--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:42:41 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/trpS/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1421.09         -1424.69
2      -1421.20         -1425.73
--------------------------------------
TOTAL    -1421.15         -1425.34
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.878685    0.087890    0.321777    1.441564    0.843779   1359.60   1430.30    1.000
r(A<->C){all}   0.150149    0.019100    0.000001    0.429468    0.106154    199.69    236.20    1.001
r(A<->G){all}   0.156836    0.019526    0.000072    0.438632    0.117740    200.18    346.09    1.002
r(A<->T){all}   0.165302    0.020099    0.000001    0.457893    0.125765     74.68    108.82    1.001
r(C<->G){all}   0.155461    0.020167    0.000091    0.447108    0.110584    138.04    139.91    1.000
r(C<->T){all}   0.216155    0.026937    0.000304    0.536800    0.177394    164.24    212.82    1.001
r(G<->T){all}   0.156096    0.019251    0.000054    0.442467    0.118496    204.48    238.97    1.000
pi(A){all}      0.188073    0.000146    0.164140    0.210858    0.187947   1290.09   1293.12    1.000
pi(C){all}      0.280076    0.000195    0.252333    0.307058    0.279904   1247.71   1306.80    1.001
pi(G){all}      0.312042    0.000203    0.282707    0.338367    0.311731   1050.93   1078.11    1.000
pi(T){all}      0.219809    0.000164    0.194622    0.245071    0.219805   1281.04   1297.86    1.003
alpha{1,2}      0.297876    0.128865    0.000652    1.058254    0.191790   1252.21   1295.00    1.000
alpha{3}        0.403971    0.204577    0.000159    1.306914    0.241964   1243.51   1316.13    1.000
pinvar{all}     0.996721    0.000007    0.991620    0.999887    0.997416   1411.66   1437.69    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1348.888265
Model 2: PositiveSelection	-1348.531678
Model 0: one-ratio	-1348.531532
Model 7: beta	-1348.888263
Model 8: beta&w>1	-1348.531678


Model 0 vs 1	0.7134660000001531

Model 2 vs 1	0.7131739999999809

Model 8 vs 7	0.713169999999991
>C1
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C2
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C3
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C4
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C5
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMVAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C6
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=343 

C1              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C2              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C3              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C4              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C5              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C6              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
                **************************************************

C1              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C2              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C3              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C4              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C5              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C6              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
                **************************************************

C1              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C2              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C3              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C4              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C5              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C6              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
                **************************************************

C1              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C2              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C3              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C4              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C5              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMVAKIYDLA
C6              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
                ******************************************.*******

C1              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C2              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C3              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C4              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C5              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C6              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
                **************************************************

C1              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C2              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C3              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C4              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C5              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C6              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
                **************************************************

C1              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C2              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C3              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C4              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C5              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C6              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
                *******************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  343 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  343 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10290]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [10290]--->[10290]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.518 Mb, Max= 30.913 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C2              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C3              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C4              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C5              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
C6              MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
                **************************************************

C1              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C2              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C3              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C4              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C5              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
C6              VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
                **************************************************

C1              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C2              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C3              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C4              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C5              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
C6              AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
                **************************************************

C1              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C2              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C3              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C4              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
C5              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMVAKIYDLA
C6              TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
                ******************************************.*******

C1              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C2              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C3              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C4              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C5              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
C6              DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
                **************************************************

C1              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C2              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C3              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C4              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C5              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
C6              VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
                **************************************************

C1              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C2              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C3              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C4              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C5              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
C6              DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
                *******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 99.71 C1	 C5	 99.71
TOP	    4    0	 99.71 C5	 C1	 99.71
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 99.71 C2	 C5	 99.71
TOP	    4    1	 99.71 C5	 C2	 99.71
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 99.71 C3	 C5	 99.71
TOP	    4    2	 99.71 C5	 C3	 99.71
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 99.71 C4	 C5	 99.71
TOP	    4    3	 99.71 C5	 C4	 99.71
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 99.71 C5	 C6	 99.71
TOP	    5    4	 99.71 C6	 C5	 99.71
AVG	 0	 C1	  *	 99.94
AVG	 1	 C2	  *	 99.94
AVG	 2	 C3	  *	 99.94
AVG	 3	 C4	  *	 99.94
AVG	 4	 C5	  *	 99.71
AVG	 5	 C6	  *	 99.94
TOT	 TOT	  *	 99.90
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
C2              ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
C3              ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
C4              ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
C5              ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
C6              ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
                **************************************************

