * [-1420.579] (-1421.536) (-1425.259) (-1420.104) -- 0:00:21
686500 -- [-1420.376] (-1422.192) (-1422.952) (-1423.508) * (-1422.696) [-1421.025] (-1423.387) (-1421.218) -- 0:00:21
687000 -- [-1423.718] (-1422.989) (-1423.610) (-1422.067) * (-1421.716) [-1421.819] (-1430.226) (-1422.854) -- 0:00:21
687500 -- (-1421.421) (-1422.795) [-1424.117] (-1420.256) * [-1421.197] (-1422.607) (-1423.040) (-1422.047) -- 0:00:21
688000 -- (-1422.405) (-1425.335) [-1423.225] (-1424.164) * (-1423.578) [-1422.181] (-1419.902) (-1422.788) -- 0:00:21
688500 -- (-1419.969) (-1419.931) (-1422.019) [-1422.242] * (-1421.632) [-1421.929] (-1420.249) (-1421.931) -- 0:00:21
689000 -- (-1421.509) (-1422.324) (-1420.799) [-1420.643] * [-1422.851] (-1420.929) (-1421.545) (-1421.188) -- 0:00:21
689500 -- [-1418.968] (-1423.688) (-1421.599) (-1423.851) * (-1420.033) [-1419.603] (-1424.075) (-1422.953) -- 0:00:21
690000 -- [-1420.379] (-1420.178) (-1422.534) (-1422.623) * (-1420.821) [-1424.404] (-1420.256) (-1423.736) -- 0:00:21
Average standard deviation of split frequencies: 0.006052
690500 -- (-1420.471) [-1422.161] (-1424.844) (-1423.332) * (-1423.054) [-1421.693] (-1425.749) (-1421.023) -- 0:00:21
691000 -- (-1423.903) [-1421.312] (-1427.447) (-1423.877) * (-1420.991) (-1421.690) [-1422.264] (-1421.462) -- 0:00:21
691500 -- (-1423.243) (-1426.553) [-1420.535] (-1423.064) * [-1423.098] (-1423.161) (-1419.087) (-1424.123) -- 0:00:20
692000 -- (-1422.322) (-1428.307) [-1422.172] (-1423.350) * (-1427.882) [-1421.158] (-1423.806) (-1424.558) -- 0:00:21
692500 -- (-1420.675) (-1426.986) [-1421.209] (-1422.627) * (-1420.633) [-1422.119] (-1420.143) (-1425.264) -- 0:00:21
693000 -- (-1422.691) [-1422.733] (-1421.079) (-1426.350) * [-1420.944] (-1423.846) (-1423.911) (-1423.009) -- 0:00:21
693500 -- [-1422.986] (-1421.661) (-1421.937) (-1426.461) * [-1420.408] (-1420.277) (-1424.606) (-1423.655) -- 0:00:21
694000 -- [-1422.961] (-1426.747) (-1421.182) (-1424.568) * (-1422.338) (-1419.987) (-1420.360) [-1422.129] -- 0:00:21
694500 -- (-1423.938) (-1420.920) [-1419.628] (-1422.163) * [-1423.458] (-1424.471) (-1421.106) (-1418.312) -- 0:00:21
695000 -- (-1424.777) (-1422.835) (-1420.151) [-1420.544] * (-1424.408) (-1423.039) (-1423.542) [-1420.663] -- 0:00:21
Average standard deviation of split frequencies: 0.006412
695500 -- (-1421.793) (-1422.117) [-1419.298] (-1421.721) * (-1420.067) [-1421.867] (-1421.850) (-1421.269) -- 0:00:21
696000 -- (-1421.871) (-1422.034) (-1421.073) [-1422.307] * [-1423.665] (-1419.747) (-1424.156) (-1421.333) -- 0:00:20
696500 -- (-1426.868) (-1421.248) [-1421.903] (-1421.635) * [-1424.420] (-1421.796) (-1423.269) (-1421.381) -- 0:00:20
697000 -- (-1426.778) [-1423.249] (-1422.372) (-1424.869) * [-1418.208] (-1424.225) (-1422.630) (-1423.000) -- 0:00:20
697500 -- [-1423.168] (-1423.404) (-1420.931) (-1423.656) * (-1420.596) [-1423.933] (-1425.517) (-1429.168) -- 0:00:20
698000 -- [-1421.936] (-1423.019) (-1424.094) (-1421.705) * (-1425.559) [-1421.661] (-1419.861) (-1428.174) -- 0:00:20
698500 -- (-1421.790) (-1425.732) [-1422.386] (-1420.717) * [-1423.993] (-1421.180) (-1420.224) (-1422.462) -- 0:00:20
699000 -- [-1422.177] (-1422.075) (-1423.265) (-1424.306) * (-1422.926) (-1420.622) [-1422.030] (-1422.755) -- 0:00:20
699500 -- (-1423.055) [-1422.753] (-1420.451) (-1423.988) * (-1422.170) [-1421.526] (-1419.962) (-1425.750) -- 0:00:20
700000 -- [-1428.628] (-1426.768) (-1418.857) (-1422.079) * (-1421.177) (-1422.042) (-1420.025) [-1422.546] -- 0:00:20
Average standard deviation of split frequencies: 0.006504
700500 -- (-1423.090) [-1422.387] (-1420.649) (-1423.367) * (-1423.001) (-1421.518) [-1425.185] (-1421.058) -- 0:00:20
701000 -- (-1423.181) (-1420.161) (-1420.007) [-1422.176] * (-1420.657) (-1419.572) [-1421.373] (-1422.179) -- 0:00:20
701500 -- [-1424.539] (-1426.661) (-1422.179) (-1425.019) * (-1419.847) (-1421.890) (-1423.336) [-1426.547] -- 0:00:20
702000 -- (-1424.648) [-1421.078] (-1424.191) (-1422.474) * (-1423.274) (-1422.023) (-1425.879) [-1428.847] -- 0:00:20
702500 -- (-1423.944) [-1421.558] (-1422.821) (-1422.935) * [-1419.920] (-1420.885) (-1426.229) (-1422.811) -- 0:00:20
703000 -- (-1423.694) (-1421.954) [-1426.466] (-1420.763) * (-1420.992) (-1419.872) (-1426.384) [-1421.475] -- 0:00:20
703500 -- (-1425.805) (-1420.845) [-1421.454] (-1430.562) * [-1423.161] (-1422.980) (-1421.713) (-1420.521) -- 0:00:20
704000 -- (-1424.755) (-1426.755) [-1424.607] (-1425.879) * (-1422.059) (-1422.003) (-1423.124) [-1424.097] -- 0:00:20
704500 -- (-1424.358) (-1425.368) [-1424.127] (-1426.225) * (-1422.520) (-1422.909) (-1423.769) [-1423.412] -- 0:00:20
705000 -- (-1423.191) (-1423.620) [-1422.603] (-1426.985) * (-1421.031) (-1425.619) (-1421.527) [-1420.756] -- 0:00:20
Average standard deviation of split frequencies: 0.006900
705500 -- (-1427.280) [-1421.151] (-1420.661) (-1424.766) * (-1424.302) [-1423.078] (-1422.990) (-1423.473) -- 0:00:20
706000 -- (-1422.917) [-1422.758] (-1425.253) (-1421.133) * [-1418.523] (-1422.083) (-1424.678) (-1421.684) -- 0:00:19
706500 -- (-1423.000) (-1425.237) (-1420.194) [-1421.186] * [-1421.516] (-1422.487) (-1420.057) (-1422.112) -- 0:00:20
707000 -- (-1422.342) (-1423.686) [-1425.181] (-1420.508) * (-1422.612) [-1420.260] (-1423.596) (-1423.371) -- 0:00:20
707500 -- (-1423.148) (-1423.922) (-1421.794) [-1422.664] * (-1422.331) (-1423.459) [-1423.636] (-1421.976) -- 0:00:20
708000 -- (-1423.227) (-1425.054) [-1420.605] (-1421.916) * (-1420.027) [-1419.687] (-1421.906) (-1423.406) -- 0:00:20
708500 -- [-1421.797] (-1425.749) (-1423.890) (-1423.037) * [-1419.814] (-1422.517) (-1424.200) (-1423.979) -- 0:00:20
709000 -- [-1423.269] (-1427.538) (-1421.029) (-1423.092) * [-1418.943] (-1424.047) (-1425.629) (-1424.653) -- 0:00:20
709500 -- (-1423.241) (-1425.457) [-1423.404] (-1422.866) * [-1421.477] (-1420.295) (-1425.304) (-1424.178) -- 0:00:20
710000 -- [-1421.694] (-1424.142) (-1420.294) (-1424.108) * (-1426.375) (-1423.122) (-1422.210) [-1422.482] -- 0:00:20
Average standard deviation of split frequencies: 0.006841
710500 -- (-1421.718) (-1421.831) (-1420.928) [-1422.767] * (-1424.393) (-1425.743) (-1422.225) [-1421.313] -- 0:00:19
711000 -- (-1421.679) (-1421.964) [-1422.972] (-1422.574) * (-1424.797) [-1427.473] (-1421.316) (-1420.706) -- 0:00:19
711500 -- [-1422.480] (-1426.516) (-1421.624) (-1422.937) * (-1426.337) (-1419.557) [-1424.819] (-1424.072) -- 0:00:19
712000 -- (-1426.678) (-1421.315) (-1419.995) [-1422.520] * (-1420.107) (-1420.575) [-1423.822] (-1422.382) -- 0:00:19
712500 -- (-1422.866) (-1423.167) [-1423.281] (-1421.582) * [-1420.275] (-1421.680) (-1422.623) (-1425.969) -- 0:00:19
713000 -- [-1422.871] (-1424.567) (-1423.088) (-1421.417) * (-1419.070) (-1422.456) [-1422.018] (-1420.101) -- 0:00:19
713500 -- [-1421.728] (-1425.114) (-1422.579) (-1421.859) * (-1421.154) [-1424.041] (-1424.984) (-1421.901) -- 0:00:19
714000 -- [-1422.931] (-1421.202) (-1421.464) (-1423.819) * [-1421.957] (-1423.231) (-1421.911) (-1422.853) -- 0:00:19
714500 -- (-1421.983) [-1421.831] (-1423.087) (-1425.029) * [-1422.314] (-1419.900) (-1421.540) (-1419.083) -- 0:00:19
715000 -- (-1424.818) (-1425.405) [-1420.886] (-1422.741) * (-1422.397) [-1422.928] (-1420.413) (-1422.842) -- 0:00:19
Average standard deviation of split frequencies: 0.006954
715500 -- (-1424.279) (-1420.929) [-1422.956] (-1422.612) * [-1420.721] (-1425.135) (-1421.758) (-1421.309) -- 0:00:19
716000 -- (-1425.056) [-1420.616] (-1422.433) (-1423.325) * (-1421.678) (-1422.457) (-1421.821) [-1426.558] -- 0:00:19
716500 -- (-1421.719) (-1420.860) [-1420.399] (-1421.649) * [-1422.536] (-1422.849) (-1422.078) (-1421.987) -- 0:00:19
717000 -- (-1422.573) (-1422.504) [-1426.065] (-1421.453) * (-1422.703) (-1423.376) (-1422.399) [-1421.110] -- 0:00:19
717500 -- [-1421.103] (-1421.069) (-1419.556) (-1424.934) * (-1426.706) (-1423.233) [-1426.961] (-1422.323) -- 0:00:19
718000 -- (-1426.286) (-1422.483) [-1422.732] (-1425.369) * (-1422.601) (-1424.525) (-1424.056) [-1420.655] -- 0:00:19
718500 -- [-1422.921] (-1420.321) (-1424.234) (-1425.607) * (-1422.213) (-1421.528) [-1421.895] (-1423.021) -- 0:00:19
719000 -- (-1422.172) [-1420.052] (-1424.927) (-1423.261) * (-1421.547) (-1421.696) (-1427.297) [-1422.046] -- 0:00:19
719500 -- [-1425.551] (-1419.312) (-1423.647) (-1425.976) * (-1426.154) [-1421.653] (-1424.436) (-1420.275) -- 0:00:19
720000 -- (-1422.428) (-1420.037) (-1424.185) [-1422.009] * [-1424.758] (-1421.348) (-1427.278) (-1419.962) -- 0:00:19
Average standard deviation of split frequencies: 0.006977
720500 -- (-1422.729) [-1418.253] (-1423.329) (-1423.778) * (-1425.867) (-1421.973) [-1424.764] (-1425.005) -- 0:00:19
721000 -- (-1422.150) [-1420.748] (-1422.463) (-1423.910) * (-1425.268) (-1421.417) [-1422.849] (-1421.982) -- 0:00:18
721500 -- (-1422.116) (-1420.433) (-1425.277) [-1423.656] * [-1421.979] (-1421.107) (-1424.206) (-1428.317) -- 0:00:19
722000 -- (-1421.018) (-1419.651) (-1419.985) [-1424.915] * [-1421.980] (-1419.257) (-1424.500) (-1424.491) -- 0:00:19
722500 -- [-1422.489] (-1428.442) (-1422.702) (-1422.669) * (-1421.675) (-1421.643) (-1421.582) [-1422.405] -- 0:00:19
723000 -- (-1421.621) [-1423.060] (-1426.474) (-1422.001) * [-1423.455] (-1419.805) (-1423.648) (-1422.979) -- 0:00:19
723500 -- (-1423.098) (-1419.875) [-1420.042] (-1421.156) * [-1423.357] (-1422.633) (-1425.569) (-1421.340) -- 0:00:19
724000 -- (-1430.281) (-1420.915) (-1423.449) [-1421.148] * (-1427.694) (-1421.202) [-1420.355] (-1421.476) -- 0:00:19
724500 -- (-1421.972) (-1422.308) (-1423.465) [-1421.539] * [-1422.704] (-1424.546) (-1421.836) (-1423.787) -- 0:00:19
725000 -- (-1421.948) (-1422.023) (-1421.336) [-1421.732] * [-1422.185] (-1422.589) (-1422.035) (-1421.432) -- 0:00:18
Average standard deviation of split frequencies: 0.006883
725500 -- (-1421.145) [-1419.641] (-1423.155) (-1423.783) * (-1424.334) (-1424.473) [-1423.852] (-1421.759) -- 0:00:18
726000 -- [-1419.266] (-1419.105) (-1422.545) (-1423.490) * (-1424.149) (-1424.088) (-1420.768) [-1421.685] -- 0:00:18
726500 -- (-1423.105) (-1419.553) [-1421.149] (-1422.825) * (-1424.495) (-1423.441) [-1422.053] (-1423.834) -- 0:00:18
727000 -- [-1420.208] (-1423.697) (-1420.794) (-1423.518) * [-1421.235] (-1427.996) (-1424.602) (-1423.754) -- 0:00:18
727500 -- (-1423.621) (-1423.616) [-1423.830] (-1421.734) * (-1421.782) (-1424.831) (-1422.545) [-1422.215] -- 0:00:18
728000 -- [-1420.676] (-1424.477) (-1422.753) (-1425.155) * (-1421.374) (-1424.126) [-1422.952] (-1421.152) -- 0:00:18
728500 -- (-1421.950) (-1423.811) [-1421.630] (-1422.884) * (-1421.730) (-1425.661) (-1420.667) [-1420.556] -- 0:00:18
729000 -- [-1425.959] (-1422.097) (-1424.667) (-1423.310) * (-1422.085) (-1421.157) (-1419.137) [-1421.059] -- 0:00:18
729500 -- [-1423.424] (-1424.981) (-1422.809) (-1420.188) * [-1422.861] (-1422.896) (-1423.603) (-1421.083) -- 0:00:18
730000 -- (-1421.265) [-1422.082] (-1426.877) (-1425.621) * (-1421.968) (-1422.805) [-1421.871] (-1420.772) -- 0:00:18
Average standard deviation of split frequencies: 0.006538
730500 -- (-1421.687) [-1420.967] (-1423.220) (-1422.708) * (-1422.831) (-1421.204) [-1421.490] (-1422.350) -- 0:00:18
731000 -- (-1419.832) (-1421.280) (-1422.039) [-1420.803] * (-1424.981) (-1420.747) (-1423.403) [-1421.871] -- 0:00:18
731500 -- (-1421.807) [-1421.666] (-1424.502) (-1422.318) * (-1429.166) (-1422.905) [-1422.560] (-1419.499) -- 0:00:18
732000 -- (-1420.693) [-1421.840] (-1423.330) (-1420.170) * (-1424.244) (-1421.879) (-1421.244) [-1423.144] -- 0:00:18
732500 -- (-1420.803) (-1424.955) (-1423.262) [-1422.583] * (-1425.157) [-1422.486] (-1422.763) (-1426.338) -- 0:00:18
733000 -- (-1421.422) (-1424.541) [-1423.356] (-1422.248) * [-1424.562] (-1421.776) (-1422.992) (-1422.160) -- 0:00:18
733500 -- (-1425.719) [-1422.357] (-1424.467) (-1423.521) * (-1422.800) (-1422.016) (-1422.120) [-1425.577] -- 0:00:18
734000 -- (-1423.001) (-1424.956) (-1425.589) [-1421.021] * (-1420.704) [-1424.682] (-1419.112) (-1422.360) -- 0:00:18
734500 -- (-1423.740) [-1422.859] (-1419.969) (-1422.225) * (-1421.507) [-1422.384] (-1424.085) (-1422.119) -- 0:00:18
735000 -- [-1422.220] (-1429.122) (-1419.618) (-1423.452) * (-1427.296) [-1422.168] (-1425.288) (-1424.012) -- 0:00:18
Average standard deviation of split frequencies: 0.006490
735500 -- [-1422.698] (-1419.741) (-1423.159) (-1422.279) * (-1427.384) [-1422.586] (-1423.577) (-1428.937) -- 0:00:17
736000 -- (-1424.760) (-1419.634) (-1426.881) [-1421.364] * (-1424.616) (-1421.255) (-1422.959) [-1422.939] -- 0:00:17
736500 -- (-1422.861) [-1423.157] (-1423.200) (-1421.915) * (-1422.192) [-1421.464] (-1424.268) (-1422.624) -- 0:00:18
737000 -- (-1424.151) (-1421.090) [-1421.691] (-1419.425) * (-1422.607) (-1419.512) [-1428.625] (-1422.304) -- 0:00:18
737500 -- (-1425.185) (-1424.103) (-1421.141) [-1424.070] * (-1422.347) [-1420.112] (-1424.204) (-1426.096) -- 0:00:18
738000 -- [-1424.033] (-1425.515) (-1421.541) (-1418.704) * (-1421.933) [-1421.168] (-1424.076) (-1424.987) -- 0:00:18
738500 -- (-1422.427) (-1423.075) [-1420.026] (-1424.350) * (-1424.058) [-1420.919] (-1421.508) (-1419.859) -- 0:00:18
739000 -- (-1425.062) (-1420.965) [-1421.750] (-1427.614) * (-1423.475) (-1420.925) (-1422.502) [-1419.744] -- 0:00:18
739500 -- (-1423.128) (-1422.112) (-1420.612) [-1423.855] * (-1425.052) [-1421.047] (-1426.351) (-1423.158) -- 0:00:17
740000 -- (-1423.573) [-1418.626] (-1420.066) (-1423.928) * [-1420.093] (-1422.196) (-1421.732) (-1427.318) -- 0:00:17
Average standard deviation of split frequencies: 0.006577
740500 -- (-1426.486) [-1418.935] (-1420.239) (-1425.307) * (-1422.669) (-1423.405) [-1421.550] (-1425.271) -- 0:00:17
741000 -- (-1424.222) (-1421.520) (-1423.704) [-1422.678] * (-1423.032) [-1420.789] (-1424.787) (-1426.814) -- 0:00:17
741500 -- [-1423.316] (-1419.289) (-1421.624) (-1421.888) * (-1424.086) (-1421.919) [-1421.902] (-1425.104) -- 0:00:17
742000 -- (-1424.912) [-1421.160] (-1421.781) (-1424.160) * (-1424.156) (-1422.615) (-1423.126) [-1422.174] -- 0:00:17
742500 -- (-1424.038) [-1421.112] (-1422.753) (-1424.377) * (-1423.875) [-1420.456] (-1425.010) (-1423.152) -- 0:00:17
743000 -- [-1423.635] (-1422.890) (-1423.209) (-1423.730) * (-1422.732) (-1425.849) [-1424.723] (-1420.491) -- 0:00:17
743500 -- (-1420.127) (-1422.805) (-1422.574) [-1421.125] * [-1421.809] (-1420.702) (-1423.397) (-1420.807) -- 0:00:17
744000 -- [-1420.619] (-1427.280) (-1420.719) (-1420.346) * (-1419.663) (-1420.161) (-1422.310) [-1421.308] -- 0:00:17
744500 -- (-1421.203) [-1419.194] (-1421.081) (-1421.257) * (-1421.843) (-1420.942) (-1422.185) [-1423.826] -- 0:00:17
745000 -- (-1421.530) [-1420.532] (-1422.033) (-1425.926) * (-1422.462) (-1420.274) [-1421.600] (-1422.672) -- 0:00:17
Average standard deviation of split frequencies: 0.006403
745500 -- (-1423.778) (-1421.833) [-1421.437] (-1426.064) * (-1422.580) (-1420.673) (-1421.706) [-1420.883] -- 0:00:17
746000 -- (-1424.052) (-1423.216) [-1420.807] (-1421.743) * (-1423.423) [-1421.349] (-1423.623) (-1422.609) -- 0:00:17
746500 -- (-1419.938) (-1424.016) (-1419.977) [-1420.398] * [-1425.761] (-1421.324) (-1421.923) (-1418.678) -- 0:00:17
747000 -- (-1422.553) (-1422.059) (-1424.015) [-1419.552] * (-1425.688) [-1419.603] (-1423.079) (-1422.071) -- 0:00:17
747500 -- (-1425.982) (-1420.647) (-1421.737) [-1420.729] * (-1422.991) (-1429.221) [-1420.848] (-1421.600) -- 0:00:17
748000 -- (-1423.882) (-1421.440) (-1421.627) [-1421.530] * (-1422.193) [-1423.266] (-1420.696) (-1423.833) -- 0:00:17
748500 -- (-1424.811) (-1421.396) [-1419.905] (-1421.533) * (-1424.288) (-1421.038) [-1423.122] (-1421.224) -- 0:00:17
749000 -- (-1422.935) (-1426.697) (-1419.979) [-1421.377] * [-1421.333] (-1422.343) (-1421.281) (-1423.018) -- 0:00:17
749500 -- (-1419.573) (-1421.405) [-1419.970] (-1426.454) * (-1423.177) [-1421.654] (-1420.965) (-1424.005) -- 0:00:17
750000 -- (-1426.181) [-1422.449] (-1420.509) (-1420.235) * [-1421.072] (-1423.135) (-1419.464) (-1422.214) -- 0:00:17
Average standard deviation of split frequencies: 0.006112
750500 -- (-1422.025) (-1420.840) [-1418.549] (-1424.184) * (-1423.327) (-1421.398) [-1422.692] (-1422.630) -- 0:00:16
751000 -- (-1421.889) (-1425.951) [-1420.032] (-1422.937) * (-1424.830) (-1421.956) [-1425.482] (-1424.211) -- 0:00:17
751500 -- (-1421.342) (-1422.925) (-1420.623) [-1421.370] * (-1422.670) (-1419.792) [-1421.238] (-1421.800) -- 0:00:17
752000 -- (-1421.863) [-1423.073] (-1418.026) (-1425.302) * (-1423.559) (-1421.552) (-1421.093) [-1420.064] -- 0:00:17
752500 -- (-1423.690) (-1420.322) [-1418.715] (-1422.588) * (-1424.441) [-1420.827] (-1422.918) (-1420.230) -- 0:00:17
753000 -- [-1420.605] (-1422.806) (-1421.557) (-1426.889) * (-1422.952) [-1418.647] (-1420.148) (-1420.898) -- 0:00:17
753500 -- [-1422.509] (-1423.835) (-1425.402) (-1421.442) * (-1424.673) (-1419.704) [-1423.200] (-1422.062) -- 0:00:17
754000 -- (-1424.856) (-1419.815) [-1424.660] (-1420.534) * [-1421.168] (-1418.256) (-1423.624) (-1423.837) -- 0:00:16
754500 -- (-1420.222) (-1422.092) [-1421.376] (-1423.989) * (-1424.127) (-1421.761) (-1422.930) [-1422.344] -- 0:00:16
755000 -- (-1422.321) [-1422.751] (-1427.270) (-1421.398) * (-1421.604) (-1421.727) (-1420.214) [-1422.423] -- 0:00:16
Average standard deviation of split frequencies: 0.006277
755500 -- (-1423.313) [-1421.135] (-1424.908) (-1423.434) * (-1421.339) (-1423.957) (-1421.969) [-1422.334] -- 0:00:16
756000 -- [-1419.253] (-1420.806) (-1420.871) (-1423.393) * (-1426.356) [-1422.901] (-1422.594) (-1426.036) -- 0:00:16
756500 -- [-1420.463] (-1425.826) (-1420.610) (-1419.771) * (-1423.284) (-1421.321) [-1421.705] (-1423.059) -- 0:00:16
757000 -- [-1421.567] (-1424.967) (-1421.103) (-1424.031) * (-1424.489) (-1423.926) (-1423.026) [-1421.389] -- 0:00:16
757500 -- (-1422.701) (-1422.757) (-1422.082) [-1421.621] * (-1422.804) [-1421.560] (-1421.481) (-1421.385) -- 0:00:16
758000 -- (-1423.029) (-1420.857) (-1423.438) [-1422.077] * (-1421.083) [-1421.669] (-1421.394) (-1424.652) -- 0:00:16
758500 -- (-1422.689) (-1421.707) [-1426.347] (-1420.501) * (-1422.464) [-1421.563] (-1422.556) (-1424.299) -- 0:00:16
759000 -- [-1422.063] (-1421.755) (-1425.608) (-1422.748) * (-1420.433) [-1421.349] (-1422.985) (-1422.425) -- 0:00:16
759500 -- [-1421.582] (-1421.672) (-1422.187) (-1422.905) * (-1420.357) (-1422.620) [-1423.764] (-1422.392) -- 0:00:16
760000 -- (-1423.093) (-1421.719) (-1425.225) [-1424.251] * (-1422.708) [-1420.186] (-1421.873) (-1421.585) -- 0:00:16
Average standard deviation of split frequencies: 0.006197
760500 -- (-1420.191) (-1421.551) (-1424.458) [-1422.317] * (-1422.530) (-1423.609) (-1421.132) [-1420.683] -- 0:00:16
761000 -- (-1421.738) [-1422.803] (-1424.951) (-1422.052) * (-1423.393) (-1422.728) [-1422.577] (-1419.581) -- 0:00:16
761500 -- (-1422.457) [-1422.935] (-1422.964) (-1422.022) * (-1421.418) [-1421.469] (-1423.925) (-1425.376) -- 0:00:16
762000 -- (-1422.942) (-1420.945) [-1422.336] (-1420.388) * [-1421.120] (-1419.310) (-1427.334) (-1425.563) -- 0:00:16
762500 -- (-1421.147) (-1422.290) [-1423.837] (-1420.089) * (-1421.607) (-1424.069) (-1427.625) [-1425.800] -- 0:00:16
763000 -- (-1420.213) (-1420.957) [-1421.627] (-1422.334) * (-1424.426) (-1421.231) [-1421.993] (-1425.451) -- 0:00:16
763500 -- (-1420.481) (-1422.641) (-1421.193) [-1420.420] * (-1420.651) [-1422.260] (-1422.732) (-1421.215) -- 0:00:16
764000 -- (-1419.684) (-1421.944) [-1421.888] (-1420.610) * (-1420.543) (-1421.575) (-1423.718) [-1420.633] -- 0:00:16
764500 -- [-1423.696] (-1424.234) (-1423.524) (-1422.056) * (-1423.392) (-1426.678) (-1425.362) [-1420.488] -- 0:00:16
765000 -- (-1424.489) (-1421.074) [-1425.899] (-1425.023) * (-1425.363) (-1421.206) [-1425.253] (-1421.483) -- 0:00:15
Average standard deviation of split frequencies: 0.006346
765500 -- (-1424.540) (-1423.816) [-1424.319] (-1421.025) * (-1425.089) (-1421.659) (-1426.335) [-1421.065] -- 0:00:15
766000 -- (-1423.637) (-1421.417) [-1426.337] (-1422.988) * (-1422.928) (-1421.829) (-1421.230) [-1421.952] -- 0:00:16
766500 -- (-1425.462) (-1423.587) [-1423.269] (-1422.238) * (-1424.346) (-1420.224) [-1421.977] (-1421.796) -- 0:00:16
767000 -- (-1427.987) (-1420.978) (-1423.883) [-1421.154] * (-1424.142) (-1425.381) (-1423.478) [-1421.644] -- 0:00:16
767500 -- (-1421.974) (-1425.596) [-1421.755] (-1420.830) * (-1423.400) (-1425.345) [-1422.274] (-1422.617) -- 0:00:16
768000 -- [-1423.482] (-1420.525) (-1422.674) (-1422.421) * (-1424.022) (-1424.457) [-1423.445] (-1420.153) -- 0:00:16
768500 -- (-1421.312) (-1421.792) (-1425.710) [-1422.938] * (-1424.044) (-1421.847) [-1421.386] (-1423.837) -- 0:00:15
769000 -- [-1420.998] (-1423.754) (-1423.656) (-1421.840) * [-1422.478] (-1421.469) (-1422.211) (-1425.461) -- 0:00:15
769500 -- (-1421.680) [-1424.357] (-1425.538) (-1420.979) * (-1423.648) [-1420.501] (-1424.655) (-1422.744) -- 0:00:15
770000 -- (-1421.669) (-1420.739) [-1422.648] (-1426.437) * (-1424.213) (-1422.643) (-1423.052) [-1422.205] -- 0:00:15
Average standard deviation of split frequencies: 0.005913
770500 -- (-1421.482) [-1421.283] (-1422.009) (-1421.061) * (-1422.354) (-1421.973) (-1422.282) [-1425.339] -- 0:00:15
771000 -- (-1423.845) (-1422.495) [-1421.585] (-1422.422) * (-1422.257) [-1423.718] (-1422.699) (-1425.324) -- 0:00:15
771500 -- (-1422.451) [-1420.949] (-1424.779) (-1423.002) * (-1422.426) (-1422.861) (-1422.770) [-1425.988] -- 0:00:15
772000 -- (-1423.322) [-1423.046] (-1423.295) (-1423.180) * (-1421.336) (-1423.647) [-1420.715] (-1425.186) -- 0:00:15
772500 -- [-1422.309] (-1422.495) (-1421.505) (-1422.607) * (-1423.472) [-1423.056] (-1421.863) (-1425.778) -- 0:00:15
773000 -- (-1424.678) [-1420.835] (-1421.143) (-1423.505) * [-1420.155] (-1425.596) (-1420.947) (-1422.408) -- 0:00:15
773500 -- [-1422.009] (-1420.505) (-1420.292) (-1420.768) * (-1420.354) (-1424.290) [-1419.745] (-1423.926) -- 0:00:15
774000 -- (-1421.245) [-1420.369] (-1421.438) (-1421.442) * (-1422.463) (-1420.513) (-1422.436) [-1423.545] -- 0:00:15
774500 -- [-1422.153] (-1423.601) (-1420.488) (-1421.461) * (-1421.551) (-1420.338) (-1418.904) [-1422.931] -- 0:00:15
775000 -- (-1426.267) [-1421.658] (-1420.786) (-1423.060) * (-1422.015) (-1424.674) (-1423.437) [-1421.767] -- 0:00:15
Average standard deviation of split frequencies: 0.006037
775500 -- (-1421.659) [-1422.047] (-1422.475) (-1424.328) * [-1422.010] (-1425.324) (-1423.288) (-1421.944) -- 0:00:15
776000 -- [-1420.489] (-1424.839) (-1423.269) (-1426.184) * [-1421.266] (-1423.439) (-1422.566) (-1422.247) -- 0:00:15
776500 -- (-1420.491) [-1420.925] (-1422.076) (-1422.038) * [-1420.874] (-1422.875) (-1423.628) (-1423.685) -- 0:00:15
777000 -- (-1423.814) (-1422.147) (-1425.604) [-1420.812] * (-1424.456) [-1421.279] (-1425.964) (-1423.716) -- 0:00:15
777500 -- (-1420.397) (-1422.234) (-1422.185) [-1424.665] * (-1425.433) (-1432.609) [-1420.629] (-1423.700) -- 0:00:15
778000 -- [-1422.628] (-1422.211) (-1422.961) (-1420.547) * (-1425.010) (-1423.805) (-1421.016) [-1420.911] -- 0:00:15
778500 -- [-1420.400] (-1422.980) (-1422.502) (-1421.866) * (-1423.394) (-1421.036) (-1420.725) [-1421.681] -- 0:00:15
779000 -- [-1422.757] (-1424.076) (-1425.012) (-1422.932) * (-1421.901) (-1422.397) [-1420.190] (-1422.050) -- 0:00:15
779500 -- [-1421.590] (-1422.373) (-1424.869) (-1424.782) * (-1423.961) (-1420.165) [-1420.504] (-1422.235) -- 0:00:14
780000 -- [-1419.277] (-1421.311) (-1421.122) (-1423.087) * (-1422.418) (-1422.511) (-1422.318) [-1423.104] -- 0:00:14
Average standard deviation of split frequencies: 0.006803
780500 -- [-1425.912] (-1421.331) (-1421.856) (-1422.732) * [-1421.223] (-1419.927) (-1422.320) (-1424.506) -- 0:00:14
781000 -- (-1421.989) (-1425.461) [-1424.129] (-1421.963) * [-1420.164] (-1427.099) (-1423.052) (-1422.287) -- 0:00:15
781500 -- [-1422.289] (-1426.526) (-1426.905) (-1431.127) * (-1419.992) (-1421.783) (-1422.229) [-1421.339] -- 0:00:15
782000 -- [-1423.199] (-1425.184) (-1421.756) (-1423.247) * (-1420.349) (-1420.926) (-1422.274) [-1421.817] -- 0:00:15
782500 -- (-1424.088) (-1422.893) (-1419.693) [-1419.746] * (-1420.612) (-1419.531) (-1421.487) [-1422.121] -- 0:00:15
783000 -- (-1422.273) (-1423.832) (-1419.712) [-1421.133] * (-1421.131) [-1418.754] (-1421.178) (-1420.731) -- 0:00:14
783500 -- (-1422.773) (-1424.072) [-1419.146] (-1423.745) * [-1423.406] (-1420.871) (-1421.764) (-1419.629) -- 0:00:14
784000 -- (-1424.462) (-1422.040) [-1422.098] (-1422.045) * [-1421.159] (-1422.262) (-1421.208) (-1420.831) -- 0:00:14
784500 -- (-1424.452) (-1422.713) (-1420.840) [-1420.871] * (-1424.008) [-1424.629] (-1425.572) (-1420.496) -- 0:00:14
785000 -- (-1423.356) [-1421.931] (-1421.760) (-1422.098) * [-1422.078] (-1419.916) (-1422.737) (-1420.418) -- 0:00:14
Average standard deviation of split frequencies: 0.006897
785500 -- (-1421.890) (-1427.881) (-1420.704) [-1422.616] * (-1418.921) (-1419.821) (-1424.000) [-1420.933] -- 0:00:14
786000 -- (-1422.632) (-1421.133) (-1423.066) [-1420.957] * [-1426.780] (-1426.560) (-1421.076) (-1425.389) -- 0:00:14
786500 -- [-1422.437] (-1422.152) (-1423.456) (-1423.993) * (-1420.518) (-1421.492) (-1421.541) [-1420.044] -- 0:00:14
787000 -- (-1422.239) (-1422.847) [-1420.357] (-1424.318) * (-1422.224) [-1421.251] (-1423.827) (-1420.912) -- 0:00:14
787500 -- (-1422.271) (-1423.980) (-1420.287) [-1421.930] * [-1421.531] (-1422.818) (-1423.690) (-1421.497) -- 0:00:14
788000 -- (-1424.374) (-1423.850) (-1423.768) [-1422.113] * (-1424.228) (-1423.026) (-1425.582) [-1421.739] -- 0:00:14
788500 -- [-1422.788] (-1427.226) (-1420.743) (-1423.462) * (-1422.463) (-1423.160) [-1422.094] (-1421.561) -- 0:00:14
789000 -- (-1423.307) (-1425.989) (-1420.246) [-1424.501] * (-1423.019) (-1420.998) [-1421.633] (-1424.034) -- 0:00:14
789500 -- (-1423.970) (-1423.754) (-1419.959) [-1421.708] * (-1422.265) [-1421.802] (-1421.411) (-1422.060) -- 0:00:14
790000 -- [-1423.400] (-1423.639) (-1422.823) (-1422.366) * (-1423.321) [-1420.611] (-1422.126) (-1421.246) -- 0:00:14
Average standard deviation of split frequencies: 0.007192
790500 -- [-1421.968] (-1423.008) (-1421.464) (-1422.490) * (-1424.960) (-1427.969) (-1421.645) [-1421.048] -- 0:00:14
791000 -- (-1421.973) [-1422.176] (-1422.152) (-1423.489) * (-1422.361) (-1422.909) [-1421.738] (-1420.069) -- 0:00:14
791500 -- (-1422.195) [-1421.691] (-1422.008) (-1422.280) * (-1425.103) (-1421.782) [-1424.590] (-1420.488) -- 0:00:14
792000 -- (-1422.934) (-1422.614) [-1425.014] (-1421.591) * (-1422.224) (-1424.247) (-1421.624) [-1423.355] -- 0:00:14
792500 -- (-1423.615) (-1422.232) [-1426.580] (-1424.227) * (-1422.567) [-1422.926] (-1423.841) (-1422.574) -- 0:00:14
793000 -- (-1423.073) (-1421.562) [-1422.155] (-1421.696) * (-1426.289) [-1420.535] (-1423.953) (-1422.753) -- 0:00:14
793500 -- [-1426.226] (-1418.951) (-1419.693) (-1426.370) * (-1429.483) [-1425.327] (-1423.573) (-1422.336) -- 0:00:14
794000 -- (-1420.162) (-1421.859) [-1420.208] (-1423.652) * (-1420.857) [-1424.463] (-1422.069) (-1420.132) -- 0:00:14
794500 -- (-1420.955) (-1423.631) [-1422.938] (-1421.596) * (-1421.809) (-1422.189) [-1422.547] (-1420.583) -- 0:00:13
795000 -- (-1421.976) [-1424.821] (-1422.583) (-1419.982) * (-1421.466) (-1424.829) (-1423.016) [-1421.824] -- 0:00:13
Average standard deviation of split frequencies: 0.007033
795500 -- (-1423.109) (-1425.276) [-1421.504] (-1422.851) * (-1424.372) (-1421.108) [-1422.865] (-1420.408) -- 0:00:13
796000 -- [-1421.624] (-1423.052) (-1422.006) (-1421.436) * (-1422.896) [-1423.975] (-1426.218) (-1418.607) -- 0:00:14
796500 -- (-1424.347) (-1421.362) [-1422.388] (-1421.294) * (-1422.282) (-1421.071) (-1425.326) [-1422.476] -- 0:00:14
797000 -- (-1421.502) (-1422.983) [-1421.630] (-1422.246) * [-1421.478] (-1421.687) (-1425.144) (-1421.192) -- 0:00:14
797500 -- (-1427.063) (-1422.331) (-1420.953) [-1422.793] * [-1423.170] (-1421.258) (-1423.507) (-1421.032) -- 0:00:13
798000 -- (-1422.190) (-1421.516) (-1420.645) [-1419.986] * (-1429.852) (-1423.217) (-1422.946) [-1420.380] -- 0:00:13
798500 -- (-1424.426) (-1422.323) [-1420.314] (-1418.730) * [-1419.974] (-1420.951) (-1422.682) (-1422.124) -- 0:00:13
799000 -- (-1422.889) (-1426.631) (-1423.764) [-1421.191] * (-1425.049) [-1421.855] (-1422.044) (-1422.848) -- 0:00:13
799500 -- [-1422.188] (-1428.693) (-1422.705) (-1420.514) * [-1424.899] (-1422.493) (-1429.145) (-1423.179) -- 0:00:13
800000 -- (-1422.355) (-1421.268) [-1419.744] (-1420.807) * (-1419.892) (-1420.555) (-1425.427) [-1420.110] -- 0:00:13
Average standard deviation of split frequencies: 0.007360
800500 -- (-1422.072) (-1421.720) [-1420.995] (-1421.244) * [-1424.469] (-1421.639) (-1423.808) (-1420.970) -- 0:00:13
801000 -- [-1419.941] (-1421.449) (-1423.601) (-1420.661) * (-1422.006) (-1421.983) (-1424.143) [-1420.660] -- 0:00:13
801500 -- (-1425.866) (-1421.932) [-1421.387] (-1422.323) * [-1422.803] (-1423.474) (-1423.069) (-1422.030) -- 0:00:13
802000 -- (-1422.834) [-1423.495] (-1424.518) (-1423.884) * (-1421.522) (-1422.264) (-1423.693) [-1421.651] -- 0:00:13
802500 -- (-1422.900) [-1419.613] (-1422.595) (-1420.109) * (-1420.836) (-1421.751) (-1423.398) [-1422.790] -- 0:00:13
803000 -- [-1420.049] (-1424.123) (-1424.364) (-1422.831) * (-1422.898) (-1421.390) (-1427.460) [-1421.145] -- 0:00:13
803500 -- (-1426.575) [-1422.788] (-1423.698) (-1422.580) * (-1426.744) (-1421.265) (-1426.487) [-1421.355] -- 0:00:13
804000 -- [-1422.366] (-1420.578) (-1424.468) (-1423.030) * (-1423.103) [-1420.060] (-1423.097) (-1422.589) -- 0:00:13
804500 -- [-1423.119] (-1421.604) (-1423.696) (-1423.381) * (-1425.964) (-1419.712) [-1425.369] (-1424.704) -- 0:00:13
805000 -- (-1425.201) (-1420.179) (-1422.728) [-1421.594] * [-1423.151] (-1423.673) (-1425.804) (-1422.032) -- 0:00:13
Average standard deviation of split frequencies: 0.007567
805500 -- [-1423.884] (-1420.507) (-1420.787) (-1424.353) * [-1421.101] (-1425.193) (-1424.957) (-1423.411) -- 0:00:13
806000 -- [-1422.002] (-1422.389) (-1424.573) (-1425.138) * [-1421.435] (-1428.328) (-1422.071) (-1419.284) -- 0:00:13
806500 -- (-1421.277) [-1422.219] (-1421.756) (-1419.936) * [-1420.346] (-1421.437) (-1428.168) (-1424.328) -- 0:00:13
807000 -- (-1424.157) (-1424.808) [-1425.658] (-1424.896) * (-1419.484) [-1421.018] (-1426.432) (-1422.701) -- 0:00:13
807500 -- (-1421.372) (-1424.023) (-1420.998) [-1422.032] * (-1422.905) (-1424.183) (-1426.652) [-1425.664] -- 0:00:13
808000 -- [-1422.031] (-1425.517) (-1422.549) (-1423.912) * [-1422.231] (-1425.998) (-1423.361) (-1425.602) -- 0:00:13
808500 -- (-1418.969) [-1421.055] (-1420.846) (-1423.131) * (-1421.876) (-1423.646) [-1422.528] (-1420.985) -- 0:00:13
809000 -- [-1420.683] (-1423.169) (-1422.097) (-1422.928) * (-1422.899) (-1427.152) (-1425.272) [-1419.392] -- 0:00:12
809500 -- (-1425.084) (-1422.081) [-1425.017] (-1422.119) * [-1422.212] (-1424.868) (-1422.313) (-1423.283) -- 0:00:12
810000 -- (-1427.026) (-1418.663) [-1421.422] (-1423.501) * (-1424.081) (-1421.350) (-1423.786) [-1423.360] -- 0:00:12
Average standard deviation of split frequencies: 0.007404
810500 -- (-1424.234) [-1419.777] (-1422.180) (-1420.656) * (-1426.780) (-1421.776) [-1423.887] (-1420.629) -- 0:00:13
811000 -- (-1421.733) [-1420.019] (-1426.782) (-1420.903) * (-1422.252) [-1429.643] (-1425.473) (-1423.210) -- 0:00:13
811500 -- (-1420.644) (-1424.546) (-1423.480) [-1420.351] * (-1422.028) [-1424.368] (-1423.146) (-1421.251) -- 0:00:13
812000 -- [-1421.569] (-1423.234) (-1423.998) (-1422.470) * (-1420.472) [-1422.877] (-1425.506) (-1422.697) -- 0:00:12
812500 -- (-1420.225) (-1421.912) [-1422.570] (-1421.495) * (-1421.214) (-1421.181) [-1421.756] (-1423.810) -- 0:00:12
813000 -- [-1423.419] (-1423.887) (-1421.976) (-1423.070) * (-1419.561) (-1422.638) (-1424.843) [-1424.749] -- 0:00:12
813500 -- [-1423.352] (-1419.317) (-1420.285) (-1426.394) * (-1423.600) (-1423.547) [-1420.933] (-1421.282) -- 0:00:12
814000 -- [-1421.247] (-1422.454) (-1419.823) (-1426.374) * (-1422.199) (-1425.998) [-1421.554] (-1422.426) -- 0:00:12
814500 -- (-1425.597) [-1419.196] (-1420.303) (-1422.648) * (-1423.211) (-1428.897) (-1423.573) [-1422.518] -- 0:00:12
815000 -- [-1421.301] (-1421.863) (-1420.170) (-1427.362) * (-1419.818) (-1423.341) [-1421.507] (-1422.144) -- 0:00:12
Average standard deviation of split frequencies: 0.007395
815500 -- (-1422.405) (-1422.829) [-1421.623] (-1425.779) * (-1422.210) (-1425.528) (-1422.195) [-1425.174] -- 0:00:12
816000 -- (-1424.297) (-1425.169) (-1423.500) [-1422.634] * (-1424.530) [-1423.345] (-1424.159) (-1422.381) -- 0:00:12
816500 -- (-1426.171) (-1423.432) (-1423.209) [-1422.473] * (-1424.569) (-1423.400) [-1421.425] (-1424.315) -- 0:00:12