C1              TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
C2              TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
C3              TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
C4              TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
C5              TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
C6              TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
                **************************************************

C1              TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
C2              TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
C3              TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
C4              TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
C5              TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
C6              TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
                **************************************************

C1              GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
C2              GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
C3              GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
C4              GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
C5              GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
C6              GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
                **************************************************

C1              TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
C2              TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
C3              TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
C4              TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
C5              TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
C6              TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
                **************************************************

C1              GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
C2              GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
C3              GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
C4              GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
C5              GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
C6              GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
                **************************************************

C1              GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
C2              GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
C3              GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
C4              GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
C5              GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
C6              GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
                **************************************************

C1              ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
C2              ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
C3              ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
C4              ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
C5              ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
C6              ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
                **************************************************

C1              GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
C2              GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
C3              GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
C4              GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
C5              GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
C6              GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
                **************************************************

C1              ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
C2              ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
C3              ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
C4              ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
C5              ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
C6              ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
                **************************************************

C1              GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
C2              GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
C3              GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
C4              GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
C5              GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
C6              GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
                **************************************************

C1              TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
C2              TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
C3              TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
C4              TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
C5              TTCCCGACATGTTCATTCCCAAGATGGTTGCCAAGATCTACGATTTGGCC
C6              TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
                *************************** **********************

C1              GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
C2              GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
C3              GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
C4              GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
C5              GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
C6              GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
                **************************************************

C1              CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
C2              CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
C3              CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
C4              CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
C5              CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
C6              CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
                **************************************************

C1              TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
C2              TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
C3              TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
C4              TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
C5              TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
C6              TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
                **************************************************

C1              GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
C2              GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
C3              GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
C4              GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
C5              GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
C6              GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
                **************************************************

C1              TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
C2              TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
C3              TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
C4              TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
C5              TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
C6              TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
                **************************************************

C1              ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
C2              ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
C3              ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
C4              ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
C5              ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
C6              ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
                **************************************************

C1              GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
C2              GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
C3              GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
C4              GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
C5              GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
C6              GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
                **************************************************

C1              AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
C2              AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
C3              AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
C4              AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
C5              AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
C6              AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
                **************************************************

C1              ACCGGCTGGGCTTTCTTCCGCAACGGGGG
C2              ACCGGCTGGGCTTTCTTCCGCAACGGGGG
C3              ACCGGCTGGGCTTTCTTCCGCAACGGGGG
C4              ACCGGCTGGGCTTTCTTCCGCAACGGGGG
C5              ACCGGCTGGGCTTTCTTCCGCAACGGGGG
C6              ACCGGCTGGGCTTTCTTCCGCAACGGGGG
                *****************************