817000 -- (-1425.264) (-1421.216) [-1422.373] (-1424.483) * (-1418.993) [-1423.823] (-1421.822) (-1426.574) -- 0:00:12
817500 -- (-1425.523) (-1421.263) [-1420.534] (-1426.088) * (-1422.135) (-1422.327) [-1420.438] (-1420.814) -- 0:00:12
818000 -- (-1423.791) [-1421.648] (-1422.112) (-1423.791) * [-1424.213] (-1420.968) (-1423.433) (-1420.412) -- 0:00:12
818500 -- (-1422.692) [-1421.623] (-1422.867) (-1420.176) * (-1424.763) [-1422.694] (-1425.507) (-1422.963) -- 0:00:12
819000 -- (-1421.859) (-1422.370) [-1421.180] (-1423.262) * (-1432.506) (-1422.964) (-1422.478) [-1420.373] -- 0:00:12
819500 -- (-1422.225) (-1422.324) [-1421.748] (-1421.581) * (-1428.114) (-1422.496) [-1420.525] (-1421.733) -- 0:00:12
820000 -- [-1420.316] (-1420.990) (-1422.559) (-1425.200) * [-1420.875] (-1423.872) (-1423.413) (-1419.703) -- 0:00:12
Average standard deviation of split frequencies: 0.007314
820500 -- (-1421.283) (-1422.430) [-1421.214] (-1420.702) * (-1419.875) (-1421.717) (-1428.268) [-1420.754] -- 0:00:12
821000 -- (-1423.458) (-1420.119) [-1424.474] (-1422.036) * (-1420.978) (-1422.706) [-1422.668] (-1422.547) -- 0:00:12
821500 -- (-1423.973) [-1421.357] (-1420.989) (-1423.734) * (-1421.255) [-1421.789] (-1424.735) (-1423.697) -- 0:00:12
822000 -- [-1424.300] (-1420.851) (-1423.240) (-1426.262) * [-1422.412] (-1422.422) (-1420.449) (-1422.423) -- 0:00:12
822500 -- (-1421.439) [-1420.358] (-1422.118) (-1421.742) * (-1419.140) [-1422.247] (-1422.667) (-1423.612) -- 0:00:12
823000 -- (-1422.089) (-1421.048) [-1422.155] (-1423.327) * (-1420.409) (-1423.362) (-1421.504) [-1427.611] -- 0:00:12
823500 -- (-1423.884) [-1422.012] (-1424.095) (-1421.223) * (-1421.860) [-1423.335] (-1421.130) (-1426.462) -- 0:00:12
824000 -- (-1422.984) [-1420.460] (-1419.427) (-1422.549) * (-1422.985) [-1422.096] (-1423.556) (-1423.775) -- 0:00:11
824500 -- (-1423.297) (-1421.843) [-1419.226] (-1423.387) * (-1423.834) [-1423.424] (-1422.336) (-1421.516) -- 0:00:11
825000 -- (-1421.091) [-1422.680] (-1420.148) (-1421.906) * (-1423.854) [-1426.696] (-1423.477) (-1423.559) -- 0:00:11
Average standard deviation of split frequencies: 0.006963
825500 -- (-1423.033) [-1422.628] (-1421.117) (-1421.787) * (-1423.647) [-1422.548] (-1422.009) (-1424.077) -- 0:00:12
826000 -- (-1421.699) [-1423.567] (-1420.231) (-1420.571) * (-1424.653) (-1420.946) [-1423.221] (-1422.240) -- 0:00:12
826500 -- [-1419.900] (-1423.693) (-1423.417) (-1423.271) * (-1420.675) (-1422.368) [-1422.276] (-1421.761) -- 0:00:11
827000 -- [-1420.608] (-1421.776) (-1423.699) (-1420.856) * (-1424.297) (-1421.660) (-1423.145) [-1422.419] -- 0:00:11
827500 -- (-1420.968) (-1420.770) (-1426.762) [-1427.363] * (-1422.923) [-1421.804] (-1426.087) (-1423.791) -- 0:00:11
828000 -- (-1422.414) [-1420.659] (-1426.500) (-1421.628) * (-1421.899) [-1421.247] (-1429.110) (-1425.368) -- 0:00:11
828500 -- (-1421.702) [-1420.415] (-1425.026) (-1425.367) * (-1427.654) [-1420.480] (-1421.545) (-1426.272) -- 0:00:11
829000 -- (-1421.914) (-1423.912) [-1421.377] (-1423.004) * (-1426.084) (-1422.886) (-1425.540) [-1422.323] -- 0:00:11
829500 -- (-1426.553) (-1423.209) (-1419.808) [-1421.368] * (-1427.204) (-1423.450) [-1421.860] (-1426.289) -- 0:00:11
830000 -- (-1422.932) (-1422.471) [-1423.755] (-1418.876) * (-1423.356) (-1422.608) [-1423.791] (-1427.423) -- 0:00:11
Average standard deviation of split frequencies: 0.006924
830500 -- (-1422.421) (-1425.217) [-1419.999] (-1420.538) * (-1424.085) [-1422.418] (-1427.739) (-1422.657) -- 0:00:11
831000 -- (-1421.664) [-1423.051] (-1419.236) (-1424.653) * [-1423.882] (-1423.885) (-1421.930) (-1421.927) -- 0:00:11
831500 -- (-1424.911) (-1418.998) [-1422.187] (-1419.532) * (-1423.475) [-1421.304] (-1420.572) (-1422.139) -- 0:00:11
832000 -- [-1421.233] (-1421.705) (-1419.945) (-1420.553) * (-1425.087) [-1421.215] (-1424.443) (-1427.114) -- 0:00:11
832500 -- (-1423.295) (-1423.187) (-1424.708) [-1424.365] * [-1425.280] (-1421.906) (-1420.546) (-1425.910) -- 0:00:11
833000 -- (-1423.046) (-1422.563) [-1420.785] (-1425.184) * (-1426.409) (-1419.697) (-1421.077) [-1421.050] -- 0:00:11
833500 -- (-1423.777) (-1422.156) [-1419.828] (-1420.940) * (-1422.556) (-1420.779) (-1420.432) [-1421.599] -- 0:00:11
834000 -- (-1422.884) (-1423.334) [-1422.332] (-1425.231) * (-1424.279) [-1423.944] (-1421.553) (-1422.238) -- 0:00:11
834500 -- (-1422.610) (-1422.992) (-1425.509) [-1421.815] * [-1422.858] (-1423.259) (-1423.160) (-1422.599) -- 0:00:11
835000 -- (-1424.981) (-1424.246) (-1430.441) [-1419.971] * (-1423.098) (-1424.041) [-1421.388] (-1424.384) -- 0:00:11
Average standard deviation of split frequencies: 0.007067
835500 -- (-1423.312) (-1422.272) (-1423.204) [-1422.008] * (-1425.867) (-1422.029) (-1423.655) [-1423.984] -- 0:00:11
836000 -- (-1421.939) (-1422.821) (-1422.937) [-1424.638] * (-1423.250) (-1421.762) [-1423.229] (-1425.934) -- 0:00:11
836500 -- (-1423.100) [-1421.210] (-1423.638) (-1421.559) * (-1421.856) (-1421.901) (-1420.451) [-1420.995] -- 0:00:11
837000 -- [-1422.429] (-1422.077) (-1423.431) (-1419.794) * (-1422.394) (-1420.834) (-1419.809) [-1422.686] -- 0:00:11
837500 -- (-1420.725) (-1421.716) [-1421.747] (-1424.015) * (-1421.530) (-1422.302) [-1419.910] (-1422.324) -- 0:00:11
838000 -- (-1422.277) (-1421.993) (-1421.129) [-1421.623] * (-1421.937) (-1421.599) (-1428.831) [-1424.832] -- 0:00:11
838500 -- (-1421.188) (-1425.155) [-1419.873] (-1419.413) * [-1420.260] (-1423.151) (-1424.014) (-1422.620) -- 0:00:10
839000 -- (-1423.272) [-1423.370] (-1422.485) (-1421.795) * [-1422.478] (-1426.373) (-1425.671) (-1422.827) -- 0:00:10
839500 -- (-1425.478) [-1419.595] (-1423.870) (-1422.599) * (-1420.787) (-1423.688) [-1426.040] (-1421.171) -- 0:00:10
840000 -- (-1424.000) (-1424.038) (-1423.040) [-1422.122] * (-1423.266) [-1422.163] (-1425.280) (-1423.701) -- 0:00:10
Average standard deviation of split frequencies: 0.006804
840500 -- [-1421.774] (-1427.310) (-1422.011) (-1423.929) * (-1427.154) (-1422.491) [-1422.046] (-1421.653) -- 0:00:11
841000 -- (-1427.804) (-1423.405) [-1423.083] (-1423.644) * (-1420.953) (-1422.197) (-1422.089) [-1421.660] -- 0:00:10
841500 -- (-1427.302) [-1422.997] (-1422.458) (-1422.425) * [-1418.366] (-1421.197) (-1423.368) (-1433.479) -- 0:00:10
842000 -- (-1424.434) (-1420.878) [-1422.889] (-1424.665) * (-1422.479) (-1422.295) (-1427.314) [-1421.421] -- 0:00:10
842500 -- (-1424.830) (-1421.038) (-1419.538) [-1421.933] * (-1419.189) (-1420.167) (-1421.174) [-1420.087] -- 0:00:10
843000 -- (-1424.543) (-1420.333) [-1420.135] (-1425.055) * [-1421.246] (-1421.544) (-1420.595) (-1422.479) -- 0:00:10
843500 -- [-1420.834] (-1421.409) (-1422.792) (-1423.919) * (-1422.477) (-1422.553) (-1425.188) [-1420.246] -- 0:00:10
844000 -- (-1423.707) [-1424.983] (-1423.613) (-1424.194) * (-1420.372) (-1421.165) [-1424.751] (-1421.146) -- 0:00:10
844500 -- (-1422.570) [-1420.973] (-1423.138) (-1423.865) * (-1424.204) [-1422.321] (-1423.977) (-1419.594) -- 0:00:10
845000 -- (-1423.228) [-1424.627] (-1421.041) (-1421.938) * [-1422.317] (-1424.767) (-1422.565) (-1422.887) -- 0:00:10
Average standard deviation of split frequencies: 0.006835
845500 -- (-1423.277) (-1421.482) [-1420.687] (-1423.658) * [-1424.025] (-1425.524) (-1421.804) (-1422.180) -- 0:00:10
846000 -- (-1420.374) (-1422.944) (-1421.358) [-1422.091] * (-1423.604) [-1422.229] (-1423.276) (-1420.830) -- 0:00:10
846500 -- [-1421.633] (-1421.759) (-1419.863) (-1425.614) * [-1424.301] (-1421.660) (-1423.942) (-1424.386) -- 0:00:10
847000 -- (-1419.355) [-1424.029] (-1423.118) (-1424.176) * (-1420.908) [-1421.621] (-1420.727) (-1423.276) -- 0:00:10
847500 -- [-1421.069] (-1421.366) (-1421.606) (-1426.746) * (-1427.462) (-1421.749) [-1421.728] (-1425.458) -- 0:00:10
848000 -- [-1421.077] (-1422.627) (-1420.757) (-1422.074) * (-1424.094) [-1421.717] (-1423.846) (-1422.150) -- 0:00:10
848500 -- [-1421.359] (-1421.866) (-1425.427) (-1426.049) * (-1420.907) [-1420.464] (-1421.822) (-1423.045) -- 0:00:10
849000 -- (-1422.817) (-1420.174) (-1425.903) [-1426.174] * [-1423.338] (-1423.079) (-1426.125) (-1422.575) -- 0:00:10
849500 -- (-1427.141) [-1421.968] (-1422.732) (-1425.269) * (-1421.816) [-1421.414] (-1427.943) (-1420.898) -- 0:00:10
850000 -- [-1421.083] (-1423.794) (-1425.807) (-1423.383) * (-1422.142) [-1421.643] (-1422.769) (-1424.502) -- 0:00:10
Average standard deviation of split frequencies: 0.006982
850500 -- [-1422.003] (-1421.508) (-1431.455) (-1422.213) * (-1424.610) [-1423.123] (-1423.226) (-1424.762) -- 0:00:10
851000 -- (-1419.825) (-1420.208) (-1421.809) [-1421.704] * (-1423.396) (-1419.604) [-1420.260] (-1424.662) -- 0:00:10
851500 -- (-1419.461) (-1421.803) (-1424.753) [-1419.920] * (-1423.448) (-1421.265) [-1420.412] (-1424.323) -- 0:00:10
852000 -- (-1422.260) [-1421.400] (-1423.735) (-1422.751) * (-1422.004) [-1423.005] (-1423.622) (-1428.799) -- 0:00:10
852500 -- [-1419.524] (-1423.501) (-1423.620) (-1420.837) * (-1424.024) [-1422.722] (-1420.903) (-1421.867) -- 0:00:10
853000 -- (-1421.378) (-1421.473) (-1425.892) [-1422.327] * (-1422.765) (-1422.547) (-1422.894) [-1422.040] -- 0:00:09
853500 -- (-1427.028) (-1422.049) (-1424.859) [-1423.823] * (-1423.654) (-1422.495) (-1422.830) [-1423.334] -- 0:00:09
854000 -- (-1421.318) (-1422.347) (-1423.281) [-1424.576] * [-1422.755] (-1424.805) (-1422.029) (-1422.412) -- 0:00:10
854500 -- (-1422.082) (-1425.624) [-1422.495] (-1422.155) * (-1423.527) [-1419.756] (-1423.162) (-1424.676) -- 0:00:10
855000 -- (-1423.777) (-1424.394) [-1423.638] (-1421.297) * (-1426.099) (-1420.917) (-1421.288) [-1425.038] -- 0:00:10
Average standard deviation of split frequencies: 0.007306
855500 -- (-1421.795) (-1423.348) (-1423.644) [-1423.903] * (-1422.914) (-1422.129) [-1423.480] (-1424.659) -- 0:00:09
856000 -- (-1421.502) [-1422.626] (-1423.213) (-1423.125) * [-1422.342] (-1420.598) (-1424.983) (-1420.943) -- 0:00:09
856500 -- [-1421.982] (-1422.283) (-1423.843) (-1422.874) * [-1422.742] (-1421.046) (-1423.010) (-1422.170) -- 0:00:09
857000 -- (-1422.167) (-1422.541) [-1424.473] (-1429.219) * (-1421.422) (-1421.847) (-1420.185) [-1419.876] -- 0:00:09
857500 -- [-1423.936] (-1422.052) (-1424.105) (-1421.740) * [-1423.772] (-1421.995) (-1422.534) (-1425.651) -- 0:00:09
858000 -- (-1424.100) (-1421.805) (-1424.202) [-1423.028] * (-1423.761) (-1423.222) [-1422.210] (-1421.227) -- 0:00:09
858500 -- [-1424.001] (-1421.450) (-1423.454) (-1422.751) * (-1422.270) [-1423.004] (-1422.653) (-1421.011) -- 0:00:09
859000 -- (-1420.051) (-1422.267) [-1421.136] (-1423.674) * (-1424.096) (-1423.835) (-1422.412) [-1421.497] -- 0:00:09
859500 -- (-1425.072) (-1421.473) (-1422.775) [-1420.776] * (-1421.432) (-1424.976) (-1420.700) [-1420.966] -- 0:00:09
860000 -- (-1423.245) [-1422.043] (-1419.691) (-1421.358) * (-1421.408) [-1421.812] (-1428.368) (-1423.175) -- 0:00:09
Average standard deviation of split frequencies: 0.007778
860500 -- (-1424.387) (-1423.649) [-1423.072] (-1422.117) * [-1422.337] (-1421.307) (-1422.544) (-1423.086) -- 0:00:09
861000 -- (-1424.028) [-1424.225] (-1422.295) (-1421.727) * (-1422.177) (-1421.740) (-1423.988) [-1422.895] -- 0:00:09
861500 -- (-1423.661) [-1422.446] (-1423.953) (-1423.901) * [-1422.614] (-1420.749) (-1420.721) (-1420.445) -- 0:00:09
862000 -- [-1422.628] (-1425.374) (-1422.625) (-1423.856) * (-1427.193) (-1423.570) (-1422.872) [-1423.403] -- 0:00:09
862500 -- (-1421.064) (-1425.641) (-1422.433) [-1422.085] * [-1422.567] (-1423.429) (-1425.808) (-1421.180) -- 0:00:09
863000 -- (-1418.807) [-1423.189] (-1420.363) (-1420.086) * [-1423.347] (-1423.786) (-1421.480) (-1421.226) -- 0:00:09
863500 -- (-1419.638) [-1421.159] (-1424.194) (-1424.303) * (-1422.660) (-1423.051) (-1423.530) [-1422.087] -- 0:00:09
864000 -- (-1421.789) (-1422.846) (-1421.780) [-1424.066] * (-1423.030) [-1421.220] (-1423.147) (-1422.516) -- 0:00:09
864500 -- (-1419.744) [-1421.417] (-1424.131) (-1423.556) * (-1419.772) (-1423.815) (-1426.316) [-1423.079] -- 0:00:09
865000 -- (-1422.012) [-1419.440] (-1423.559) (-1424.403) * (-1427.651) (-1420.911) [-1424.784] (-1420.530) -- 0:00:09
Average standard deviation of split frequencies: 0.007839
865500 -- (-1422.661) (-1421.973) [-1420.220] (-1420.509) * [-1423.854] (-1420.234) (-1421.600) (-1421.480) -- 0:00:09
866000 -- [-1421.441] (-1428.775) (-1426.466) (-1422.062) * (-1421.637) (-1420.232) (-1420.632) [-1425.334] -- 0:00:09
866500 -- (-1423.525) (-1424.841) (-1422.175) [-1425.977] * (-1424.094) (-1419.774) (-1421.573) [-1419.280] -- 0:00:09
867000 -- (-1425.215) [-1424.840] (-1421.614) (-1424.275) * (-1424.484) (-1420.027) (-1420.011) [-1421.406] -- 0:00:09
867500 -- [-1421.654] (-1423.005) (-1423.095) (-1421.947) * (-1422.604) [-1420.638] (-1426.828) (-1423.547) -- 0:00:09
868000 -- (-1420.035) (-1422.111) (-1423.338) [-1422.192] * [-1422.987] (-1423.305) (-1425.550) (-1424.011) -- 0:00:08
868500 -- (-1421.555) [-1421.258] (-1423.607) (-1422.466) * (-1421.956) (-1423.559) (-1420.925) [-1422.513] -- 0:00:09
869000 -- (-1420.610) (-1423.164) [-1423.368] (-1423.036) * (-1421.966) (-1421.171) (-1423.248) [-1422.000] -- 0:00:09
869500 -- [-1421.396] (-1422.897) (-1421.981) (-1424.842) * (-1422.777) [-1420.683] (-1425.251) (-1423.472) -- 0:00:09
870000 -- (-1422.219) [-1419.407] (-1422.505) (-1427.553) * (-1426.272) (-1425.447) [-1420.385] (-1422.281) -- 0:00:08
Average standard deviation of split frequencies: 0.007652
870500 -- (-1421.143) (-1424.233) [-1423.242] (-1423.417) * (-1424.158) (-1421.679) (-1421.190) [-1421.971] -- 0:00:08
871000 -- (-1424.444) (-1423.299) [-1421.305] (-1424.080) * (-1423.659) (-1421.528) [-1423.486] (-1422.143) -- 0:00:08
871500 -- (-1425.522) [-1420.786] (-1422.407) (-1421.686) * (-1422.267) [-1422.207] (-1423.514) (-1426.096) -- 0:00:08
872000 -- (-1428.568) (-1422.766) [-1421.355] (-1418.752) * [-1422.182] (-1422.530) (-1422.302) (-1422.195) -- 0:00:08
872500 -- (-1422.471) (-1422.704) [-1423.444] (-1425.712) * [-1419.266] (-1422.439) (-1423.202) (-1422.218) -- 0:00:08
873000 -- (-1423.669) (-1422.276) (-1422.829) [-1421.773] * (-1424.512) (-1425.320) [-1423.460] (-1425.201) -- 0:00:08
873500 -- [-1424.508] (-1424.511) (-1424.790) (-1423.041) * (-1420.707) (-1424.764) [-1422.626] (-1421.707) -- 0:00:08
874000 -- (-1423.044) (-1421.867) [-1422.931] (-1421.589) * (-1423.516) (-1423.149) (-1423.444) [-1421.720] -- 0:00:08
874500 -- (-1426.280) (-1424.485) [-1423.739] (-1426.167) * (-1422.663) (-1420.840) (-1421.531) [-1423.762] -- 0:00:08
875000 -- [-1423.950] (-1421.506) (-1420.234) (-1426.113) * (-1420.655) [-1419.927] (-1420.129) (-1423.172) -- 0:00:08
Average standard deviation of split frequencies: 0.007319
875500 -- [-1421.375] (-1423.248) (-1422.137) (-1426.218) * [-1421.084] (-1427.589) (-1422.002) (-1421.657) -- 0:00:08
876000 -- (-1424.750) (-1422.824) [-1420.169] (-1430.891) * [-1420.704] (-1423.821) (-1423.468) (-1422.151) -- 0:00:08
876500 -- (-1423.623) (-1425.982) (-1421.499) [-1419.931] * [-1420.356] (-1424.066) (-1420.872) (-1424.449) -- 0:00:08
877000 -- [-1421.135] (-1423.797) (-1423.627) (-1420.547) * (-1423.919) (-1425.391) (-1424.765) [-1420.902] -- 0:00:08
877500 -- [-1423.675] (-1423.430) (-1420.502) (-1422.751) * (-1422.004) [-1422.457] (-1422.596) (-1422.039) -- 0:00:08
878000 -- (-1425.470) (-1423.102) (-1422.540) [-1421.950] * (-1422.786) (-1424.698) [-1420.774] (-1421.891) -- 0:00:08
878500 -- (-1423.565) (-1425.591) [-1421.706] (-1423.295) * (-1421.239) (-1426.726) [-1421.430] (-1423.734) -- 0:00:08
879000 -- (-1422.661) (-1421.449) [-1420.776] (-1422.969) * [-1422.189] (-1424.926) (-1421.560) (-1421.969) -- 0:00:08
879500 -- (-1421.943) (-1423.129) (-1419.198) [-1419.532] * (-1419.899) [-1420.098] (-1421.503) (-1428.296) -- 0:00:08
880000 -- (-1423.218) (-1422.492) (-1420.431) [-1423.332] * (-1419.226) (-1420.887) [-1422.576] (-1421.073) -- 0:00:08
Average standard deviation of split frequencies: 0.007494
880500 -- (-1423.676) (-1420.831) (-1421.384) [-1420.750] * (-1422.733) (-1422.731) [-1419.221] (-1421.074) -- 0:00:08
881000 -- (-1422.770) [-1421.376] (-1419.493) (-1423.458) * [-1420.801] (-1422.923) (-1422.178) (-1424.140) -- 0:00:08
881500 -- [-1423.335] (-1423.119) (-1419.866) (-1423.111) * [-1418.587] (-1428.504) (-1423.757) (-1422.966) -- 0:00:08
882000 -- [-1420.416] (-1420.433) (-1427.906) (-1421.676) * (-1422.325) (-1424.696) [-1423.906] (-1422.399) -- 0:00:08
882500 -- (-1420.563) (-1422.662) (-1421.881) [-1419.197] * [-1423.651] (-1422.467) (-1423.048) (-1425.307) -- 0:00:07
883000 -- [-1420.550] (-1422.918) (-1422.813) (-1421.787) * [-1420.388] (-1421.920) (-1422.995) (-1421.633) -- 0:00:08
883500 -- (-1422.553) [-1424.688] (-1428.167) (-1425.049) * (-1419.192) [-1425.008] (-1423.966) (-1423.018) -- 0:00:08
884000 -- (-1422.780) (-1422.293) [-1424.776] (-1421.794) * (-1421.113) (-1423.661) (-1424.205) [-1425.292] -- 0:00:08
884500 -- [-1423.377] (-1422.442) (-1422.831) (-1420.722) * (-1424.207) [-1422.139] (-1426.612) (-1423.561) -- 0:00:07
885000 -- (-1420.101) (-1423.524) [-1422.001] (-1423.236) * [-1424.123] (-1422.747) (-1421.165) (-1422.719) -- 0:00:07
Average standard deviation of split frequencies: 0.007307
885500 -- (-1424.131) (-1422.627) (-1424.099) [-1420.588] * (-1421.778) [-1425.172] (-1423.481) (-1425.879) -- 0:00:07
886000 -- (-1424.794) [-1421.511] (-1426.151) (-1422.567) * (-1421.603) [-1420.246] (-1421.610) (-1423.343) -- 0:00:07
886500 -- (-1421.699) (-1423.522) (-1422.159) [-1422.824] * (-1423.022) [-1423.976] (-1421.656) (-1423.379) -- 0:00:07
887000 -- (-1424.277) [-1420.328] (-1423.156) (-1426.211) * (-1421.921) [-1422.794] (-1423.310) (-1420.836) -- 0:00:07
887500 -- (-1425.321) [-1420.001] (-1421.734) (-1425.559) * (-1420.264) (-1425.180) (-1422.767) [-1421.573] -- 0:00:07
888000 -- (-1419.989) (-1423.428) (-1421.597) [-1422.064] * (-1422.850) [-1423.572] (-1422.137) (-1421.917) -- 0:00:07
888500 -- (-1422.878) (-1420.603) (-1422.308) [-1421.106] * (-1423.900) [-1422.895] (-1419.566) (-1421.644) -- 0:00:07
889000 -- (-1422.897) [-1422.187] (-1424.689) (-1424.178) * [-1421.512] (-1421.103) (-1424.023) (-1424.541) -- 0:00:07
889500 -- (-1422.842) (-1422.387) (-1423.109) [-1424.341] * (-1422.165) (-1421.812) (-1420.123) [-1425.248] -- 0:00:07
890000 -- (-1421.882) (-1423.271) [-1421.725] (-1424.261) * (-1424.341) (-1422.004) (-1423.421) [-1421.555] -- 0:00:07
Average standard deviation of split frequencies: 0.007375
890500 -- [-1421.170] (-1424.946) (-1419.948) (-1424.616) * (-1424.104) (-1421.977) [-1423.747] (-1423.235) -- 0:00:07
891000 -- (-1421.705) [-1419.659] (-1420.803) (-1424.691) * [-1424.301] (-1426.164) (-1422.177) (-1421.977) -- 0:00:07
891500 -- (-1421.343) [-1422.165] (-1419.173) (-1423.460) * (-1422.604) (-1425.555) [-1420.526] (-1424.348) -- 0:00:07
892000 -- [-1421.639] (-1423.247) (-1430.604) (-1423.818) * [-1423.951] (-1425.666) (-1424.217) (-1423.798) -- 0:00:07
892500 -- [-1421.067] (-1423.663) (-1427.780) (-1421.701) * [-1423.608] (-1425.863) (-1421.568) (-1421.333) -- 0:00:07
893000 -- (-1422.096) [-1421.619] (-1423.168) (-1422.035) * (-1422.240) (-1428.415) [-1421.919] (-1423.861) -- 0:00:07
893500 -- (-1422.503) [-1420.735] (-1422.508) (-1422.317) * (-1421.485) [-1423.638] (-1421.606) (-1421.641) -- 0:00:07
894000 -- (-1423.990) (-1421.916) [-1422.750] (-1424.453) * (-1426.523) [-1422.139] (-1422.186) (-1420.051) -- 0:00:07
894500 -- (-1424.520) (-1421.663) [-1420.559] (-1425.593) * (-1422.933) (-1423.702) [-1421.647] (-1425.743) -- 0:00:07
895000 -- (-1424.211) (-1422.194) [-1421.980] (-1423.837) * (-1422.157) (-1422.686) (-1422.177) [-1427.329] -- 0:00:07
Average standard deviation of split frequencies: 0.007190
895500 -- [-1422.304] (-1421.743) (-1422.399) (-1421.319) * (-1423.649) (-1425.342) (-1423.452) [-1422.193] -- 0:00:07
896000 -- (-1422.763) (-1420.506) (-1422.424) [-1420.088] * (-1422.364) (-1422.578) (-1423.009) [-1422.657] -- 0:00:07
896500 -- (-1422.169) (-1419.709) [-1422.796] (-1420.824) * (-1422.217) (-1425.437) [-1422.886] (-1422.449) -- 0:00:07
897000 -- (-1421.983) (-1421.520) [-1424.442] (-1420.323) * [-1422.072] (-1419.125) (-1423.179) (-1421.262) -- 0:00:07
897500 -- (-1426.980) (-1420.915) (-1421.575) [-1422.315] * (-1422.287) [-1422.351] (-1420.265) (-1423.589) -- 0:00:06
898000 -- (-1424.627) [-1419.297] (-1421.556) (-1420.003) * (-1421.235) (-1421.962) [-1423.177] (-1421.234) -- 0:00:06
898500 -- (-1422.136) [-1422.935] (-1421.369) (-1427.827) * [-1421.321] (-1422.594) (-1424.882) (-1428.707) -- 0:00:07
899000 -- (-1419.042) (-1421.938) [-1422.185] (-1423.090) * (-1424.382) (-1422.628) [-1420.877] (-1426.515) -- 0:00:06
899500 -- [-1421.208] (-1424.796) (-1419.384) (-1419.650) * (-1425.950) (-1424.265) (-1423.059) [-1424.227] -- 0:00:06
900000 -- (-1418.920) (-1423.679) (-1421.386) [-1420.946] * [-1424.249] (-1420.181) (-1422.564) (-1422.433) -- 0:00:06
Average standard deviation of split frequencies: 0.007013
900500 -- [-1421.851] (-1420.510) (-1421.998) (-1422.876) * (-1424.909) (-1423.377) [-1421.061] (-1423.105) -- 0:00:06
901000 -- (-1421.597) (-1420.734) (-1423.347) [-1421.838] * [-1426.040] (-1424.791) (-1421.389) (-1422.293) -- 0:00:06
901500 -- (-1420.524) (-1421.205) (-1425.492) [-1422.458] * (-1425.428) [-1423.520] (-1421.542) (-1422.385) -- 0:00:06
902000 -- (-1422.764) (-1426.478) (-1423.956) [-1422.174] * (-1426.885) (-1420.678) [-1421.507] (-1421.053) -- 0:00:06
902500 -- (-1422.217) (-1425.509) (-1421.597) [-1421.768] * (-1424.738) (-1422.296) (-1422.698) [-1421.825] -- 0:00:06
903000 -- (-1423.626) (-1423.162) [-1421.597] (-1421.846) * [-1420.886] (-1422.481) (-1420.659) (-1421.722) -- 0:00:06
903500 -- (-1422.607) (-1421.738) (-1420.535) [-1420.058] * (-1425.403) [-1421.947] (-1423.036) (-1420.402) -- 0:00:06
904000 -- (-1423.000) [-1422.800] (-1423.648) (-1421.190) * [-1422.294] (-1421.885) (-1422.904) (-1420.967) -- 0:00:06
904500 -- [-1421.722] (-1422.641) (-1422.923) (-1428.230) * (-1422.147) (-1425.902) [-1423.212] (-1419.583) -- 0:00:06
905000 -- (-1432.289) (-1419.299) [-1423.001] (-1422.245) * (-1422.064) (-1422.045) [-1421.194] (-1422.375) -- 0:00:06
Average standard deviation of split frequencies: 0.006695
905500 -- (-1422.105) (-1420.940) (-1426.163) [-1419.289] * (-1421.556) (-1421.076) (-1425.093) [-1423.149] -- 0:00:06
906000 -- [-1421.388] (-1421.556) (-1422.518) (-1418.702) * (-1423.541) (-1422.982) [-1426.024] (-1423.800) -- 0:00:06
906500 -- (-1420.852) (-1422.030) [-1421.704] (-1418.707) * (-1428.099) (-1423.206) [-1423.379] (-1423.494) -- 0:00:06
907000 -- (-1422.018) (-1422.867) [-1422.005] (-1421.267) * [-1423.770] (-1422.691) (-1424.070) (-1425.329) -- 0:00:06
907500 -- (-1423.132) (-1421.771) (-1422.498) [-1418.356] * (-1422.319) (-1424.644) [-1421.875] (-1421.809) -- 0:00:06
908000 -- (-1422.749) (-1420.892) [-1420.933] (-1422.270) * (-1420.432) (-1421.879) [-1419.892] (-1422.228) -- 0:00:06
908500 -- (-1421.054) (-1421.056) [-1421.970] (-1420.096) * (-1425.376) (-1424.096) (-1420.813) [-1422.335] -- 0:00:06
909000 -- (-1424.585) (-1423.138) (-1421.849) [-1424.899] * (-1420.366) (-1421.113) [-1418.586] (-1421.196) -- 0:00:06
909500 -- (-1419.453) (-1423.974) (-1423.999) [-1420.537] * (-1420.998) (-1424.299) [-1420.574] (-1424.371) -- 0:00:06
910000 -- [-1418.484] (-1421.102) (-1423.683) (-1425.395) * [-1420.390] (-1423.434) (-1421.551) (-1425.147) -- 0:00:06
Average standard deviation of split frequencies: 0.007040
910500 -- (-1423.107) (-1419.488) (-1421.848) [-1418.666] * (-1422.733) (-1424.222) [-1421.834] (-1423.244) -- 0:00:06
911000 -- [-1425.240] (-1423.023) (-1424.081) (-1421.899) * (-1420.892) (-1422.897) (-1420.854) [-1422.841] -- 0:00:06
911500 -- [-1421.682] (-1420.099) (-1421.730) (-1423.709) * [-1422.282] (-1421.424) (-1422.149) (-1423.304) -- 0:00:06
912000 -- (-1421.833) (-1422.903) (-1428.399) [-1424.473] * (-1420.695) [-1423.834] (-1425.314) (-1419.241) -- 0:00:05
912500 -- (-1425.366) (-1430.547) (-1424.858) [-1422.432] * [-1421.004] (-1421.496) (-1424.164) (-1422.246) -- 0:00:05
913000 -- (-1424.782) (-1423.208) [-1422.064] (-1423.032) * (-1420.494) [-1422.012] (-1425.014) (-1420.889) -- 0:00:06
913500 -- (-1423.227) [-1422.828] (-1421.928) (-1423.956) * (-1421.419) [-1424.090] (-1425.049) (-1421.816) -- 0:00:05
914000 -- (-1424.198) [-1419.864] (-1421.055) (-1423.400) * (-1421.872) (-1423.248) (-1423.095) [-1421.303] -- 0:00:05
914500 -- (-1421.760) [-1421.082] (-1420.597) (-1420.824) * (-1421.980) [-1421.890] (-1423.039) (-1419.351) -- 0:00:05
915000 -- [-1422.915] (-1420.611) (-1423.058) (-1425.463) * (-1423.082) [-1420.830] (-1428.855) (-1421.385) -- 0:00:05
Average standard deviation of split frequencies: 0.006759
915500 -- [-1422.900] (-1420.045) (-1421.845) (-1425.100) * (-1422.757) (-1421.258) (-1424.583) [-1422.469] -- 0:00:05
916000 -- (-1421.086) (-1423.374) (-1421.228) [-1419.822] * (-1420.916) [-1420.816] (-1423.698) (-1421.994) -- 0:00:05
916500 -- [-1420.266] (-1420.154) (-1420.093) (-1420.929) * (-1421.646) (-1427.121) (-1422.651) [-1423.208] -- 0:00:05
917000 -- (-1420.458) [-1422.485] (-1425.053) (-1421.923) * (-1429.943) (-1420.379) (-1424.504) [-1423.685] -- 0:00:05
917500 -- (-1421.161) (-1421.693) [-1420.741] (-1422.276) * (-1423.549) (-1422.230) [-1424.226] (-1429.197) -- 0:00:05
918000 -- (-1423.067) (-1421.031) (-1422.182) [-1423.012] * (-1424.636) (-1425.533) [-1424.379] (-1421.213) -- 0:00:05
918500 -- (-1424.203) (-1420.666) [-1424.083] (-1421.478) * (-1420.610) (-1419.288) [-1422.644] (-1423.480) -- 0:00:05
919000 -- [-1422.391] (-1421.598) (-1420.621) (-1423.205) * (-1420.223) [-1422.007] (-1423.149) (-1422.353) -- 0:00:05
919500 -- (-1421.897) (-1420.531) [-1424.009] (-1424.586) * (-1421.090) (-1422.079) (-1422.620) [-1421.253] -- 0:00:05
920000 -- [-1421.779] (-1423.530) (-1427.633) (-1423.660) * [-1424.379] (-1422.785) (-1421.497) (-1422.453) -- 0:00:05
Average standard deviation of split frequencies: 0.006759
920500 -- (-1422.513) (-1421.290) (-1421.818) [-1424.638] * (-1420.839) (-1424.406) [-1421.898] (-1423.272) -- 0:00:05
921000 -- (-1426.376) [-1423.081] (-1422.461) (-1424.844) * [-1421.881] (-1420.710) (-1422.487) (-1424.338) -- 0:00:05
921500 -- [-1421.995] (-1425.608) (-1422.054) (-1425.998) * (-1421.487) (-1421.579) [-1423.855] (-1420.839) -- 0:00:05
922000 -- (-1425.614) (-1423.964) (-1426.652) [-1420.789] * (-1423.665) [-1422.284] (-1424.812) (-1419.846) -- 0:00:05
922500 -- (-1422.382) (-1420.737) [-1423.285] (-1423.951) * [-1421.367] (-1422.918) (-1422.479) (-1422.278) -- 0:00:05
923000 -- (-1423.532) (-1423.566) [-1421.453] (-1421.512) * (-1424.726) (-1421.635) (-1423.485) [-1421.552] -- 0:00:05
923500 -- (-1420.879) [-1423.042] (-1421.583) (-1422.962) * (-1422.674) (-1423.309) (-1423.616) [-1424.301] -- 0:00:05
924000 -- [-1425.082] (-1421.043) (-1421.642) (-1422.766) * (-1424.705) (-1419.447) (-1422.982) [-1424.414] -- 0:00:05
924500 -- (-1421.616) [-1424.049] (-1422.681) (-1423.898) * [-1422.270] (-1419.631) (-1426.018) (-1422.271) -- 0:00:05
925000 -- [-1421.119] (-1423.652) (-1422.418) (-1425.923) * (-1423.210) (-1426.389) [-1422.801] (-1423.725) -- 0:00:05
Average standard deviation of split frequencies: 0.006279
925500 -- [-1420.383] (-1423.581) (-1423.911) (-1422.939) * (-1422.991) (-1423.131) [-1421.145] (-1420.502) -- 0:00:05
926000 -- (-1420.911) (-1419.895) (-1423.109) [-1424.356] * [-1421.148] (-1424.785) (-1429.409) (-1421.890) -- 0:00:05
926500 -- (-1422.654) [-1423.798] (-1421.385) (-1429.481) * (-1422.151) (-1423.215) [-1422.129] (-1423.987) -- 0:00:04
927000 -- (-1422.016) (-1426.422) (-1421.048) [-1424.036] * (-1421.595) (-1421.767) (-1423.910) [-1418.958] -- 0:00:04
927500 -- (-1426.920) (-1427.234) (-1420.667) [-1423.317] * (-1423.376) (-1422.330) [-1423.714] (-1420.739) -- 0:00:05
928000 -- (-1425.280) [-1423.121] (-1421.491) (-1422.143) * (-1424.660) (-1421.874) [-1422.513] (-1420.902) -- 0:00:04
928500 -- (-1420.285) (-1420.570) [-1421.774] (-1424.418) * (-1420.622) (-1423.436) (-1422.478) [-1420.459] -- 0:00:04
929000 -- (-1426.026) (-1422.208) [-1420.600] (-1422.774) * (-1423.210) (-1421.088) [-1422.349] (-1423.839) -- 0:00:04
929500 -- (-1429.614) (-1419.683) (-1422.448) [-1423.062] * [-1419.533] (-1422.122) (-1422.743) (-1426.485) -- 0:00:04
930000 -- (-1428.363) (-1419.875) [-1422.473] (-1424.090) * (-1423.271) (-1425.338) [-1422.079] (-1425.404) -- 0:00:04
Average standard deviation of split frequencies: 0.006078
930500 -- (-1423.544) (-1421.098) [-1422.883] (-1424.358) * (-1424.644) (-1425.145) (-1421.653) [-1422.222] -- 0:00:04
931000 -- (-1422.578) [-1420.962] (-1424.352) (-1423.063) * [-1422.239] (-1424.791) (-1426.676) (-1421.722) -- 0:00:04
931500 -- (-1425.165) (-1423.453) (-1422.585) [-1423.267] * (-1423.559) (-1423.110) [-1425.828] (-1426.489) -- 0:00:04
932000 -- (-1423.556) [-1420.664] (-1422.852) (-1424.771) * (-1421.127) [-1421.950] (-1425.525) (-1430.237) -- 0:00:04
932500 -- (-1422.550) (-1421.463) (-1422.182) [-1422.370] * (-1420.638) (-1422.385) (-1423.006) [-1429.718] -- 0:00:04
933000 -- (-1422.132) (-1422.971) (-1423.981) [-1420.907] * (-1420.814) (-1423.383) [-1422.035] (-1422.905) -- 0:00:04
933500 -- [-1423.100] (-1422.988) (-1421.177) (-1423.976) * (-1423.621) (-1421.435) (-1419.552) [-1421.730] -- 0:00:04
934000 -- (-1422.726) [-1420.335] (-1421.736) (-1424.488) * (-1426.272) (-1422.299) (-1422.491) [-1421.699] -- 0:00:04
934500 -- [-1422.121] (-1421.035) (-1423.598) (-1424.431) * (-1423.832) (-1428.512) [-1420.749] (-1423.478) -- 0:00:04
935000 -- (-1426.140) (-1424.788) (-1422.321) [-1425.784] * (-1422.655) [-1426.654] (-1421.215) (-1424.521) -- 0:00:04
Average standard deviation of split frequencies: 0.006212
935500 -- [-1422.524] (-1420.786) (-1426.627) (-1424.818) * (-1421.025) [-1422.007] (-1420.998) (-1421.563) -- 0:00:04
936000 -- (-1425.308) (-1426.654) [-1426.728] (-1422.816) * (-1422.851) (-1422.088) (-1422.979) [-1422.518] -- 0:00:04
936500 -- [-1424.148] (-1420.625) (-1423.015) (-1424.231) * [-1421.960] (-1422.835) (-1425.055) (-1419.970) -- 0:00:04
937000 -- [-1423.867] (-1422.983) (-1422.517) (-1422.868) * (-1424.384) (-1424.049) (-1421.683) [-1421.248] -- 0:00:04
937500 -- [-1424.394] (-1422.500) (-1422.983) (-1423.991) * [-1419.967] (-1424.815) (-1422.541) (-1422.561) -- 0:00:04
938000 -- (-1420.108) [-1420.876] (-1424.300) (-1424.103) * [-1418.624] (-1424.935) (-1422.379) (-1422.437) -- 0:00:04
938500 -- (-1422.292) [-1420.945] (-1423.888) (-1421.732) * (-1419.300) (-1427.181) (-1419.860) [-1423.524] -- 0:00:04
939000 -- (-1422.885) [-1424.568] (-1423.569) (-1422.937) * [-1419.253] (-1425.656) (-1422.527) (-1425.038) -- 0:00:04
939500 -- [-1422.785] (-1422.675) (-1422.381) (-1422.724) * (-1420.658) (-1428.739) (-1420.346) [-1419.891] -- 0:00:04
940000 -- (-1422.540) [-1425.156] (-1424.222) (-1422.942) * (-1419.477) (-1423.931) (-1420.958) [-1425.234] -- 0:00:04
Average standard deviation of split frequencies: 0.006181
940500 -- (-1422.274) (-1420.749) (-1423.379) [-1421.605] * (-1420.437) [-1424.812] (-1421.068) (-1421.739) -- 0:00:04
941000 -- (-1421.877) (-1420.946) (-1423.841) [-1421.596] * (-1422.971) [-1426.447] (-1426.656) (-1421.749) -- 0:00:04
941500 -- (-1420.781) [-1420.294] (-1421.971) (-1424.505) * (-1421.859) (-1426.760) (-1422.899) [-1422.530] -- 0:00:03
942000 -- [-1421.430] (-1420.928) (-1420.771) (-1422.903) * (-1426.218) [-1421.842] (-1424.937) (-1423.714) -- 0:00:03
942500 -- (-1423.432) (-1419.593) (-1419.658) [-1423.699] * [-1421.819] (-1425.436) (-1421.517) (-1423.652) -- 0:00:03
943000 -- (-1421.964) (-1424.754) (-1422.382) [-1422.844] * (-1420.030) [-1422.128] (-1423.139) (-1424.960) -- 0:00:03
943500 -- (-1422.034) (-1420.923) [-1420.214] (-1422.457) * [-1422.252] (-1421.541) (-1422.834) (-1422.895) -- 0:00:03
944000 -- (-1423.915) (-1421.670) [-1424.382] (-1426.680) * (-1425.150) [-1423.961] (-1423.911) (-1420.805) -- 0:00:03
944500 -- (-1421.920) [-1421.672] (-1420.008) (-1422.820) * [-1423.886] (-1424.459) (-1424.136) (-1421.024) -- 0:00:03
945000 -- (-1420.184) [-1422.531] (-1425.650) (-1424.157) * (-1422.925) (-1422.488) (-1422.867) [-1423.338] -- 0:00:03
Average standard deviation of split frequencies: 0.006179
945500 -- (-1420.885) (-1423.052) (-1425.322) [-1422.443] * (-1424.527) [-1422.416] (-1421.368) (-1426.661) -- 0:00:03
946000 -- (-1423.330) [-1421.989] (-1425.667) (-1424.082) * [-1421.491] (-1424.029) (-1421.766) (-1422.432) -- 0:00:03
946500 -- [-1421.890] (-1421.978) (-1419.120) (-1424.478) * (-1421.623) (-1421.097) (-1427.115) [-1425.233] -- 0:00:03
947000 -- (-1424.477) (-1421.074) [-1422.033] (-1422.701) * (-1425.374) [-1419.974] (-1425.781) (-1423.295) -- 0:00:03
947500 -- (-1423.178) (-1421.240) [-1420.095] (-1421.503) * [-1425.731] (-1421.891) (-1422.704) (-1421.874) -- 0:00:03