>C1
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C2
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C3
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C4
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C5
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGTTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C6
ATGAGTACCGCTACCGGATTCAGCAGGATTTTCTCCGGCGTGCAGCCCAC
TTCTGATTCGCTTCACCTCGGTAACGCGTTGGGTGCCATCACCCAGTGGG
TTGCGCTGCAGTACGATCATCCGGACGAATACGAAGCGTTCTTTTGTGTG
GTTGACCTGCACGCCATAACCATCGCGCAAGATCCCGAGACACTGTGGCG
TCGGACCCTGGTCACTGCCGCGCAATACCTGGCCTTGGGCATCGATCCGG
GGCGCGCCGTCGTTTTCGTGCAAAGCCATGTACCAGCCCACACGCAGTTG
GCGTGGGTGCTGGGCTGCTTTACCGGCTTCGGACAGGCGTCTCGGATGAC
ACAGTTCAAGGACAAGGCGCTGCGTCAGGGTGCCGACTCCACCACCGTCG
GCCTGTTCACCTATCCTGTGTTGCAGGCTGCCGACGTGTTGGCCTACGAT
ACTGATCTGGTGCCCGTGGGGGAGGATCAGCGGCAGCACTTGGAGCTTGC
GCGTGACTTGGCGCAGCGGTTCAATAGCCGCTTCCCGGACACCTTTGTGG
TTCCCGACATGTTCATTCCCAAGATGGCTGCCAAGATCTACGATTTGGCC
GACCCAACGTCGAAAATGAGTAAATCGGCGTCCAGTGATGCTGGGTTGAT
CAACCTGCTCGACGATCCGGCGTTGTCCGTCAAGAAAATTCGAGCAGCGG
TGACCGACAGTGAACGGGAGATCCGGTATGATCCGGAGGTCAAGCCGGGT
GTGTCGAACTTGTTGAACATCCAGTCCGCGGTCACCGGGGTTGATGTCGA
TACCCTTGTGCAGCGCTACGTTGGGCACGGTTATGGCGACCTGAAGAAAG
ACACCGCCGAGGCCGTGGTCGAGTTCGTCAGCCCGATCAAGGACCGGGTC
GACGAATTGATGGCCGATCTAACCGAATTGGAGGTTGTTCTTGCGGTCGG
AGCGCAGCGTGCTCAAGATGTGGCTGGCAAGACGATGCAGCGGGTTTACG
ACCGGCTGGGCTTTCTTCCGCAACGGGGG
>C1
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C2
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C3
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C4
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C5
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMVAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG
>C6
MSTATGFSRIFSGVQPTSDSLHLGNALGAITQWVALQYDHPDEYEAFFCV
VDLHAITIAQDPETLWRRTLVTAAQYLALGIDPGRAVVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKALRQGADSTTVGLFTYPVLQAADVLAYD
TDLVPVGEDQRQHLELARDLAQRFNSRFPDTFVVPDMFIPKMAAKIYDLA
DPTSKMSKSASSDAGLINLLDDPALSVKKIRAAVTDSEREIRYDPEVKPG
VSNLLNIQSAVTGVDVDTLVQRYVGHGYGDLKKDTAEAVVEFVSPIKDRV
DELMADLTELEVVLAVGAQRAQDVAGKTMQRVYDRLGFLPQRG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1029 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790473
      Setting output file names to "/data/12res/trpS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 220177891
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0538955121
      Seed = 2138082342
      Swapseed = 1579790473
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2306.352641 -- -24.965149
         Chain 2 -- -2306.353774 -- -24.965149
         Chain 3 -- -2306.353774 -- -24.965149
         Chain 4 -- -2306.354057 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2306.354190 -- -24.965149
         Chain 2 -- -2306.353774 -- -24.965149
         Chain 3 -- -2306.354190 -- -24.965149
         Chain 4 -- -2306.354190 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2306.353] (-2306.354) (-2306.354) (-2306.354) * [-2306.354] (-2306.354) (-2306.354) (-2306.354) 
        500 -- (-1433.559) (-1450.745) (-1434.656) [-1426.924] * (-1426.676) (-1442.798) (-1432.250) [-1427.142] -- 0:00:00
       1000 -- [-1422.003] (-1430.574) (-1429.788) (-1425.365) * (-1429.896) (-1431.222) (-1430.583) [-1425.767] -- 0:00:00
       1500 -- [-1422.467] (-1429.584) (-1425.456) (-1433.326) * (-1427.522) (-1428.743) [-1425.484] (-1427.975) -- 0:00:00
       2000 -- [-1425.311] (-1432.626) (-1425.610) (-1434.476) * (-1424.184) (-1426.195) (-1439.794) [-1426.512] -- 0:00:00
       2500 -- [-1424.560] (-1426.989) (-1438.656) (-1429.793) * [-1431.296] (-1429.978) (-1428.824) (-1437.922) -- 0:00:00
       3000 -- [-1424.076] (-1423.582) (-1422.314) (-1431.105) * [-1431.778] (-1426.240) (-1425.126) (-1429.394) -- 0:00:00
       3500 -- (-1434.542) (-1433.484) (-1424.047) [-1427.413] * (-1428.252) [-1426.027] (-1424.836) (-1430.082) -- 0:00:00
       4000 -- [-1425.971] (-1423.987) (-1432.469) (-1426.788) * [-1431.277] (-1427.402) (-1429.716) (-1430.185) -- 0:00:00
       4500 -- (-1437.907) (-1434.577) (-1430.745) [-1422.349] * (-1423.858) [-1432.328] (-1429.023) (-1426.446) -- 0:00:00
       5000 -- (-1423.512) (-1428.872) (-1432.147) [-1424.440] * [-1427.945] (-1432.116) (-1428.952) (-1427.946) -- 0:00:00