948000 -- (-1423.018) (-1421.558) [-1421.101] (-1422.807) * (-1423.286) (-1421.658) (-1423.827) [-1425.100] -- 0:00:03
948500 -- [-1422.395] (-1425.624) (-1420.622) (-1423.205) * [-1422.420] (-1422.084) (-1426.348) (-1424.371) -- 0:00:03
949000 -- (-1420.626) (-1424.054) [-1422.132] (-1422.481) * (-1422.680) [-1419.926] (-1424.350) (-1420.137) -- 0:00:03
949500 -- (-1420.238) (-1423.678) [-1420.281] (-1424.318) * (-1420.056) (-1420.869) [-1424.671] (-1425.943) -- 0:00:03
950000 -- (-1422.368) [-1424.541] (-1422.584) (-1421.309) * (-1420.228) [-1421.940] (-1424.615) (-1427.306) -- 0:00:03
Average standard deviation of split frequencies: 0.005981
950500 -- (-1421.686) (-1418.971) [-1420.635] (-1427.419) * [-1423.421] (-1425.938) (-1422.964) (-1425.157) -- 0:00:03
951000 -- [-1423.088] (-1420.057) (-1422.265) (-1423.036) * (-1425.578) (-1427.034) [-1419.695] (-1423.440) -- 0:00:03
951500 -- (-1421.396) (-1421.720) [-1422.842] (-1426.470) * (-1423.234) (-1422.537) [-1421.738] (-1423.310) -- 0:00:03
952000 -- (-1420.261) [-1422.363] (-1420.089) (-1423.811) * (-1421.739) (-1423.114) [-1426.533] (-1423.463) -- 0:00:03
952500 -- [-1421.443] (-1419.923) (-1422.381) (-1420.968) * (-1423.089) (-1422.572) [-1421.570] (-1422.834) -- 0:00:03
953000 -- (-1421.958) [-1421.250] (-1426.847) (-1422.726) * [-1421.854] (-1422.809) (-1423.509) (-1423.359) -- 0:00:03
953500 -- (-1421.787) [-1423.926] (-1428.185) (-1422.930) * (-1423.081) [-1421.953] (-1423.784) (-1423.685) -- 0:00:03
954000 -- [-1422.703] (-1419.822) (-1428.007) (-1421.133) * (-1422.386) (-1424.803) [-1422.492] (-1422.324) -- 0:00:03
954500 -- [-1419.705] (-1424.722) (-1422.756) (-1422.785) * (-1421.597) [-1423.816] (-1425.301) (-1424.304) -- 0:00:03
955000 -- (-1419.147) (-1418.949) (-1422.742) [-1423.013] * [-1420.902] (-1421.968) (-1424.908) (-1422.361) -- 0:00:03
Average standard deviation of split frequencies: 0.006010
955500 -- (-1420.619) (-1421.925) [-1424.737] (-1425.602) * (-1423.070) (-1422.325) [-1420.862] (-1422.709) -- 0:00:03
956000 -- (-1424.988) (-1423.238) (-1426.462) [-1426.486] * (-1423.020) [-1423.525] (-1421.666) (-1421.793) -- 0:00:02
956500 -- (-1419.443) (-1421.475) [-1420.433] (-1423.036) * (-1425.846) (-1421.336) [-1422.270] (-1419.667) -- 0:00:02
957000 -- [-1419.175] (-1421.571) (-1421.623) (-1419.243) * [-1423.819] (-1422.293) (-1426.602) (-1419.952) -- 0:00:02
957500 -- (-1418.825) (-1423.398) [-1421.787] (-1418.615) * (-1427.044) (-1422.833) (-1424.409) [-1425.793] -- 0:00:02
958000 -- [-1421.681] (-1420.910) (-1424.939) (-1422.274) * (-1422.144) (-1422.329) (-1421.647) [-1424.076] -- 0:00:02
958500 -- (-1421.792) (-1423.836) (-1421.639) [-1422.007] * (-1422.805) (-1422.172) (-1422.667) [-1421.135] -- 0:00:02
959000 -- (-1424.732) [-1422.656] (-1422.459) (-1425.293) * (-1422.195) (-1423.531) [-1425.411] (-1421.223) -- 0:00:02
959500 -- (-1424.379) (-1422.257) [-1425.177] (-1422.282) * (-1422.490) [-1423.172] (-1427.840) (-1424.454) -- 0:00:02
960000 -- (-1423.227) [-1419.316] (-1423.170) (-1420.456) * (-1425.205) [-1421.623] (-1423.572) (-1421.890) -- 0:00:02
Average standard deviation of split frequencies: 0.006706
960500 -- [-1422.694] (-1423.172) (-1424.328) (-1421.481) * (-1423.534) (-1424.822) [-1420.607] (-1421.975) -- 0:00:02
961000 -- [-1418.752] (-1422.783) (-1424.176) (-1423.070) * (-1422.272) (-1423.230) (-1422.826) [-1420.158] -- 0:00:02
961500 -- (-1424.925) (-1420.675) (-1426.059) [-1421.519] * [-1419.968] (-1421.263) (-1422.603) (-1419.770) -- 0:00:02
962000 -- (-1424.230) (-1422.454) [-1421.983] (-1420.317) * (-1421.654) [-1422.838] (-1423.626) (-1421.861) -- 0:00:02
962500 -- (-1422.057) [-1420.410] (-1422.235) (-1420.599) * (-1428.881) (-1421.231) [-1420.767] (-1422.222) -- 0:00:02
963000 -- [-1420.077] (-1422.804) (-1423.499) (-1421.168) * (-1425.812) (-1423.024) [-1420.808] (-1423.920) -- 0:00:02
963500 -- (-1422.965) [-1424.163] (-1426.720) (-1420.457) * (-1422.592) [-1422.445] (-1420.784) (-1420.935) -- 0:00:02
964000 -- (-1423.539) (-1422.720) (-1426.187) [-1422.589] * (-1420.310) [-1422.078] (-1422.317) (-1423.266) -- 0:00:02
964500 -- [-1422.434] (-1422.967) (-1424.706) (-1422.018) * (-1422.513) [-1422.402] (-1421.911) (-1420.842) -- 0:00:02
965000 -- (-1423.368) [-1423.157] (-1427.020) (-1423.761) * (-1423.831) (-1420.995) (-1422.544) [-1421.926] -- 0:00:02
Average standard deviation of split frequencies: 0.006405
965500 -- (-1423.027) (-1423.093) (-1421.364) [-1423.998] * [-1423.001] (-1422.128) (-1421.081) (-1420.568) -- 0:00:02
966000 -- (-1426.476) (-1422.329) (-1422.775) [-1425.877] * (-1420.006) (-1422.574) (-1423.178) [-1421.871] -- 0:00:02
966500 -- [-1423.387] (-1419.892) (-1425.535) (-1423.997) * (-1423.481) (-1425.971) [-1421.811] (-1421.922) -- 0:00:02
967000 -- (-1421.127) [-1420.475] (-1429.314) (-1425.153) * [-1420.515] (-1422.590) (-1420.429) (-1424.424) -- 0:00:02
967500 -- (-1422.197) (-1420.542) (-1427.547) [-1423.986] * (-1422.136) (-1422.607) (-1421.732) [-1430.611] -- 0:00:02
968000 -- [-1423.553] (-1422.943) (-1423.595) (-1423.682) * (-1426.800) (-1422.799) (-1422.482) [-1429.842] -- 0:00:02
968500 -- (-1423.100) [-1421.875] (-1422.643) (-1421.125) * (-1424.847) [-1422.580] (-1420.624) (-1422.098) -- 0:00:02
969000 -- (-1421.731) [-1421.944] (-1421.974) (-1421.978) * [-1427.773] (-1424.024) (-1422.042) (-1421.374) -- 0:00:02
969500 -- (-1421.534) (-1419.707) (-1420.736) [-1421.610] * (-1421.521) (-1422.344) (-1426.267) [-1420.628] -- 0:00:02
970000 -- [-1420.580] (-1423.152) (-1422.094) (-1423.025) * (-1425.130) (-1421.183) (-1420.773) [-1425.601] -- 0:00:02
Average standard deviation of split frequencies: 0.006929
970500 -- (-1422.784) (-1421.285) [-1420.693] (-1423.355) * (-1421.959) [-1423.056] (-1422.152) (-1422.838) -- 0:00:02
971000 -- [-1421.959] (-1426.094) (-1422.293) (-1421.844) * (-1422.641) [-1419.387] (-1421.750) (-1422.546) -- 0:00:01
971500 -- (-1423.500) (-1425.811) (-1425.080) [-1421.539] * (-1423.289) [-1421.819] (-1424.144) (-1422.771) -- 0:00:01
972000 -- (-1421.164) (-1426.479) [-1423.775] (-1420.977) * (-1422.163) (-1424.645) [-1420.102] (-1423.108) -- 0:00:01
972500 -- [-1422.130] (-1425.818) (-1428.114) (-1423.244) * (-1423.121) (-1428.204) [-1420.348] (-1424.330) -- 0:00:01
973000 -- (-1421.849) [-1422.214] (-1425.619) (-1422.400) * (-1422.444) [-1422.457] (-1420.960) (-1423.682) -- 0:00:01
973500 -- (-1420.160) (-1421.948) (-1421.501) [-1425.389] * [-1419.508] (-1421.945) (-1423.270) (-1423.857) -- 0:00:01
974000 -- [-1422.579] (-1422.980) (-1423.525) (-1425.718) * [-1421.024] (-1423.054) (-1425.424) (-1422.586) -- 0:00:01
974500 -- [-1421.402] (-1422.373) (-1420.700) (-1420.913) * (-1423.827) (-1423.257) (-1428.100) [-1418.869] -- 0:00:01
975000 -- (-1421.363) (-1422.012) (-1423.605) [-1421.845] * (-1426.454) (-1422.563) [-1424.927] (-1420.781) -- 0:00:01
Average standard deviation of split frequencies: 0.006762
975500 -- (-1422.952) [-1421.508] (-1422.510) (-1421.365) * (-1421.726) (-1422.631) (-1424.974) [-1420.939] -- 0:00:01
976000 -- [-1419.522] (-1423.757) (-1421.448) (-1422.483) * (-1421.309) (-1425.111) [-1423.104] (-1431.611) -- 0:00:01
976500 -- (-1419.361) (-1426.924) (-1423.135) [-1423.666] * [-1419.402] (-1425.627) (-1421.270) (-1421.778) -- 0:00:01
977000 -- (-1424.542) [-1422.877] (-1422.854) (-1424.777) * [-1420.535] (-1423.251) (-1423.858) (-1421.625) -- 0:00:01
977500 -- (-1424.226) (-1422.901) (-1423.972) [-1429.549] * (-1421.475) (-1426.789) (-1421.786) [-1418.977] -- 0:00:01
978000 -- (-1421.295) (-1422.560) [-1422.824] (-1426.188) * (-1423.601) (-1425.192) (-1423.508) [-1422.985] -- 0:00:01
978500 -- [-1423.792] (-1421.005) (-1423.005) (-1423.048) * [-1421.232] (-1422.353) (-1422.357) (-1421.388) -- 0:00:01
979000 -- [-1423.269] (-1424.696) (-1423.025) (-1426.489) * (-1424.193) (-1424.489) [-1421.567] (-1422.894) -- 0:00:01
979500 -- (-1424.332) (-1423.639) [-1421.360] (-1428.529) * (-1419.828) [-1420.463] (-1422.720) (-1420.225) -- 0:00:01
980000 -- (-1422.422) (-1429.824) [-1420.545] (-1422.295) * (-1421.745) [-1422.223] (-1421.744) (-1422.544) -- 0:00:01
Average standard deviation of split frequencies: 0.006505
980500 -- [-1419.837] (-1422.362) (-1423.537) (-1422.323) * (-1423.921) [-1424.102] (-1421.483) (-1422.160) -- 0:00:01
981000 -- (-1421.361) (-1425.138) (-1425.988) [-1423.661] * (-1424.432) [-1421.757] (-1419.709) (-1420.439) -- 0:00:01
981500 -- (-1421.470) [-1427.650] (-1421.552) (-1423.376) * [-1420.286] (-1423.100) (-1419.484) (-1424.150) -- 0:00:01
982000 -- (-1419.552) (-1421.013) (-1421.756) [-1422.576] * (-1420.531) (-1420.901) [-1421.630] (-1423.716) -- 0:00:01
982500 -- (-1418.098) [-1421.486] (-1419.421) (-1424.924) * [-1420.813] (-1423.482) (-1425.561) (-1423.511) -- 0:00:01
983000 -- [-1419.910] (-1431.499) (-1431.866) (-1424.668) * (-1419.634) (-1422.162) [-1421.268] (-1423.909) -- 0:00:01
983500 -- (-1420.700) (-1427.408) (-1422.875) [-1423.466] * (-1421.779) (-1422.761) (-1420.557) [-1420.307] -- 0:00:01
984000 -- (-1423.884) (-1423.675) (-1424.625) [-1421.311] * (-1421.096) [-1421.648] (-1422.889) (-1422.534) -- 0:00:01
984500 -- [-1419.727] (-1421.483) (-1424.345) (-1423.833) * (-1422.570) [-1421.549] (-1420.965) (-1427.263) -- 0:00:01
985000 -- (-1419.121) (-1420.286) (-1423.110) [-1421.956] * (-1420.847) [-1422.852] (-1423.898) (-1423.044) -- 0:00:01
Average standard deviation of split frequencies: 0.005976
985500 -- (-1426.651) (-1424.328) [-1423.064] (-1420.688) * (-1423.779) [-1420.569] (-1423.268) (-1424.385) -- 0:00:00
986000 -- [-1421.052] (-1419.509) (-1422.808) (-1424.769) * (-1422.778) (-1425.048) (-1420.798) [-1421.219] -- 0:00:00
986500 -- (-1423.179) (-1422.153) [-1421.644] (-1424.641) * (-1423.764) (-1422.498) [-1420.114] (-1424.181) -- 0:00:00
987000 -- (-1425.469) (-1422.590) (-1421.197) [-1420.681] * (-1422.900) (-1420.803) [-1422.995] (-1422.030) -- 0:00:00
987500 -- [-1425.033] (-1423.316) (-1422.606) (-1421.348) * (-1424.446) (-1419.848) [-1422.823] (-1421.129) -- 0:00:00
988000 -- [-1420.272] (-1423.453) (-1422.180) (-1423.784) * [-1422.075] (-1421.999) (-1422.520) (-1423.532) -- 0:00:00
988500 -- [-1423.113] (-1422.293) (-1422.570) (-1421.856) * [-1421.449] (-1427.367) (-1422.179) (-1420.647) -- 0:00:00
989000 -- [-1421.781] (-1422.205) (-1421.156) (-1422.697) * (-1422.032) [-1420.893] (-1422.524) (-1422.152) -- 0:00:00
989500 -- [-1422.859] (-1421.082) (-1423.782) (-1422.326) * [-1422.083] (-1421.657) (-1422.827) (-1422.865) -- 0:00:00
990000 -- (-1423.365) [-1421.750] (-1424.517) (-1423.280) * (-1425.862) (-1423.765) (-1425.361) [-1422.268] -- 0:00:00
Average standard deviation of split frequencies: 0.005502
990500 -- (-1421.778) [-1420.430] (-1420.220) (-1425.072) * [-1425.061] (-1419.977) (-1428.863) (-1422.564) -- 0:00:00
991000 -- (-1420.572) [-1422.354] (-1420.762) (-1422.162) * [-1423.953] (-1419.865) (-1425.138) (-1424.438) -- 0:00:00
991500 -- (-1422.639) (-1427.021) [-1420.399] (-1423.039) * (-1425.662) [-1422.029] (-1421.952) (-1425.310) -- 0:00:00
992000 -- (-1420.709) (-1423.571) (-1422.217) [-1423.167] * (-1422.383) (-1423.710) (-1420.862) [-1422.964] -- 0:00:00
992500 -- (-1423.258) (-1422.258) [-1421.487] (-1427.234) * (-1426.024) (-1422.211) (-1421.529) [-1422.674] -- 0:00:00
993000 -- [-1422.510] (-1422.079) (-1422.450) (-1422.335) * (-1422.107) (-1423.646) [-1419.848] (-1423.322) -- 0:00:00
993500 -- (-1422.568) [-1421.591] (-1422.186) (-1424.736) * (-1423.053) (-1420.718) [-1420.972] (-1422.768) -- 0:00:00
994000 -- (-1425.979) (-1420.763) [-1422.294] (-1425.216) * (-1425.400) (-1423.562) (-1424.323) [-1421.451] -- 0:00:00
994500 -- (-1428.593) (-1425.434) [-1422.660] (-1425.811) * (-1423.259) (-1426.553) (-1420.764) [-1421.713] -- 0:00:00
995000 -- (-1423.821) (-1422.725) (-1426.010) [-1424.569] * (-1422.895) (-1421.929) [-1422.510] (-1423.109) -- 0:00:00
Average standard deviation of split frequencies: 0.005206
995500 -- (-1425.945) (-1422.257) (-1424.409) [-1423.165] * (-1425.945) (-1421.257) (-1427.203) [-1422.747] -- 0:00:00
996000 -- (-1428.587) [-1421.510] (-1425.828) (-1423.124) * (-1423.035) (-1425.288) (-1424.462) [-1423.813] -- 0:00:00
996500 -- (-1422.416) (-1420.880) [-1422.953] (-1419.952) * (-1421.802) [-1426.288] (-1422.179) (-1424.196) -- 0:00:00
997000 -- [-1423.941] (-1421.807) (-1422.728) (-1422.306) * [-1424.437] (-1423.301) (-1425.422) (-1420.096) -- 0:00:00
997500 -- [-1421.809] (-1421.888) (-1424.616) (-1422.434) * (-1423.281) [-1420.586] (-1422.213) (-1420.834) -- 0:00:00
998000 -- [-1425.643] (-1425.944) (-1421.857) (-1423.086) * (-1425.077) [-1422.817] (-1422.179) (-1422.689) -- 0:00:00
998500 -- (-1422.884) [-1422.957] (-1423.535) (-1420.398) * (-1423.787) [-1421.171] (-1421.489) (-1423.272) -- 0:00:00
999000 -- (-1424.383) (-1420.454) (-1424.805) [-1422.047] * (-1424.010) (-1420.052) [-1422.560] (-1422.587) -- 0:00:00
999500 -- [-1424.347] (-1422.864) (-1421.903) (-1421.697) * [-1421.170] (-1420.035) (-1424.479) (-1424.068) -- 0:00:00
1000000 -- (-1422.947) [-1420.735] (-1424.140) (-1422.075) * (-1422.823) [-1420.892] (-1421.699) (-1423.665) -- 0:00:00
Average standard deviation of split frequencies: 0.005241
Analysis completed in 1 mins 8 seconds
Analysis used 67.44 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1417.24
Likelihood of best state for "cold" chain of run 2 was -1417.24
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 72 %) Dirichlet(Revmat{all})
98.4 % ( 97 %) Slider(Revmat{all})
25.8 % ( 19 %) Dirichlet(Pi{all})
27.6 % ( 30 %) Slider(Pi{all})
66.9 % ( 50 %) Multiplier(Alpha{1,2})
79.5 % ( 54 %) Multiplier(Alpha{3})
24.7 % ( 26 %) Slider(Pinvar{all})
97.4 % (100 %) ExtSPR(Tau{all},V{all})
69.1 % ( 67 %) ExtTBR(Tau{all},V{all})
98.2 % ( 96 %) NNI(Tau{all},V{all})
88.1 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
95.1 % ( 96 %) Nodeslider(V{all})
30.2 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 72 %) Dirichlet(Revmat{all})
98.0 % ( 96 %) Slider(Revmat{all})
26.0 % ( 25 %) Dirichlet(Pi{all})
27.8 % ( 24 %) Slider(Pi{all})
66.6 % ( 41 %) Multiplier(Alpha{1,2})
78.9 % ( 49 %) Multiplier(Alpha{3})
24.2 % ( 27 %) Slider(Pinvar{all})
97.4 % ( 94 %) ExtSPR(Tau{all},V{all})
69.2 % ( 72 %) ExtTBR(Tau{all},V{all})
98.2 % ( 96 %) NNI(Tau{all},V{all})
88.1 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 20 %) Multiplier(V{all})
95.0 % ( 97 %) Nodeslider(V{all})
30.4 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.79 0.62 0.48
2 | 166864 0.81 0.65
3 | 166306 167290 0.83
4 | 166256 166626 166658
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.79 0.62 0.48
2 | 166810 0.81 0.66
3 | 166301 166561 0.83
4 | 167000 166610 166718
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1421.21
| 1 |
| 2 |
| 1 1 2 2 1 2 |
|1 1 2 1 22 11 11 |
| 2 1 1 2 21 1 1 |
| 2 1 2 11 2 1 1 2 |
| 1 1 1 2 1 * 11 |
| 2 1 1 1 1 2* |
| 11 1 2 2 * *2 2 2 212 12|
| * 1 2 2 2 2 21 2 2 2 2 1 1222 1 2 2* 1|
|2 1 1 * 2 1 2 12 |
| 2 1 2 1 2 2 |
| 2 2 22 11 1 |
| 1 21 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1423.26
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1421.09 -1424.69
2 -1421.20 -1425.73
--------------------------------------
TOTAL -1421.15 -1425.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.878685 0.087890 0.321777 1.441564 0.843779 1359.60 1430.30 1.000
r(A<->C){all} 0.150149 0.019100 0.000001 0.429468 0.106154 199.69 236.20 1.001
r(A<->G){all} 0.156836 0.019526 0.000072 0.438632 0.117740 200.18 346.09 1.002
r(A<->T){all} 0.165302 0.020099 0.000001 0.457893 0.125765 74.68 108.82 1.001
r(C<->G){all} 0.155461 0.020167 0.000091 0.447108 0.110584 138.04 139.91 1.000
r(C<->T){all} 0.216155 0.026937 0.000304 0.536800 0.177394 164.24 212.82 1.001
r(G<->T){all} 0.156096 0.019251 0.000054 0.442467 0.118496 204.48 238.97 1.000
pi(A){all} 0.188073 0.000146 0.164140 0.210858 0.187947 1290.09 1293.12 1.000
pi(C){all} 0.280076 0.000195 0.252333 0.307058 0.279904 1247.71 1306.80 1.001
pi(G){all} 0.312042 0.000203 0.282707 0.338367 0.311731 1050.93 1078.11 1.000
pi(T){all} 0.219809 0.000164 0.194622 0.245071 0.219805 1281.04 1297.86 1.003
alpha{1,2} 0.297876 0.128865 0.000652 1.058254 0.191790 1252.21 1295.00 1.000
alpha{3} 0.403971 0.204577 0.000159 1.306914 0.241964 1243.51 1316.13 1.000
pinvar{all} 0.996721 0.000007 0.991620 0.999887 0.997416 1411.66 1437.69 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .**.**
9 -- .*..*.