      Average standard deviation of split frequencies: 0.095647

       5500 -- [-1425.107] (-1426.954) (-1426.660) (-1430.416) * [-1429.177] (-1429.476) (-1423.265) (-1426.555) -- 0:00:00
       6000 -- (-1427.721) [-1431.541] (-1426.032) (-1426.043) * [-1420.277] (-1429.706) (-1422.530) (-1434.232) -- 0:00:00
       6500 -- (-1424.918) (-1428.070) (-1424.959) [-1425.058] * (-1425.432) (-1430.112) (-1437.756) [-1428.907] -- 0:00:00
       7000 -- (-1423.517) (-1429.516) (-1438.163) [-1425.445] * (-1425.054) (-1427.592) (-1420.691) [-1422.834] -- 0:00:00
       7500 -- (-1430.520) (-1428.667) (-1429.753) [-1425.057] * (-1422.442) [-1428.097] (-1423.363) (-1423.210) -- 0:00:00
       8000 -- (-1427.895) (-1431.322) (-1435.033) [-1420.580] * (-1425.028) (-1432.197) [-1421.226] (-1427.873) -- 0:02:04
       8500 -- (-1430.003) (-1424.802) [-1438.811] (-1430.374) * (-1426.496) [-1431.863] (-1423.732) (-1422.341) -- 0:01:56
       9000 -- (-1434.451) (-1425.608) [-1428.858] (-1439.532) * [-1422.899] (-1429.513) (-1428.103) (-1425.336) -- 0:01:50
       9500 -- [-1422.777] (-1423.404) (-1428.002) (-1442.930) * (-1430.127) (-1422.686) (-1429.578) [-1427.971] -- 0:01:44
      10000 -- [-1423.351] (-1433.700) (-1421.213) (-1431.003) * (-1430.299) (-1435.911) [-1423.025] (-1424.624) -- 0:01:39

      Average standard deviation of split frequencies: 0.074938

      10500 -- (-1419.553) [-1421.440] (-1419.939) (-1426.047) * (-1429.351) [-1423.178] (-1428.552) (-1428.712) -- 0:01:34
      11000 -- [-1427.596] (-1430.335) (-1424.281) (-1432.287) * [-1427.369] (-1424.355) (-1422.680) (-1425.592) -- 0:01:29
      11500 -- [-1429.119] (-1423.013) (-1427.820) (-1433.309) * (-1424.578) [-1426.803] (-1424.600) (-1423.130) -- 0:01:25
      12000 -- (-1424.061) (-1424.497) (-1425.275) [-1429.655] * (-1429.821) [-1419.863] (-1427.244) (-1422.373) -- 0:01:22
      12500 -- (-1433.566) [-1429.675] (-1421.903) (-1426.248) * (-1428.949) (-1426.483) (-1430.982) [-1427.479] -- 0:01:19
      13000 -- [-1432.684] (-1429.324) (-1423.071) (-1428.682) * (-1432.278) [-1425.673] (-1425.941) (-1428.683) -- 0:01:15
      13500 -- (-1430.946) (-1436.078) (-1423.137) [-1428.710] * [-1430.474] (-1425.994) (-1429.669) (-1432.904) -- 0:01:13
      14000 -- (-1427.764) (-1426.371) (-1422.572) [-1428.244] * (-1422.666) (-1424.384) (-1431.817) [-1434.031] -- 0:01:10
      14500 -- (-1431.019) [-1425.739] (-1420.554) (-1427.255) * (-1423.275) (-1420.444) [-1427.319] (-1433.554) -- 0:01:07
      15000 -- (-1430.861) (-1426.476) (-1420.879) [-1428.223] * (-1420.417) (-1424.471) (-1431.175) [-1439.432] -- 0:01:05