10 -- .****.
11 -- ..**..
12 -- .*.*..
13 -- .***.*
14 -- .*...*
15 -- ..*.*.
16 -- ...**.
17 -- .*.***
18 -- ...*.*
19 -- ....**
20 -- ..*..*
21 -- ..****
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.009422 0.145903 0.159227 2
8 453 0.150899 0.002355 0.149234 0.152565 2
9 451 0.150233 0.008009 0.144570 0.155896 2
10 444 0.147901 0.002827 0.145903 0.149900 2
11 443 0.147568 0.008951 0.141239 0.153897 2
12 438 0.145903 0.000942 0.145237 0.146569 2
13 437 0.145570 0.003298 0.143238 0.147901 2
14 431 0.143571 0.007066 0.138574 0.148568 2
15 427 0.142239 0.000471 0.141905 0.142572 2
16 420 0.139907 0.014133 0.129913 0.149900 2
17 417 0.138907 0.000471 0.138574 0.139241 2
18 414 0.137908 0.007537 0.132578 0.143238 2
19 413 0.137575 0.015546 0.126582 0.148568 2
20 404 0.134577 0.000000 0.134577 0.134577 2
21 379 0.126249 0.001413 0.125250 0.127249 2
22 299 0.099600 0.001413 0.098601 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.090537 0.008619 0.000048 0.278975 0.061209 1.000 2
length{all}[2] 0.093602 0.009002 0.000026 0.279359 0.064421 1.000 2
length{all}[3] 0.092226 0.009117 0.000033 0.277841 0.062933 1.000 2
length{all}[4] 0.088468 0.007623 0.000034 0.263277 0.061320 1.000 2
length{all}[5] 0.140912 0.015774 0.000111 0.374733 0.107288 1.000 2
length{all}[6] 0.090438 0.008544 0.000031 0.269312 0.060086 1.000 2
length{all}[7] 0.102895 0.010255 0.000111 0.297043 0.072686 0.998 2
length{all}[8] 0.092135 0.007974 0.000859 0.284528 0.064284 1.016 2
length{all}[9] 0.095728 0.008597 0.000271 0.261604 0.073088 1.005 2
length{all}[10] 0.091878 0.009574 0.000061 0.286919 0.063258 0.999 2
length{all}[11] 0.091984 0.008477 0.000032 0.288816 0.060788 0.999 2
length{all}[12] 0.095393 0.008786 0.000130 0.282597 0.067887 1.000 2
length{all}[13] 0.096123 0.010455 0.000032 0.291246 0.060833 0.998 2
length{all}[14] 0.092182 0.008229 0.000023 0.270859 0.064025 1.000 2
length{all}[15] 0.094403 0.008628 0.000098 0.288473 0.060830 0.998 2
length{all}[16] 0.093810 0.009064 0.000128 0.274915 0.064483 1.002 2
length{all}[17] 0.090404 0.006964 0.000111 0.257205 0.065743 0.998 2
length{all}[18] 0.092423 0.008748 0.000526 0.272588 0.061748 0.998 2
length{all}[19] 0.090427 0.008943 0.000317 0.271315 0.063631 0.998 2
length{all}[20] 0.087709 0.007925 0.000040 0.262565 0.064218 1.001 2
length{all}[21] 0.091888 0.008457 0.000529 0.267524 0.063909 1.005 2
length{all}[22] 0.105274 0.011070 0.000483 0.310124 0.074090 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005241
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.016
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------- C1 (1)
|
|------------------------------------------- C2 (2)
|
|------------------------------------------ C3 (3)
+
|----------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\---------------------------------------- C6 (6)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1029
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 59 patterns at 343 / 343 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 59 patterns at 343 / 343 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
57584 bytes for conP
5192 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.089979 0.070601 0.035482 0.103705 0.012589 0.107829 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1490.700332
Iterating by ming2
Initial: fx= 1490.700332
x= 0.08998 0.07060 0.03548 0.10370 0.01259 0.10783 0.30000 1.30000
1 h-m-p 0.0000 0.0000 795.5805 +YCYYCCC 1463.533664 6 0.0000 24 | 0/8
2 h-m-p 0.0000 0.0000 7044.8049 ++ 1430.775180 m 0.0000 35 | 1/8
3 h-m-p 0.0001 0.0007 70.4038 ++ 1411.329538 m 0.0007 46 | 1/8
4 h-m-p 0.0011 0.0248 45.9590 -----------.. | 1/8
5 h-m-p 0.0000 0.0000 236570.7157 ---YCYYCYYCCC 1405.724074 9 0.0000 93 | 1/8
6 h-m-p 0.0000 0.0000 677.3340 ++ 1383.356902 m 0.0000 104 | 2/8
7 h-m-p 0.0006 0.0284 45.1654 -----------.. | 2/8
8 h-m-p 0.0000 0.0001 587.5104 ++ 1362.418817 m 0.0001 135 | 3/8
9 h-m-p 0.0000 0.0000 35146.8347 ++ 1353.792682 m 0.0000 146 | 4/8
10 h-m-p 0.0000 0.0000 169.8955 ++ 1352.294313 m 0.0000 157 | 5/8
11 h-m-p 0.0041 2.0381 3.8475 ++++YYYC 1349.440623 3 0.9756 175 | 5/8
12 h-m-p 1.6000 8.0000 0.4610 +CCC 1349.100492 2 5.9674 191 | 5/8
13 h-m-p 1.6000 8.0000 0.1420 ++ 1348.975855 m 8.0000 205 | 5/8
14 h-m-p 0.8929 8.0000 1.2718 +YCCC 1348.887698 3 2.3779 225 | 5/8
15 h-m-p 1.6000 8.0000 0.3501 ++ 1348.798774 m 8.0000 236 | 5/8
16 h-m-p 0.6963 8.0000 4.0218 +YYC 1348.714718 2 2.2599 253 | 5/8
17 h-m-p 1.6000 8.0000 3.7198 YYCC 1348.658698 3 2.2079 268 | 5/8
18 h-m-p 1.6000 8.0000 4.3977 +CC 1348.606367 1 5.5979 282 | 5/8
19 h-m-p 1.6000 8.0000 7.2511 YYC 1348.585378 2 2.3511 295 | 5/8
20 h-m-p 1.6000 8.0000 10.5109 +CC 1348.562400 1 5.5857 309 | 5/8
21 h-m-p 1.6000 8.0000 17.5934 CYC 1348.553098 2 2.1764 323 | 5/8
22 h-m-p 1.6000 8.0000 23.6334 +CC 1348.543083 1 6.0080 337 | 5/8
23 h-m-p 1.6000 8.0000 41.3766 CYC 1348.539054 2 2.0882 351 | 5/8
24 h-m-p 1.6000 8.0000 53.7053 +C 1348.534741 0 6.4000 363 | 5/8
25 h-m-p 1.2451 6.2256 98.2475 YC 1348.533019 1 2.0560 375 | 5/8
26 h-m-p 0.6747 3.3736 121.5424 ++ 1348.531590 m 3.3736 386 | 6/8
27 h-m-p 0.2516 1.2580 69.4691 ++ 1348.531540 m 1.2580 397 | 7/8
28 h-m-p 0.4389 8.0000 0.0000 Y 1348.531532 0 1.0233 408
Out..
lnL = -1348.531532
409 lfun, 409 eigenQcodon, 2454 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.085569 0.092758 0.041446 0.023245 0.047506 0.095389 999.000000 0.552209 0.128883
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.028467
np = 9
lnL0 = -1468.986293
Iterating by ming2
Initial: fx= 1468.986293
x= 0.08557 0.09276 0.04145 0.02325 0.04751 0.09539 951.42857 0.55221 0.12888
1 h-m-p 0.0000 0.0001 728.2753 ++ 1428.223198 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 714.1813 +YCYYCYCYC 1416.840063 8 0.0000 39 | 1/9
3 h-m-p 0.0000 0.0002 409.4522 ++ 1398.896703 m 0.0002 51 | 2/9
4 h-m-p 0.0000 0.0000 105338.7726 ++ 1388.981207 m 0.0000 63 | 3/9
5 h-m-p 0.0004 0.0054 54.3481 ++ 1379.468380 m 0.0054 75 | 4/9
6 h-m-p 0.0000 0.0002 165.7974 ++ 1365.207510 m 0.0002 87 | 5/9
7 h-m-p 0.0002 0.0046 191.2355 +++ 1351.506907 m 0.0046 100 | 6/9
8 h-m-p 0.0000 0.0000 210.9035 ++ 1348.903698 m 0.0000 112 | 7/9
9 h-m-p 0.4056 8.0000 0.0004 +CYC 1348.888265 2 1.2820 128 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 C 1348.888265 0 2.0689 142
Out..
lnL = -1348.888265
143 lfun, 429 eigenQcodon, 1716 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.095690 0.054336 0.055716 0.085474 0.045898 0.071846 951.428577 1.168923 0.173340 0.497804 1154.226981
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000147
np = 11
lnL0 = -1401.044107
Iterating by ming2
Initial: fx= 1401.044107
x= 0.09569 0.05434 0.05572 0.08547 0.04590 0.07185 951.42858 1.16892 0.17334 0.49780 951.42857
1 h-m-p 0.0000 0.0011 114.3757 ++++ 1374.610288 m 0.0011 18 | 1/11
2 h-m-p 0.0007 0.0034 35.5786 +YYYYYYYY 1372.347939 7 0.0027 40 | 1/11
3 h-m-p 0.0000 0.0002 2494.2071 ++ 1351.579219 m 0.0002 54 | 2/11
4 h-m-p 0.0000 0.0000 4286.0374 ++ 1350.924163 m 0.0000 68 | 3/11
5 h-m-p 0.0000 0.0000 217029.6044 ++ 1350.243698 m 0.0000 82 | 4/11
6 h-m-p 0.0000 0.0000 4142.0195 ++ 1348.858632 m 0.0000 96 | 5/11
7 h-m-p 0.1073 8.0000 0.9541 ++CYCCC 1348.541396 4 1.3923 119 | 5/11
8 h-m-p 1.6000 8.0000 0.0777 ++ 1348.536493 m 8.0000 139 | 5/11
9 h-m-p 1.6000 8.0000 0.3803 +YC 1348.532250 1 7.1821 161 | 5/11
10 h-m-p 1.6000 8.0000 0.0261 YC 1348.532125 1 2.9489 182 | 5/11
11 h-m-p 0.3446 8.0000 0.2237 +++ 1348.531836 m 8.0000 203 | 5/11
12 h-m-p 1.6000 8.0000 0.5553 YC 1348.531758 1 3.3654 224 | 5/11
13 h-m-p 1.6000 8.0000 0.6374 C 1348.531720 0 1.9664 244 | 5/11
14 h-m-p 1.6000 8.0000 0.6325 +Y 1348.531695 0 5.4172 265 | 5/11
15 h-m-p 1.6000 8.0000 0.9968 C 1348.531685 0 1.8036 285 | 5/11
16 h-m-p 1.6000 8.0000 0.8654 Y 1348.531681 0 3.9578 305 | 5/11
17 h-m-p 1.6000 8.0000 1.1861 C 1348.531679 0 2.1906 325 | 5/11
18 h-m-p 1.5107 7.5534 1.5663 +Y 1348.531678 0 6.5737 340 | 5/11
19 h-m-p 0.6736 3.3678 0.4557 C 1348.531678 0 0.7766 354 | 5/11
20 h-m-p 1.0617 5.3083 0.2224 Y 1348.531678 0 0.7415 374 | 5/11
21 h-m-p 0.2392 1.4730 0.6896 C 1348.531678 0 0.1971 394 | 5/11
22 h-m-p 0.1306 0.8455 1.0405 C 1348.531678 0 0.2075 414 | 5/11
23 h-m-p 1.6000 8.0000 0.1267 Y 1348.531678 0 0.9410 428 | 5/11
24 h-m-p 1.6000 8.0000 0.0503 ++ 1348.531678 m 8.0000 448 | 5/11
25 h-m-p 0.0249 0.1243 3.0621 ++ 1348.531678 m 0.1243 468 | 5/11
26 h-m-p 0.0000 0.0000 677.1520
h-m-p: 0.00000000e+00 0.00000000e+00 6.77151987e+02 1348.531678
.. | 5/11
27 h-m-p 0.0001 0.0522 0.0579 -C 1348.531678 0 0.0000 494 | 5/11
28 h-m-p 0.1085 8.0000 0.0000 Y 1348.531678 0 0.0271 514
Out..
lnL = -1348.531678
515 lfun, 2060 eigenQcodon, 9270 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1353.469989 S = -1352.031099 -2.367452
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 59 patterns 0:03
did 20 / 59 patterns 0:03
did 30 / 59 patterns 0:03
did 40 / 59 patterns 0:03
did 50 / 59 patterns 0:03
did 59 / 59 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.062224 0.082462 0.057052 0.014126 0.020973 0.013507 951.431014 0.444779 1.662143
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.043134
np = 9
lnL0 = -1430.802781
Iterating by ming2
Initial: fx= 1430.802781
x= 0.06222 0.08246 0.05705 0.01413 0.02097 0.01351 951.43101 0.44478 1.66214
1 h-m-p 0.0000 0.0000 782.5780 ++ 1406.057424 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 32047.9042 ++ 1405.178068 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0001 509.8814 ++ 1371.407411 m 0.0001 38 | 2/9
4 h-m-p 0.0010 0.0051 23.0637 ++ 1361.832645 m 0.0051 50 | 3/9
5 h-m-p 0.0000 0.0000 172.8795 ++ 1358.658589 m 0.0000 62 | 4/9
6 h-m-p 0.0003 0.1329 22.4401 +++++ 1352.031392 m 0.1329 77 | 5/9
7 h-m-p 0.2583 1.2917 0.1950 +
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
+ 1351.859260 m 1.2917 89
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30145, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
8 h-m-p 0.6324 3.5310 0.1779
QuantileBeta(0.85, 3.18912, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27348, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.29457, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.29985, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30116, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30149, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30158, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-..
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30145, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
9 h-m-p 0.0000 0.0011 44947.9827
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
C 1348.888279 4 0.0000 143
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30161, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
+ 1348.888277 m 8.0000 155
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30146, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30160, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
11 h-m-p 0.1003 8.0000 0.0002
QuantileBeta(0.85, 3.30161, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30161, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.30166, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
C 1348.888263 0 1.5863 172
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30177, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30147, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
12 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
C 1348.888263 0 0.0001 193
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1348.888263
194 lfun, 2134 eigenQcodon, 11640 P(t)
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.30162, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.067521 0.096992 0.047317 0.080960 0.023632 0.086780 951.431328 0.900000 1.169321 1.036904 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000271
np = 11
lnL0 = -1381.483080
Iterating by ming2
Initial: fx= 1381.483080
x= 0.06752 0.09699 0.04732 0.08096 0.02363 0.08678 951.43133 0.90000 1.16932 1.03690 951.42857
1 h-m-p 0.0000 0.0004 258.2318 ++YCYYYCCC 1361.415367 7 0.0003 29 | 0/11
2 h-m-p 0.0004 0.0020 46.0099 ++ 1357.631387 m 0.0020 43 | 1/11
3 h-m-p 0.0000 0.0001 536.6820 ++ 1355.606570 m 0.0001 57 | 2/11
4 h-m-p 0.0009 0.0043 8.8253 ++ 1354.700831 m 0.0043 71 | 3/11
5 h-m-p 0.0001 0.0004 100.4501 ++ 1352.045623 m 0.0004 85 | 4/11
6 h-m-p 0.0030 0.0152 3.2933 ++ 1351.300708 m 0.0152 99 | 5/11
7 h-m-p 0.0342 0.5673 1.4423 CCC 1351.293400 2 0.0447 117 | 5/11
8 h-m-p 0.0079 0.1920 8.1792 ++
QuantileBeta(0.15, 0.00500, 2.23223) = 1.172485e-160 2000 rounds
+ 1351.035052 m 0.1920 132
QuantileBeta(0.15, 0.00500, 2.23223) = 1.172485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23223) = 1.172485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23223) = 1.172485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23223) = 1.172485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23223) = 1.172485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23223) = 1.172485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23223) = 1.172485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23223) = 1.172485e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23223) = 1.213416e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23224) = 1.172484e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23223) = 1.172485e-160 2000 rounds
| 6/11
9 h-m-p 0.5589 2.7944 0.7974 YYYC 1350.787188 3 0.5966 149 | 6/11
10 h-m-p 1.1686 5.8429 0.2998 ----------------.. | 6/11
11 h-m-p 0.0000 0.0002 52.9687 +YYYC 1350.726025 3 0.0000 205 | 6/11
12 h-m-p 0.0001 0.0061 16.5161 ++CYYCYYYCYY 1348.631298 10 0.0058 234 | 6/11
13 h-m-p 1.6000 8.0000 0.0275 ---CC 1348.630456 1 0.0090 253 | 6/11
14 h-m-p 0.2098 8.0000 0.0012 +++ 1348.553569 m 8.0000 273 | 6/11
15 h-m-p 1.6000 8.0000 0.0008 YYC 1348.551982 2 1.2848 294 | 6/11
16 h-m-p 0.6865 8.0000 0.0016 ++ 1348.540863 m 8.0000 313 | 6/11
17 h-m-p 1.6000 8.0000 0.0038 CC 1348.539133 1 2.0552 334 | 6/11
18 h-m-p 1.3115 8.0000 0.0059 +YC 1348.536201 1 3.2901 355 | 6/11
19 h-m-p 1.6000 8.0000 0.0093 C 1348.534882 0 1.6000 374 | 6/11
20 h-m-p 1.6000 8.0000 0.0064 +Y 1348.533658 0 6.8731 394 | 6/11
21 h-m-p 1.6000 8.0000 0.0226 YY 1348.533006 1 1.3707 414 | 6/11
22 h-m-p 1.6000 8.0000 0.0159 ++ 1348.532248 m 8.0000 433 | 6/11
23 h-m-p 1.6000 8.0000 0.0461 YC 1348.532057 1 2.8450 453 | 6/11
24 h-m-p 1.6000 8.0000 0.0578 YC 1348.531864 1 2.6999 473 | 6/11
25 h-m-p 0.9810 4.9052 0.0897 +Y 1348.531740 0 3.0220 493 | 6/11
26 h-m-p 0.3048 1.5239 0.1109 ++ 1348.531679 m 1.5239 512 | 7/11
27 h-m-p 1.6000 8.0000 0.0029 Y 1348.531678 0 1.0699 531 | 7/11
28 h-m-p 1.6000 8.0000 0.0002 -----C 1348.531678 0 0.0004 554
Out..