      Average standard deviation of split frequencies: 0.054015

      15500 -- (-1429.199) (-1420.136) (-1421.406) [-1427.614] * (-1423.051) (-1426.530) [-1422.769] (-1428.876) -- 0:01:03
      16000 -- (-1431.581) [-1424.011] (-1420.996) (-1425.821) * [-1421.124] (-1424.448) (-1436.204) (-1429.668) -- 0:01:01
      16500 -- (-1426.669) (-1423.281) (-1420.833) [-1431.790] * (-1421.572) (-1433.600) (-1429.534) [-1423.172] -- 0:00:59
      17000 -- (-1428.228) (-1426.430) (-1421.393) [-1431.368] * (-1424.334) (-1432.306) [-1421.917] (-1428.467) -- 0:00:57
      17500 -- (-1422.316) (-1430.901) (-1421.184) [-1424.129] * (-1422.739) (-1430.424) [-1429.951] (-1422.884) -- 0:00:56
      18000 -- (-1429.692) (-1425.076) [-1419.669] (-1433.200) * (-1423.071) [-1424.998] (-1430.030) (-1426.904) -- 0:00:54
      18500 -- (-1421.641) [-1425.084] (-1421.235) (-1424.633) * (-1422.679) [-1426.336] (-1423.642) (-1428.250) -- 0:00:53
      19000 -- (-1426.973) [-1423.092] (-1420.639) (-1427.308) * (-1424.900) [-1429.112] (-1427.219) (-1433.717) -- 0:00:51
      19500 -- (-1423.786) [-1424.612] (-1422.511) (-1431.738) * (-1425.617) (-1430.480) [-1424.779] (-1422.091) -- 0:00:50
      20000 -- (-1424.479) [-1424.512] (-1419.963) (-1432.531) * (-1422.407) [-1425.463] (-1422.466) (-1424.820) -- 0:00:49

      Average standard deviation of split frequencies: 0.044194

      20500 -- (-1435.798) [-1426.315] (-1420.763) (-1425.717) * (-1424.368) (-1427.180) (-1422.626) [-1422.228] -- 0:01:35
      21000 -- (-1424.720) (-1433.898) (-1419.963) [-1422.645] * (-1422.952) (-1434.313) [-1423.702] (-1425.871) -- 0:01:33
      21500 -- (-1430.038) (-1428.677) (-1420.050) [-1424.271] * (-1422.820) (-1431.823) (-1424.032) [-1426.509] -- 0:01:31
      22000 -- (-1422.351) [-1423.179] (-1426.140) (-1428.308) * (-1422.781) (-1423.011) [-1420.629] (-1425.790) -- 0:01:28
      22500 -- (-1428.374) (-1430.302) (-1428.178) [-1429.482] * (-1427.785) [-1431.273] (-1421.885) (-1426.051) -- 0:01:26
      23000 -- [-1433.632] (-1421.243) (-1422.673) (-1426.508) * (-1424.168) [-1426.028] (-1422.998) (-1418.735) -- 0:01:24
      23500 -- (-1428.263) [-1423.739] (-1421.831) (-1430.825) * (-1423.888) [-1427.255] (-1421.088) (-1434.031) -- 0:01:23
      24000 -- [-1428.701] (-1422.896) (-1420.690) (-1425.871) * (-1425.510) [-1423.332] (-1421.593) (-1426.575) -- 0:01:21
      24500 -- [-1424.433] (-1424.957) (-1420.242) (-1423.093) * [-1424.087] (-1424.218) (-1420.419) (-1422.018) -- 0:01:19
      25000 -- (-1424.865) [-1423.101] (-1420.988) (-1422.685) * (-1425.450) [-1427.618] (-1421.302) (-1427.242) -- 0:01:18

      Average standard deviation of split frequencies: 0.036262

      25500 -- [-1422.084] (-1433.776) (-1419.218) (-1430.221) * (-1422.900) (-1429.854) (-1420.609) [-1423.888] -- 0:01:16
      26000 -- (-1426.706) (-1422.055) (-1423.131) [-1423.011] * [-1420.937] (-1424.321) (-1422.047) (-1424.891) -- 0:01:14
      26500 -- (-1429.493) (-1439.390) [-1421.869] (-1425.805) * (-1423.897) [-1426.919] (-1420.239) (-1428.773) -- 0:01:13
      27000 -- (-1426.764) (-1420.199) [-1420.652] (-1422.759) * (-1424.429) (-1426.444) (-1424.103) [-1424.356] -- 0:01:12
      27500 -- (-1424.941) [-1423.340] (-1423.099) (-1422.125) * (-1423.180) (-1425.802) (-1420.740) [-1430.207] -- 0:01:10
      28000 -- [-1432.790] (-1429.471) (-1424.218) (-1424.775) * (-1423.916) (-1421.080) [-1425.633] (-1423.358) -- 0:01:09
      28500 -- (-1426.942) (-1423.011) (-1420.979) [-1428.895] * (-1428.603) (-1422.256) [-1422.359] (-1428.817) -- 0:01:08
      29000 -- (-1429.053) [-1423.186] (-1421.547) (-1423.274) * [-1422.686] (-1423.605) (-1422.598) (-1432.930) -- 0:01:06
      29500 -- (-1428.067) [-1429.200] (-1420.404) (-1425.027) * (-1424.378) (-1423.970) (-1420.937) [-1428.291] -- 0:01:05
      30000 -- (-1429.414) (-1423.236) (-1421.311) [-1421.600] * [-1422.834] (-1423.904) (-1419.418) (-1428.408) -- 0:01:04