lnL = -1348.531678
555 lfun, 6660 eigenQcodon, 36630 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1353.209022 S = -1352.031224 -1.981267
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 59 patterns 0:16
did 20 / 59 patterns 0:16
did 30 / 59 patterns 0:16
did 40 / 59 patterns 0:16
did 50 / 59 patterns 0:17
did 59 / 59 patterns 0:17
Time used: 0:17
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/12res/trpS/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 343
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 4 4 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1
TTC 11 11 11 11 11 11 | TCC 5 5 5 5 5 5 | TAC 7 7 7 7 7 7 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 14 14 14 14 14 14 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 5 5 5 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 2 2 2 2 2 2 | CCC 5 5 5 5 5 5 | CAC 5 5 5 5 5 5 | CGC 3 3 3 3 3 3
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 5 5 5 5 5 5 | CGA 1 1 1 1 1 1
CTG 12 12 12 12 12 12 | CCG 8 8 8 8 8 8 | CAG 15 15 15 15 15 15 | CGG 10 10 10 10 10 10
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 1 1 1 1 1 1 | Ser AGT 4 4 4 4 4 4
ATC 8 8 8 8 8 8 | ACC 15 15 15 15 15 15 | AAC 4 4 4 4 4 4 | AGC 4 4 4 4 4 4
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 7 7 7 7 | ACG 3 3 3 3 3 3 | AAG 9 9 9 9 9 9 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 9 9 9 9 10 9 | Ala GCT 6 6 6 6 5 6 | Asp GAT 15 15 15 15 15 15 | Gly GGT 5 5 5 5 5 5
GTC 11 11 11 11 11 11 | GCC 14 14 14 14 14 14 | GAC 16 16 16 16 16 16 | GGC 8 8 8 8 8 8
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 5 5 5 5 5 5 | GGA 3 3 3 3 3 3
GTG 14 14 14 14 14 14 | GCG 16 16 16 16 16 16 | GAG 8 8 8 8 8 8 | GGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907876_1_715_MLBR_RS03395
position 1: T:0.16035 C:0.23615 A:0.20117 G:0.40233
position 2: T:0.30029 C:0.25364 A:0.28863 G:0.15743
position 3: T:0.19825 C:0.34694 A:0.07580 G:0.37901
Average T:0.21963 C:0.27891 A:0.18853 G:0.31293
#2: NC_002677_1_NP_301552_1_424_trpS
position 1: T:0.16035 C:0.23615 A:0.20117 G:0.40233
position 2: T:0.30029 C:0.25364 A:0.28863 G:0.15743
position 3: T:0.19825 C:0.34694 A:0.07580 G:0.37901
Average T:0.21963 C:0.27891 A:0.18853 G:0.31293
#3: NZ_LVXE01000001_1_WP_010907876_1_101_A3216_RS00495
position 1: T:0.16035 C:0.23615 A:0.20117 G:0.40233
position 2: T:0.30029 C:0.25364 A:0.28863 G:0.15743
position 3: T:0.19825 C:0.34694 A:0.07580 G:0.37901
Average T:0.21963 C:0.27891 A:0.18853 G:0.31293
#4: NZ_LYPH01000001_1_WP_010907876_1_89_A8144_RS00440
position 1: T:0.16035 C:0.23615 A:0.20117 G:0.40233
position 2: T:0.30029 C:0.25364 A:0.28863 G:0.15743
position 3: T:0.19825 C:0.34694 A:0.07580 G:0.37901
Average T:0.21963 C:0.27891 A:0.18853 G:0.31293
#5: NZ_CP029543_1_WP_111480987_1_733_trpS
position 1: T:0.16035 C:0.23615 A:0.20117 G:0.40233
position 2: T:0.30321 C:0.25073 A:0.28863 G:0.15743
position 3: T:0.19825 C:0.34694 A:0.07580 G:0.37901
Average T:0.22060 C:0.27794 A:0.18853 G:0.31293
#6: NZ_AP014567_1_WP_010907876_1_748_trpS
position 1: T:0.16035 C:0.23615 A:0.20117 G:0.40233
position 2: T:0.30029 C:0.25364 A:0.28863 G:0.15743
position 3: T:0.19825 C:0.34694 A:0.07580 G:0.37901
Average T:0.21963 C:0.27891 A:0.18853 G:0.31293
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 24 | Ser S TCT 12 | Tyr Y TAT 18 | Cys C TGT 6
TTC 66 | TCC 30 | TAC 42 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 84 | TCG 24 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 30 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 24
CTC 12 | CCC 30 | CAC 30 | CGC 18
CTA 6 | CCA 12 | Gln Q CAA 30 | CGA 6
CTG 72 | CCG 48 | CAG 90 | CGG 60
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 6 | Ser S AGT 24
ATC 48 | ACC 90 | AAC 24 | AGC 24
ATA 6 | ACA 12 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 42 | ACG 18 | AAG 54 | AGG 6
------------------------------------------------------------------------------
Val V GTT 55 | Ala A GCT 35 | Asp D GAT 90 | Gly G GGT 30
GTC 66 | GCC 84 | GAC 96 | GGC 48
GTA 6 | GCA 6 | Glu E GAA 30 | GGA 18
GTG 84 | GCG 96 | GAG 48 | GGG 36
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16035 C:0.23615 A:0.20117 G:0.40233
position 2: T:0.30078 C:0.25316 A:0.28863 G:0.15743
position 3: T:0.19825 C:0.34694 A:0.07580 G:0.37901
Average T:0.21979 C:0.27875 A:0.18853 G:0.31293
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -1348.531532 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.003023 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003043
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.003023, 6: 0.000004);
(NC_011896_1_WP_010907876_1_715_MLBR_RS03395: 0.000004, NC_002677_1_NP_301552_1_424_trpS: 0.000004, NZ_LVXE01000001_1_WP_010907876_1_101_A3216_RS00495: 0.000004, NZ_LYPH01000001_1_WP_010907876_1_89_A8144_RS00440: 0.000004, NZ_CP029543_1_WP_111480987_1_733_trpS: 0.003023, NZ_AP014567_1_WP_010907876_1_748_trpS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 738.1 290.9 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 738.1 290.9 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 738.1 290.9 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 738.1 290.9 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.003 738.1 290.9 999.0000 0.0014 0.0000 1.0 0.0
7..6 0.000 738.1 290.9 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0014
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1348.888265 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.002949 0.000004 951.428577 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002969
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.002949, 6: 0.000004);
(NC_011896_1_WP_010907876_1_715_MLBR_RS03395: 0.000004, NC_002677_1_NP_301552_1_424_trpS: 0.000004, NZ_LVXE01000001_1_WP_010907876_1_101_A3216_RS00495: 0.000004, NZ_LYPH01000001_1_WP_010907876_1_89_A8144_RS00440: 0.000004, NZ_CP029543_1_WP_111480987_1_733_trpS: 0.002949, NZ_AP014567_1_WP_010907876_1_748_trpS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42858
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 738.1 290.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 738.1 290.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 738.1 290.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 738.1 290.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.003 738.1 290.9 1.0000 0.0010 0.0010 0.7 0.3
7..6 0.000 738.1 290.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1348.531678 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.003023 0.000004 951.431014 0.000000 0.000087 1.000000 951.435664
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003043
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.003023, 6: 0.000004);
(NC_011896_1_WP_010907876_1_715_MLBR_RS03395: 0.000004, NC_002677_1_NP_301552_1_424_trpS: 0.000004, NZ_LVXE01000001_1_WP_010907876_1_101_A3216_RS00495: 0.000004, NZ_LYPH01000001_1_WP_010907876_1_89_A8144_RS00440: 0.000004, NZ_CP029543_1_WP_111480987_1_733_trpS: 0.003023, NZ_AP014567_1_WP_010907876_1_748_trpS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.43101
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00009 0.99991
w: 1.00000 1.00000 951.43566
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 738.1 290.9 951.3526 0.0000 0.0000 0.0 0.0
7..2 0.000 738.1 290.9 951.3526 0.0000 0.0000 0.0 0.0
7..3 0.000 738.1 290.9 951.3526 0.0000 0.0000 0.0 0.0
7..4 0.000 738.1 290.9 951.3526 0.0000 0.0000 0.0 0.0
7..5 0.003 738.1 290.9 951.3526 0.0014 0.0000 1.0 0.0
7..6 0.000 738.1 290.9 951.3526 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907876_1_715_MLBR_RS03395)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.352
2 S 1.000** 951.352
3 T 1.000** 951.352
4 A 1.000** 951.352
5 T 1.000** 951.352
6 G 1.000** 951.352
7 F 1.000** 951.352
8 S 1.000** 951.352
9 R 1.000** 951.352
10 I 1.000** 951.352
11 F 1.000** 951.352
12 S 1.000** 951.352
13 G 1.000** 951.352
14 V 1.000** 951.352
15 Q 1.000** 951.352
16 P 1.000** 951.352
17 T 1.000** 951.352
18 S 1.000** 951.352
19 D 1.000** 951.352
20 S 1.000** 951.352
21 L 1.000** 951.352
22 H 1.000** 951.352
23 L 1.000** 951.352
24 G 1.000** 951.352
25 N 1.000** 951.352
26 A 1.000** 951.352
27 L 1.000** 951.352
28 G 1.000** 951.352
29 A 1.000** 951.352
30 I 1.000** 951.352
31 T 1.000** 951.352
32 Q 1.000** 951.352
33 W 1.000** 951.352
34 V 1.000** 951.352
35 A 1.000** 951.352
36 L 1.000** 951.352
37 Q 1.000** 951.352
38 Y 1.000** 951.352
39 D 1.000** 951.352
40 H 1.000** 951.352
41 P 1.000** 951.352
42 D 1.000** 951.352
43 E 1.000** 951.353
44 Y 1.000** 951.352
45 E 1.000** 951.353
46 A 1.000** 951.352
47 F 1.000** 951.352
48 F 1.000** 951.352
49 C 1.000** 951.352
50 V 1.000** 951.352
51 V 1.000** 951.352
52 D 1.000** 951.352
53 L 1.000** 951.352
54 H 1.000** 951.352
55 A 1.000** 951.352
56 I 1.000** 951.352
57 T 1.000** 951.352
58 I 1.000** 951.352
59 A 1.000** 951.352
60 Q 1.000** 951.353
61 D 1.000** 951.352
62 P 1.000** 951.352
63 E 1.000** 951.352
64 T 1.000** 951.352
65 L 1.000** 951.352
66 W 1.000** 951.352
67 R 1.000** 951.352
68 R 1.000** 951.352
69 T 1.000** 951.352
70 L 1.000** 951.352
71 V 1.000** 951.352
72 T 1.000** 951.352
73 A 1.000** 951.352
74 A 1.000** 951.352
75 Q 1.000** 951.353
76 Y 1.000** 951.352
77 L 1.000** 951.352
78 A 1.000** 951.352
79 L 1.000** 951.352
80 G 1.000** 951.352
81 I 1.000** 951.352
82 D 1.000** 951.352
83 P 1.000** 951.352
84 G 1.000** 951.352
85 R 1.000** 951.352
86 A 1.000** 951.352
87 V 1.000** 951.352
88 V 1.000** 951.352
89 F 1.000** 951.352
90 V 1.000** 951.352
91 Q 1.000** 951.353
92 S 1.000** 951.352
93 H 1.000** 951.352
94 V 1.000** 951.352
95 P 1.000** 951.353
96 A 1.000** 951.352
97 H 1.000** 951.352
98 T 1.000** 951.352
99 Q 1.000** 951.352
100 L 1.000** 951.352
101 A 1.000** 951.352
102 W 1.000** 951.352
103 V 1.000** 951.352
104 L 1.000** 951.352
105 G 1.000** 951.352
106 C 1.000** 951.352
107 F 1.000** 951.352
108 T 1.000** 951.352
109 G 1.000** 951.352
110 F 1.000** 951.352
111 G 1.000** 951.352
112 Q 1.000** 951.352
113 A 1.000** 951.352
114 S 1.000** 951.352
115 R 1.000** 951.352
116 M 1.000** 951.352
117 T 1.000** 951.352
118 Q 1.000** 951.352
119 F 1.000** 951.352
120 K 1.000** 951.352
121 D 1.000** 951.352
122 K 1.000** 951.352
123 A 1.000** 951.352
124 L 1.000** 951.352
125 R 1.000** 951.352
126 Q 1.000** 951.352
127 G 1.000** 951.352
128 A 1.000** 951.352
129 D 1.000** 951.352
130 S 1.000** 951.352
131 T 1.000** 951.352
132 T 1.000** 951.352
133 V 1.000** 951.352
134 G 1.000** 951.352
135 L 1.000** 951.352
136 F 1.000** 951.352
137 T 1.000** 951.352
138 Y 1.000** 951.352
139 P 1.000** 951.352
140 V 1.000** 951.352
141 L 1.000** 951.352
142 Q 1.000** 951.352
143 A 1.000** 951.352
144 A 1.000** 951.352
145 D 1.000** 951.352
146 V 1.000** 951.352
147 L 1.000** 951.352
148 A 1.000** 951.352
149 Y 1.000** 951.352
150 D 1.000** 951.352
151 T 1.000** 951.352
152 D 1.000** 951.352
153 L 1.000** 951.352
154 V 1.000** 951.352
155 P 1.000** 951.352
156 V 1.000** 951.352
157 G 1.000** 951.352
158 E 1.000** 951.352
159 D 1.000** 951.352
160 Q 1.000** 951.352
161 R 1.000** 951.352
162 Q 1.000** 951.352
163 H 1.000** 951.352
164 L 1.000** 951.352
165 E 1.000** 951.352
166 L 1.000** 951.352
167 A 1.000** 951.352
168 R 1.000** 951.352
169 D 1.000** 951.352
170 L 1.000** 951.352
171 A 1.000** 951.352
172 Q 1.000** 951.352
173 R 1.000** 951.352
174 F 1.000** 951.352
175 N 1.000** 951.352
176 S 1.000** 951.352
177 R 1.000** 951.352
178 F 1.000** 951.352
179 P 1.000** 951.352
180 D 1.000** 951.352
181 T 1.000** 951.352
182 F 1.000** 951.352
183 V 1.000** 951.352
184 V 1.000** 951.352
185 P 1.000** 951.352
186 D 1.000** 951.352
187 M 1.000** 951.352
188 F 1.000** 951.352
189 I 1.000** 951.352
190 P 1.000** 951.352
191 K 1.000** 951.352
192 M 1.000** 951.352
193 A 1.000** 951.436
194 A 1.000** 951.352
195 K 1.000** 951.352
196 I 1.000** 951.352
197 Y 1.000** 951.352
198 D 1.000** 951.352
199 L 1.000** 951.352
200 A 1.000** 951.352
201 D 1.000** 951.352
202 P 1.000** 951.353
203 T 1.000** 951.352
204 S 1.000** 951.352
205 K 1.000** 951.352
206 M 1.000** 951.352
207 S 1.000** 951.352
208 K 1.000** 951.352
209 S 1.000** 951.352
210 A 1.000** 951.352
211 S 1.000** 951.352
212 S 1.000** 951.352
213 D 1.000** 951.352
214 A 1.000** 951.352
215 G 1.000** 951.352
216 L 1.000** 951.352
217 I 1.000** 951.352
218 N 1.000** 951.352
219 L 1.000** 951.352
220 L 1.000** 951.352
221 D 1.000** 951.352
222 D 1.000** 951.352
223 P 1.000** 951.352
224 A 1.000** 951.352
225 L 1.000** 951.352
226 S 1.000** 951.352
227 V 1.000** 951.352
228 K 1.000** 951.352
229 K 1.000** 951.352
230 I 1.000** 951.352
231 R 1.000** 951.353
232 A 1.000** 951.352
233 A 1.000** 951.352
234 V 1.000** 951.352
235 T 1.000** 951.352
236 D 1.000** 951.352
237 S 1.000** 951.352
238 E 1.000** 951.353
239 R 1.000** 951.352
240 E 1.000** 951.352
241 I 1.000** 951.352
242 R 1.000** 951.352
243 Y 1.000** 951.352
244 D 1.000** 951.352
245 P 1.000** 951.352
246 E 1.000** 951.352
247 V 1.000** 951.352
248 K 1.000** 951.352
249 P 1.000** 951.352
250 G 1.000** 951.352
251 V 1.000** 951.352
252 S 1.000** 951.352
253 N 1.000** 951.352
254 L 1.000** 951.352
255 L 1.000** 951.352
256 N 1.000** 951.352
257 I 1.000** 951.352
258 Q 1.000** 951.352
259 S 1.000** 951.352
260 A 1.000** 951.352
261 V 1.000** 951.352
262 T 1.000** 951.352
263 G 1.000** 951.352
264 V 1.000** 951.352
265 D 1.000** 951.352
266 V 1.000** 951.352
267 D 1.000** 951.352
268 T 1.000** 951.352
269 L 1.000** 951.352
270 V 1.000** 951.352
271 Q 1.000** 951.352
272 R 1.000** 951.352
273 Y 1.000** 951.352
274 V 1.000** 951.352
275 G 1.000** 951.352
276 H 1.000** 951.352
277 G 1.000** 951.352
278 Y 1.000** 951.352
279 G 1.000** 951.352
280 D 1.000** 951.352
281 L 1.000** 951.352
282 K 1.000** 951.352
283 K 1.000** 951.352
284 D 1.000** 951.352
285 T 1.000** 951.352
286 A 1.000** 951.352
287 E 1.000** 951.352
288 A 1.000** 951.352
289 V 1.000** 951.352
290 V 1.000** 951.352
291 E 1.000** 951.352
292 F 1.000** 951.352
293 V 1.000** 951.352
294 S 1.000** 951.352
295 P 1.000** 951.352
296 I 1.000** 951.352
297 K 1.000** 951.352
298 D 1.000** 951.352
299 R 1.000** 951.352
300 V 1.000** 951.352
301 D 1.000** 951.352
302 E 1.000** 951.353
303 L 1.000** 951.352
304 M 1.000** 951.352
305 A 1.000** 951.352
306 D 1.000** 951.352
307 L 1.000** 951.353
308 T 1.000** 951.352
309 E 1.000** 951.353
310 L 1.000** 951.352
311 E 1.000** 951.352
312 V 1.000** 951.352
313 V 1.000** 951.352
314 L 1.000** 951.352
315 A 1.000** 951.352
316 V 1.000** 951.352
317 G 1.000** 951.352
318 A 1.000** 951.352
319 Q 1.000** 951.352
320 R 1.000** 951.352
321 A 1.000** 951.352
322 Q 1.000** 951.353
323 D 1.000** 951.352
324 V 1.000** 951.352
325 A 1.000** 951.352
326 G 1.000** 951.352
327 K 1.000** 951.352
328 T 1.000** 951.352
329 M 1.000** 951.352
330 Q 1.000** 951.352
331 R 1.000** 951.352
332 V 1.000** 951.352
333 Y 1.000** 951.352
334 D 1.000** 951.352
335 R 1.000** 951.352
336 L 1.000** 951.352
337 G 1.000** 951.352
338 F 1.000** 951.352
339 L 1.000** 951.352
340 P 1.000** 951.352
341 Q 1.000** 951.353
342 R 1.000** 951.352
343 G 1.000** 951.352
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907876_1_715_MLBR_RS03395)
Pr(w>1) post mean +- SE for w
193 A 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1348.888263 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.002949 0.000004 951.431328 3.301618 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002969
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.002949, 6: 0.000004);
(NC_011896_1_WP_010907876_1_715_MLBR_RS03395: 0.000004, NC_002677_1_NP_301552_1_424_trpS: 0.000004, NZ_LVXE01000001_1_WP_010907876_1_101_A3216_RS00495: 0.000004, NZ_LYPH01000001_1_WP_010907876_1_89_A8144_RS00440: 0.000004, NZ_CP029543_1_WP_111480987_1_733_trpS: 0.002949, NZ_AP014567_1_WP_010907876_1_748_trpS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.43133
Parameters in M7 (beta):
p = 3.30162 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 738.1 290.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 738.1 290.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 738.1 290.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 738.1 290.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.003 738.1 290.9 1.0000 0.0010 0.0010 0.7 0.3
7..6 0.000 738.1 290.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1348.531678 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.003023 0.000004 951.441183 0.000010 0.005000 1.756734 951.484682
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003043
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.003023, 6: 0.000004);
(NC_011896_1_WP_010907876_1_715_MLBR_RS03395: 0.000004, NC_002677_1_NP_301552_1_424_trpS: 0.000004, NZ_LVXE01000001_1_WP_010907876_1_101_A3216_RS00495: 0.000004, NZ_LYPH01000001_1_WP_010907876_1_89_A8144_RS00440: 0.000004, NZ_CP029543_1_WP_111480987_1_733_trpS: 0.003023, NZ_AP014567_1_WP_010907876_1_748_trpS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.44118
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.75673
(p1 = 0.99999) w = 951.48468
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 951.48468