      Average standard deviation of split frequencies: 0.031598

      30500 -- [-1428.116] (-1424.614) (-1427.791) (-1425.673) * [-1423.331] (-1421.705) (-1422.212) (-1426.633) -- 0:01:03
      31000 -- (-1424.813) [-1427.074] (-1423.510) (-1419.545) * (-1424.827) (-1422.377) (-1420.722) [-1421.624] -- 0:01:02
      31500 -- [-1434.722] (-1421.388) (-1420.279) (-1422.222) * [-1423.884] (-1422.957) (-1421.837) (-1423.082) -- 0:01:01
      32000 -- (-1429.065) (-1425.950) [-1421.297] (-1422.997) * [-1421.065] (-1420.599) (-1424.652) (-1426.289) -- 0:01:00
      32500 -- [-1420.296] (-1429.725) (-1421.947) (-1422.927) * (-1423.138) (-1423.595) [-1420.871] (-1425.769) -- 0:00:59
      33000 -- (-1425.589) [-1427.235] (-1425.069) (-1422.238) * [-1424.673] (-1426.353) (-1421.694) (-1429.397) -- 0:00:58
      33500 -- [-1422.549] (-1436.312) (-1425.849) (-1421.840) * (-1425.027) (-1425.437) [-1424.764] (-1425.365) -- 0:00:57
      34000 -- [-1425.694] (-1424.789) (-1422.331) (-1424.754) * [-1422.930] (-1422.487) (-1430.335) (-1424.820) -- 0:01:25
      34500 -- (-1429.224) (-1426.991) (-1425.290) [-1425.664] * [-1428.556] (-1422.277) (-1424.181) (-1432.207) -- 0:01:23
      35000 -- (-1419.030) (-1432.626) (-1425.428) [-1422.933] * (-1424.667) (-1420.250) [-1420.652] (-1427.630) -- 0:01:22

      Average standard deviation of split frequencies: 0.038595

      35500 -- (-1422.188) (-1430.370) (-1425.750) [-1423.718] * [-1428.025] (-1420.107) (-1420.337) (-1431.994) -- 0:01:21
      36000 -- (-1420.143) (-1424.766) [-1424.497] (-1422.384) * (-1424.130) (-1420.696) (-1419.471) [-1421.489] -- 0:01:20
      36500 -- (-1425.289) [-1428.266] (-1423.371) (-1421.601) * (-1424.240) (-1422.045) [-1423.882] (-1429.487) -- 0:01:19
      37000 -- (-1425.185) (-1427.701) [-1422.719] (-1423.113) * (-1422.232) [-1421.619] (-1422.308) (-1424.253) -- 0:01:18
      37500 -- (-1426.142) (-1423.754) (-1420.587) [-1422.523] * (-1424.355) [-1423.896] (-1421.595) (-1424.177) -- 0:01:17
      38000 -- (-1419.982) [-1423.631] (-1426.238) (-1420.740) * (-1425.338) (-1420.839) [-1421.583] (-1423.417) -- 0:01:15
      38500 -- (-1423.567) [-1425.690] (-1423.617) (-1421.804) * (-1422.848) [-1421.099] (-1421.063) (-1424.977) -- 0:01:14
      39000 -- [-1421.570] (-1429.966) (-1419.378) (-1422.178) * (-1421.014) (-1421.700) (-1424.289) [-1431.956] -- 0:01:13
      39500 -- (-1421.080) [-1426.015] (-1425.486) (-1422.161) * (-1424.617) (-1421.867) (-1426.551) [-1423.777] -- 0:01:12
      40000 -- (-1423.399) (-1427.635) [-1421.942] (-1422.699) * (-1424.465) (-1421.991) (-1421.501) [-1422.515] -- 0:01:12