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 738.1 290.9 951.4752 0.0000 0.0000 0.0 0.0
7..2 0.000 738.1 290.9 951.4752 0.0000 0.0000 0.0 0.0
7..3 0.000 738.1 290.9 951.4752 0.0000 0.0000 0.0 0.0
7..4 0.000 738.1 290.9 951.4752 0.0000 0.0000 0.0 0.0
7..5 0.003 738.1 290.9 951.4752 0.0014 0.0000 1.0 0.0
7..6 0.000 738.1 290.9 951.4752 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907876_1_715_MLBR_RS03395)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.475
2 S 1.000** 951.475
3 T 1.000** 951.475
4 A 1.000** 951.475
5 T 1.000** 951.475
6 G 1.000** 951.475
7 F 1.000** 951.475
8 S 1.000** 951.475
9 R 1.000** 951.475
10 I 1.000** 951.475
11 F 1.000** 951.475
12 S 1.000** 951.475
13 G 1.000** 951.475
14 V 1.000** 951.475
15 Q 1.000** 951.475
16 P 1.000** 951.475
17 T 1.000** 951.475
18 S 1.000** 951.475
19 D 1.000** 951.475
20 S 1.000** 951.475
21 L 1.000** 951.475
22 H 1.000** 951.475
23 L 1.000** 951.475
24 G 1.000** 951.475
25 N 1.000** 951.475
26 A 1.000** 951.475
27 L 1.000** 951.475
28 G 1.000** 951.475
29 A 1.000** 951.475
30 I 1.000** 951.475
31 T 1.000** 951.475
32 Q 1.000** 951.475
33 W 1.000** 951.475
34 V 1.000** 951.475
35 A 1.000** 951.475
36 L 1.000** 951.475
37 Q 1.000** 951.475
38 Y 1.000** 951.475
39 D 1.000** 951.475
40 H 1.000** 951.475
41 P 1.000** 951.475
42 D 1.000** 951.475
43 E 1.000** 951.475
44 Y 1.000** 951.475
45 E 1.000** 951.475
46 A 1.000** 951.475
47 F 1.000** 951.475
48 F 1.000** 951.475
49 C 1.000** 951.475
50 V 1.000** 951.475
51 V 1.000** 951.475
52 D 1.000** 951.475
53 L 1.000** 951.475
54 H 1.000** 951.475
55 A 1.000** 951.475
56 I 1.000** 951.475
57 T 1.000** 951.475
58 I 1.000** 951.475
59 A 1.000** 951.475
60 Q 1.000** 951.475
61 D 1.000** 951.475
62 P 1.000** 951.475
63 E 1.000** 951.475
64 T 1.000** 951.475
65 L 1.000** 951.475
66 W 1.000** 951.475
67 R 1.000** 951.475
68 R 1.000** 951.475
69 T 1.000** 951.475
70 L 1.000** 951.475
71 V 1.000** 951.475
72 T 1.000** 951.475
73 A 1.000** 951.475
74 A 1.000** 951.475
75 Q 1.000** 951.475
76 Y 1.000** 951.475
77 L 1.000** 951.475
78 A 1.000** 951.475
79 L 1.000** 951.475
80 G 1.000** 951.475
81 I 1.000** 951.475
82 D 1.000** 951.475
83 P 1.000** 951.475
84 G 1.000** 951.475
85 R 1.000** 951.475
86 A 1.000** 951.475
87 V 1.000** 951.475
88 V 1.000** 951.475
89 F 1.000** 951.475
90 V 1.000** 951.475
91 Q 1.000** 951.475
92 S 1.000** 951.475
93 H 1.000** 951.475
94 V 1.000** 951.475
95 P 1.000** 951.475
96 A 1.000** 951.475
97 H 1.000** 951.475
98 T 1.000** 951.475
99 Q 1.000** 951.475
100 L 1.000** 951.475
101 A 1.000** 951.475
102 W 1.000** 951.475
103 V 1.000** 951.475
104 L 1.000** 951.475
105 G 1.000** 951.475
106 C 1.000** 951.475
107 F 1.000** 951.475
108 T 1.000** 951.475
109 G 1.000** 951.475
110 F 1.000** 951.475
111 G 1.000** 951.475
112 Q 1.000** 951.475
113 A 1.000** 951.475
114 S 1.000** 951.475
115 R 1.000** 951.475
116 M 1.000** 951.475
117 T 1.000** 951.475
118 Q 1.000** 951.475
119 F 1.000** 951.475
120 K 1.000** 951.475
121 D 1.000** 951.475
122 K 1.000** 951.475
123 A 1.000** 951.475
124 L 1.000** 951.475
125 R 1.000** 951.475
126 Q 1.000** 951.475
127 G 1.000** 951.475
128 A 1.000** 951.475
129 D 1.000** 951.475
130 S 1.000** 951.475
131 T 1.000** 951.475
132 T 1.000** 951.475
133 V 1.000** 951.475
134 G 1.000** 951.475
135 L 1.000** 951.475
136 F 1.000** 951.475
137 T 1.000** 951.475
138 Y 1.000** 951.475
139 P 1.000** 951.475
140 V 1.000** 951.475
141 L 1.000** 951.475
142 Q 1.000** 951.475
143 A 1.000** 951.475
144 A 1.000** 951.475
145 D 1.000** 951.475
146 V 1.000** 951.475
147 L 1.000** 951.475
148 A 1.000** 951.475
149 Y 1.000** 951.475
150 D 1.000** 951.475
151 T 1.000** 951.475
152 D 1.000** 951.475
153 L 1.000** 951.475
154 V 1.000** 951.475
155 P 1.000** 951.475
156 V 1.000** 951.475
157 G 1.000** 951.475
158 E 1.000** 951.475
159 D 1.000** 951.475
160 Q 1.000** 951.475
161 R 1.000** 951.475
162 Q 1.000** 951.475
163 H 1.000** 951.475
164 L 1.000** 951.475
165 E 1.000** 951.475
166 L 1.000** 951.475
167 A 1.000** 951.475
168 R 1.000** 951.475
169 D 1.000** 951.475
170 L 1.000** 951.475
171 A 1.000** 951.475
172 Q 1.000** 951.475
173 R 1.000** 951.475
174 F 1.000** 951.475
175 N 1.000** 951.475
176 S 1.000** 951.475
177 R 1.000** 951.475
178 F 1.000** 951.475
179 P 1.000** 951.475
180 D 1.000** 951.475
181 T 1.000** 951.475
182 F 1.000** 951.475
183 V 1.000** 951.475
184 V 1.000** 951.475
185 P 1.000** 951.475
186 D 1.000** 951.475
187 M 1.000** 951.475
188 F 1.000** 951.475
189 I 1.000** 951.475
190 P 1.000** 951.475
191 K 1.000** 951.475
192 M 1.000** 951.475
193 A 1.000** 951.485
194 A 1.000** 951.475
195 K 1.000** 951.475
196 I 1.000** 951.475
197 Y 1.000** 951.475
198 D 1.000** 951.475
199 L 1.000** 951.475
200 A 1.000** 951.475
201 D 1.000** 951.475
202 P 1.000** 951.475
203 T 1.000** 951.475
204 S 1.000** 951.475
205 K 1.000** 951.475
206 M 1.000** 951.475
207 S 1.000** 951.475
208 K 1.000** 951.475
209 S 1.000** 951.475
210 A 1.000** 951.475
211 S 1.000** 951.475
212 S 1.000** 951.475
213 D 1.000** 951.475
214 A 1.000** 951.475
215 G 1.000** 951.475
216 L 1.000** 951.475
217 I 1.000** 951.475
218 N 1.000** 951.475
219 L 1.000** 951.475
220 L 1.000** 951.475
221 D 1.000** 951.475
222 D 1.000** 951.475
223 P 1.000** 951.475
224 A 1.000** 951.475
225 L 1.000** 951.475
226 S 1.000** 951.475
227 V 1.000** 951.475
228 K 1.000** 951.475
229 K 1.000** 951.475
230 I 1.000** 951.475
231 R 1.000** 951.475
232 A 1.000** 951.475
233 A 1.000** 951.475
234 V 1.000** 951.475
235 T 1.000** 951.475
236 D 1.000** 951.475
237 S 1.000** 951.475
238 E 1.000** 951.475
239 R 1.000** 951.475
240 E 1.000** 951.475
241 I 1.000** 951.475
242 R 1.000** 951.475
243 Y 1.000** 951.475
244 D 1.000** 951.475
245 P 1.000** 951.475
246 E 1.000** 951.475
247 V 1.000** 951.475
248 K 1.000** 951.475
249 P 1.000** 951.475
250 G 1.000** 951.475
251 V 1.000** 951.475
252 S 1.000** 951.475
253 N 1.000** 951.475
254 L 1.000** 951.475
255 L 1.000** 951.475
256 N 1.000** 951.475
257 I 1.000** 951.475
258 Q 1.000** 951.475
259 S 1.000** 951.475
260 A 1.000** 951.475
261 V 1.000** 951.475
262 T 1.000** 951.475
263 G 1.000** 951.475
264 V 1.000** 951.475
265 D 1.000** 951.475
266 V 1.000** 951.475
267 D 1.000** 951.475
268 T 1.000** 951.475
269 L 1.000** 951.475
270 V 1.000** 951.475
271 Q 1.000** 951.475
272 R 1.000** 951.475
273 Y 1.000** 951.475
274 V 1.000** 951.475
275 G 1.000** 951.475
276 H 1.000** 951.475
277 G 1.000** 951.475
278 Y 1.000** 951.475
279 G 1.000** 951.475
280 D 1.000** 951.475
281 L 1.000** 951.475
282 K 1.000** 951.475
283 K 1.000** 951.475
284 D 1.000** 951.475
285 T 1.000** 951.475
286 A 1.000** 951.475
287 E 1.000** 951.475
288 A 1.000** 951.475
289 V 1.000** 951.475
290 V 1.000** 951.475
291 E 1.000** 951.475
292 F 1.000** 951.475
293 V 1.000** 951.475
294 S 1.000** 951.475
295 P 1.000** 951.475
296 I 1.000** 951.475
297 K 1.000** 951.475
298 D 1.000** 951.475
299 R 1.000** 951.475
300 V 1.000** 951.475
301 D 1.000** 951.475
302 E 1.000** 951.475
303 L 1.000** 951.475
304 M 1.000** 951.475
305 A 1.000** 951.475
306 D 1.000** 951.475
307 L 1.000** 951.475
308 T 1.000** 951.475
309 E 1.000** 951.475
310 L 1.000** 951.475
311 E 1.000** 951.475
312 V 1.000** 951.475
313 V 1.000** 951.475
314 L 1.000** 951.475
315 A 1.000** 951.475
316 V 1.000** 951.475
317 G 1.000** 951.475
318 A 1.000** 951.475
319 Q 1.000** 951.475
320 R 1.000** 951.475
321 A 1.000** 951.475
322 Q 1.000** 951.475
323 D 1.000** 951.475
324 V 1.000** 951.475
325 A 1.000** 951.475
326 G 1.000** 951.475
327 K 1.000** 951.475
328 T 1.000** 951.475
329 M 1.000** 951.475
330 Q 1.000** 951.475
331 R 1.000** 951.475
332 V 1.000** 951.475
333 Y 1.000** 951.475
334 D 1.000** 951.475
335 R 1.000** 951.475
336 L 1.000** 951.475
337 G 1.000** 951.475
338 F 1.000** 951.475
339 L 1.000** 951.475
340 P 1.000** 951.475
341 Q 1.000** 951.475
342 R 1.000** 951.475
343 G 1.000** 951.475
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907876_1_715_MLBR_RS03395)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.860 +- 3.856
2 S 0.639 4.860 +- 3.856
3 T 0.639 4.860 +- 3.856
4 A 0.639 4.860 +- 3.856
5 T 0.639 4.860 +- 3.856
6 G 0.639 4.860 +- 3.856
7 F 0.639 4.860 +- 3.856
8 S 0.639 4.860 +- 3.856
9 R 0.639 4.860 +- 3.856
10 I 0.639 4.860 +- 3.856
11 F 0.639 4.860 +- 3.856
12 S 0.639 4.860 +- 3.856
13 G 0.639 4.860 +- 3.856
14 V 0.639 4.860 +- 3.856
15 Q 0.639 4.860 +- 3.856
16 P 0.639 4.860 +- 3.856
17 T 0.639 4.860 +- 3.856
18 S 0.639 4.860 +- 3.856
19 D 0.639 4.860 +- 3.856
20 S 0.639 4.860 +- 3.856
21 L 0.639 4.860 +- 3.856
22 H 0.639 4.860 +- 3.856
23 L 0.639 4.860 +- 3.856
24 G 0.639 4.860 +- 3.856
25 N 0.639 4.860 +- 3.856
26 A 0.639 4.860 +- 3.856
27 L 0.639 4.860 +- 3.856
28 G 0.639 4.860 +- 3.856
29 A 0.639 4.860 +- 3.856
30 I 0.639 4.860 +- 3.856
31 T 0.639 4.860 +- 3.856
32 Q 0.639 4.860 +- 3.856
33 W 0.639 4.860 +- 3.856
34 V 0.639 4.860 +- 3.856
35 A 0.639 4.860 +- 3.856
36 L 0.639 4.860 +- 3.856
37 Q 0.639 4.860 +- 3.856
38 Y 0.639 4.860 +- 3.856
39 D 0.639 4.860 +- 3.856
40 H 0.639 4.860 +- 3.856
41 P 0.639 4.860 +- 3.856
42 D 0.639 4.860 +- 3.856
43 E 0.639 4.860 +- 3.856
44 Y 0.639 4.860 +- 3.856
45 E 0.639 4.860 +- 3.856
46 A 0.639 4.860 +- 3.856
47 F 0.639 4.860 +- 3.856
48 F 0.639 4.860 +- 3.856
49 C 0.639 4.860 +- 3.856
50 V 0.639 4.860 +- 3.856
51 V 0.639 4.860 +- 3.856
52 D 0.639 4.860 +- 3.856
53 L 0.639 4.860 +- 3.856
54 H 0.639 4.860 +- 3.856
55 A 0.639 4.860 +- 3.856
56 I 0.639 4.860 +- 3.856
57 T 0.639 4.860 +- 3.856
58 I 0.639 4.860 +- 3.856
59 A 0.639 4.860 +- 3.856
60 Q 0.639 4.860 +- 3.856
61 D 0.639 4.860 +- 3.856
62 P 0.639 4.860 +- 3.856
63 E 0.639 4.860 +- 3.856
64 T 0.639 4.860 +- 3.856
65 L 0.639 4.860 +- 3.856
66 W 0.639 4.860 +- 3.856
67 R 0.639 4.860 +- 3.856
68 R 0.639 4.860 +- 3.856
69 T 0.639 4.860 +- 3.856
70 L 0.639 4.860 +- 3.856
71 V 0.639 4.860 +- 3.856
72 T 0.639 4.860 +- 3.856
73 A 0.639 4.860 +- 3.856
74 A 0.639 4.860 +- 3.856
75 Q 0.639 4.860 +- 3.856
76 Y 0.639 4.860 +- 3.856
77 L 0.639 4.860 +- 3.856
78 A 0.639 4.860 +- 3.856
79 L 0.639 4.860 +- 3.856
80 G 0.639 4.860 +- 3.856
81 I 0.639 4.860 +- 3.856
82 D 0.639 4.860 +- 3.856
83 P 0.639 4.860 +- 3.856
84 G 0.639 4.860 +- 3.856
85 R 0.639 4.860 +- 3.856
86 A 0.639 4.860 +- 3.856
87 V 0.639 4.860 +- 3.856
88 V 0.639 4.860 +- 3.856
89 F 0.639 4.860 +- 3.856
90 V 0.639 4.860 +- 3.856
91 Q 0.639 4.860 +- 3.856
92 S 0.639 4.860 +- 3.856
93 H 0.639 4.860 +- 3.856
94 V 0.639 4.860 +- 3.856
95 P 0.639 4.860 +- 3.856
96 A 0.639 4.860 +- 3.856
97 H 0.639 4.860 +- 3.856
98 T 0.639 4.860 +- 3.856
99 Q 0.639 4.860 +- 3.856
100 L 0.639 4.860 +- 3.856
101 A 0.639 4.860 +- 3.856
102 W 0.639 4.860 +- 3.856
103 V 0.639 4.860 +- 3.856
104 L 0.639 4.860 +- 3.856
105 G 0.639 4.860 +- 3.856
106 C 0.639 4.860 +- 3.856
107 F 0.639 4.860 +- 3.856
108 T 0.639 4.860 +- 3.856
109 G 0.639 4.860 +- 3.856
110 F 0.639 4.860 +- 3.856
111 G 0.639 4.860 +- 3.856
112 Q 0.639 4.860 +- 3.856
113 A 0.639 4.860 +- 3.856
114 S 0.639 4.860 +- 3.856
115 R 0.639 4.860 +- 3.856
116 M 0.639 4.860 +- 3.856
117 T 0.639 4.860 +- 3.856
118 Q 0.639 4.860 +- 3.856
119 F 0.639 4.860 +- 3.856
120 K 0.639 4.860 +- 3.856
121 D 0.639 4.860 +- 3.856
122 K 0.639 4.860 +- 3.856
123 A 0.639 4.860 +- 3.856
124 L 0.639 4.860 +- 3.856
125 R 0.639 4.860 +- 3.856
126 Q 0.639 4.860 +- 3.856
127 G 0.639 4.860 +- 3.856
128 A 0.639 4.860 +- 3.856
129 D 0.639 4.860 +- 3.856
130 S 0.639 4.860 +- 3.856
131 T 0.639 4.860 +- 3.856
132 T 0.639 4.860 +- 3.856
133 V 0.639 4.860 +- 3.856
134 G 0.639 4.860 +- 3.856
135 L 0.639 4.860 +- 3.856
136 F 0.639 4.860 +- 3.856
137 T 0.639 4.860 +- 3.856
138 Y 0.639 4.860 +- 3.856
139 P 0.639 4.860 +- 3.856
140 V 0.639 4.860 +- 3.856
141 L 0.639 4.860 +- 3.856
142 Q 0.639 4.860 +- 3.856
143 A 0.639 4.860 +- 3.856
144 A 0.639 4.860 +- 3.856
145 D 0.639 4.860 +- 3.856
146 V 0.639 4.860 +- 3.856
147 L 0.639 4.860 +- 3.856
148 A 0.639 4.860 +- 3.856
149 Y 0.639 4.860 +- 3.856
150 D 0.639 4.860 +- 3.856
151 T 0.639 4.860 +- 3.856
152 D 0.639 4.860 +- 3.856
153 L 0.639 4.860 +- 3.856
154 V 0.639 4.860 +- 3.856
155 P 0.639 4.860 +- 3.856
156 V 0.639 4.860 +- 3.856
157 G 0.639 4.860 +- 3.856
158 E 0.639 4.860 +- 3.856
159 D 0.639 4.860 +- 3.856
160 Q 0.639 4.860 +- 3.856
161 R 0.639 4.860 +- 3.856
162 Q 0.639 4.860 +- 3.856
163 H 0.639 4.860 +- 3.856
164 L 0.639 4.860 +- 3.856
165 E 0.639 4.860 +- 3.856
166 L 0.639 4.860 +- 3.856
167 A 0.639 4.860 +- 3.856
168 R 0.639 4.860 +- 3.856
169 D 0.639 4.860 +- 3.856
170 L 0.639 4.860 +- 3.856
171 A 0.639 4.860 +- 3.856
172 Q 0.639 4.860 +- 3.856
173 R 0.639 4.860 +- 3.856
174 F 0.639 4.860 +- 3.856
175 N 0.639 4.860 +- 3.856
176 S 0.639 4.860 +- 3.856
177 R 0.639 4.860 +- 3.856
178 F 0.639 4.860 +- 3.856
179 P 0.639 4.860 +- 3.856
180 D 0.639 4.860 +- 3.856
181 T 0.639 4.860 +- 3.856
182 F 0.639 4.860 +- 3.856
183 V 0.639 4.860 +- 3.856
184 V 0.639 4.860 +- 3.856
185 P 0.639 4.860 +- 3.856
186 D 0.639 4.860 +- 3.856
187 M 0.639 4.860 +- 3.856
188 F 0.639 4.860 +- 3.856
189 I 0.639 4.860 +- 3.856
190 P 0.639 4.860 +- 3.856
191 K 0.639 4.860 +- 3.856
192 M 0.639 4.860 +- 3.856
193 A 0.923 6.858 +- 3.003
194 A 0.639 4.860 +- 3.856
195 K 0.639 4.860 +- 3.856
196 I 0.639 4.860 +- 3.856
197 Y 0.639 4.860 +- 3.856
198 D 0.639 4.860 +- 3.856
199 L 0.639 4.860 +- 3.856
200 A 0.639 4.860 +- 3.856
201 D 0.639 4.860 +- 3.856
202 P 0.639 4.860 +- 3.856
203 T 0.639 4.860 +- 3.856
204 S 0.639 4.860 +- 3.856
205 K 0.639 4.860 +- 3.856
206 M 0.639 4.860 +- 3.856
207 S 0.639 4.860 +- 3.856
208 K 0.639 4.860 +- 3.856
209 S 0.639 4.860 +- 3.856
210 A 0.639 4.860 +- 3.856
211 S 0.639 4.860 +- 3.856
212 S 0.639 4.860 +- 3.856
213 D 0.639 4.860 +- 3.856
214 A 0.639 4.860 +- 3.856
215 G 0.639 4.860 +- 3.856
216 L 0.639 4.860 +- 3.856
217 I 0.639 4.860 +- 3.856
218 N 0.639 4.860 +- 3.856
219 L 0.639 4.860 +- 3.856
220 L 0.639 4.860 +- 3.856
221 D 0.639 4.860 +- 3.856
222 D 0.639 4.860 +- 3.856
223 P 0.639 4.860 +- 3.856
224 A 0.639 4.860 +- 3.856
225 L 0.639 4.860 +- 3.856
226 S 0.639 4.860 +- 3.856
227 V 0.639 4.860 +- 3.856
228 K 0.639 4.860 +- 3.856
229 K 0.639 4.860 +- 3.856
230 I 0.639 4.860 +- 3.856
231 R 0.639 4.860 +- 3.856
232 A 0.639 4.860 +- 3.856
233 A 0.639 4.860 +- 3.856
234 V 0.639 4.860 +- 3.856
235 T 0.639 4.860 +- 3.856
236 D 0.639 4.860 +- 3.856
237 S 0.639 4.860 +- 3.856
238 E 0.639 4.860 +- 3.856
239 R 0.639 4.860 +- 3.856
240 E 0.639 4.860 +- 3.856
241 I 0.639 4.860 +- 3.856
242 R 0.639 4.860 +- 3.856
243 Y 0.639 4.860 +- 3.856
244 D 0.639 4.860 +- 3.856
245 P 0.639 4.860 +- 3.856
246 E 0.639 4.860 +- 3.856
247 V 0.639 4.860 +- 3.856
248 K 0.639 4.860 +- 3.856
249 P 0.639 4.860 +- 3.856
250 G 0.639 4.860 +- 3.856
251 V 0.639 4.860 +- 3.856
252 S 0.639 4.860 +- 3.856
253 N 0.639 4.860 +- 3.856
254 L 0.639 4.860 +- 3.856
255 L 0.639 4.860 +- 3.856
256 N 0.639 4.860 +- 3.856
257 I 0.639 4.860 +- 3.856
258 Q 0.639 4.860 +- 3.856
259 S 0.639 4.860 +- 3.856
260 A 0.639 4.860 +- 3.856
261 V 0.639 4.860 +- 3.856
262 T 0.639 4.860 +- 3.856
263 G 0.639 4.860 +- 3.856
264 V 0.639 4.860 +- 3.856
265 D 0.639 4.860 +- 3.856
266 V 0.639 4.860 +- 3.856
267 D 0.639 4.860 +- 3.856
268 T 0.639 4.860 +- 3.856
269 L 0.639 4.860 +- 3.856
270 V 0.639 4.860 +- 3.856
271 Q 0.639 4.860 +- 3.856
272 R 0.639 4.860 +- 3.856
273 Y 0.639 4.860 +- 3.856
274 V 0.639 4.860 +- 3.856
275 G 0.639 4.860 +- 3.856
276 H 0.639 4.860 +- 3.856
277 G 0.639 4.860 +- 3.856
278 Y 0.639 4.860 +- 3.856
279 G 0.639 4.860 +- 3.856
280 D 0.639 4.860 +- 3.856
281 L 0.639 4.860 +- 3.856
282 K 0.639 4.860 +- 3.856
283 K 0.639 4.860 +- 3.856
284 D 0.639 4.860 +- 3.856
285 T 0.639 4.860 +- 3.856
286 A 0.639 4.860 +- 3.856
287 E 0.639 4.860 +- 3.856
288 A 0.639 4.860 +- 3.856
289 V 0.639 4.860 +- 3.856
290 V 0.639 4.860 +- 3.856
291 E 0.639 4.860 +- 3.856
292 F 0.639 4.860 +- 3.856
293 V 0.639 4.860 +- 3.856
294 S 0.639 4.860 +- 3.856
295 P 0.639 4.860 +- 3.856
296 I 0.639 4.860 +- 3.856
297 K 0.639 4.860 +- 3.856
298 D 0.639 4.860 +- 3.856
299 R 0.639 4.860 +- 3.856
300 V 0.639 4.860 +- 3.856
301 D 0.639 4.860 +- 3.856
302 E 0.639 4.860 +- 3.856
303 L 0.639 4.860 +- 3.856
304 M 0.639 4.860 +- 3.856
305 A 0.639 4.860 +- 3.856
306 D 0.639 4.860 +- 3.856
307 L 0.639 4.860 +- 3.856
308 T 0.639 4.860 +- 3.856
309 E 0.639 4.860 +- 3.856
310 L 0.639 4.860 +- 3.856
311 E 0.639 4.860 +- 3.856
312 V 0.639 4.860 +- 3.856
313 V 0.639 4.860 +- 3.856
314 L 0.639 4.860 +- 3.856
315 A 0.639 4.860 +- 3.856
316 V 0.639 4.860 +- 3.856
317 G 0.639 4.860 +- 3.856
318 A 0.639 4.860 +- 3.856
319 Q 0.639 4.860 +- 3.856
320 R 0.639 4.860 +- 3.856
321 A 0.639 4.860 +- 3.856
322 Q 0.639 4.860 +- 3.856
323 D 0.639 4.860 +- 3.856
324 V 0.639 4.860 +- 3.856
325 A 0.639 4.860 +- 3.856
326 G 0.639 4.860 +- 3.856
327 K 0.639 4.860 +- 3.856
328 T 0.639 4.860 +- 3.856
329 M 0.639 4.860 +- 3.856
330 Q 0.639 4.860 +- 3.856
331 R 0.639 4.860 +- 3.856
332 V 0.639 4.860 +- 3.856
333 Y 0.639 4.860 +- 3.856
334 D 0.639 4.860 +- 3.856
335 R 0.639 4.860 +- 3.856
336 L 0.639 4.860 +- 3.856
337 G 0.639 4.860 +- 3.856
338 F 0.639 4.860 +- 3.856
339 L 0.639 4.860 +- 3.856
340 P 0.639 4.860 +- 3.856
341 Q 0.639 4.860 +- 3.856
342 R 0.639 4.860 +- 3.856
343 G 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:17