      Average standard deviation of split frequencies: 0.029559

      40500 -- (-1423.921) (-1423.244) [-1421.044] (-1424.194) * (-1424.072) (-1422.991) (-1421.847) [-1423.010] -- 0:01:11
      41000 -- (-1425.052) (-1421.649) (-1422.154) [-1426.437] * (-1420.773) (-1423.874) [-1418.464] (-1440.016) -- 0:01:10
      41500 -- (-1428.145) [-1423.075] (-1420.817) (-1422.251) * (-1421.439) (-1422.554) [-1420.229] (-1431.225) -- 0:01:09
      42000 -- (-1425.935) (-1425.652) [-1423.932] (-1418.987) * (-1424.707) (-1423.577) [-1418.573] (-1432.660) -- 0:01:08
      42500 -- (-1425.822) (-1426.038) [-1422.022] (-1421.987) * (-1421.840) [-1421.475] (-1424.689) (-1429.782) -- 0:01:07
      43000 -- (-1420.673) (-1422.165) (-1422.013) [-1422.727] * [-1423.438] (-1422.011) (-1428.108) (-1426.359) -- 0:01:06
      43500 -- (-1422.624) [-1423.722] (-1424.334) (-1420.122) * (-1422.815) (-1422.035) (-1420.958) [-1426.904] -- 0:01:05
      44000 -- (-1425.822) (-1427.223) (-1423.594) [-1423.692] * (-1422.520) (-1424.950) (-1422.570) [-1423.922] -- 0:01:05
      44500 -- (-1431.579) [-1426.123] (-1421.793) (-1421.621) * [-1422.844] (-1420.753) (-1421.015) (-1425.536) -- 0:01:04
      45000 -- (-1422.663) [-1424.139] (-1422.869) (-1420.642) * (-1427.872) (-1424.183) (-1419.005) [-1429.859] -- 0:01:03

      Average standard deviation of split frequencies: 0.030256

      45500 -- [-1421.384] (-1421.986) (-1427.146) (-1420.769) * (-1422.622) [-1424.998] (-1424.717) (-1424.386) -- 0:01:02
      46000 -- (-1420.593) (-1426.295) (-1422.856) [-1420.655] * (-1422.208) [-1421.153] (-1420.262) (-1435.062) -- 0:01:02
      46500 -- (-1423.068) [-1422.361] (-1420.319) (-1420.596) * (-1422.555) [-1422.029] (-1419.959) (-1426.349) -- 0:01:01
      47000 -- (-1419.993) (-1425.697) (-1419.679) [-1420.499] * (-1420.366) (-1423.570) (-1421.173) [-1422.734] -- 0:01:00
      47500 -- (-1425.087) [-1426.030] (-1422.128) (-1422.402) * (-1420.735) (-1422.561) (-1422.528) [-1432.177] -- 0:01:00
      48000 -- [-1422.079] (-1425.531) (-1425.354) (-1422.247) * (-1422.278) (-1423.108) (-1423.018) [-1429.167] -- 0:00:59
      48500 -- (-1422.701) [-1422.269] (-1428.104) (-1419.205) * (-1420.672) (-1425.020) (-1426.584) [-1427.262] -- 0:01:18
      49000 -- (-1420.366) (-1424.830) (-1425.564) [-1422.180] * (-1422.882) (-1422.268) (-1422.227) [-1428.047] -- 0:01:17
      49500 -- (-1422.112) (-1426.886) (-1421.920) [-1419.551] * (-1422.337) [-1421.720] (-1424.357) (-1432.119) -- 0:01:16
      50000 -- (-1419.414) (-1425.160) (-1422.759) [-1421.689] * [-1421.128] (-1422.885) (-1422.934) (-1430.141) -- 0:01:16

      Average standard deviation of split frequencies: 0.023505

      50500 -- (-1422.480) (-1431.644) (-1424.410) [-1420.819] * [-1424.669] (-1423.849) (-1422.098) (-1425.054) -- 0:01:15
      51000 -- (-1420.386) (-1425.540) (-1422.425) [-1422.997] * (-1422.007) [-1421.889] (-1424.391) (-1435.132) -- 0:01:14
      51500 -- (-1421.495) [-1423.201] (-1424.299) (-1423.188) * (-1424.234) (-1424.931) [-1423.789] (-1423.967) -- 0:01:13
      52000 -- (-1420.440) [-1424.918] (-1422.151) (-1424.064) * (-1424.280) (-1422.386) (-1422.332) [-1424.185] -- 0:01:12
      52500 -- (-1423.506) (-1436.899) (-1423.563) [-1424.720] * (-1420.445) [-1421.466] (-1421.758) (-1424.084) -- 0:01:12
      53000 -- (-1422.555) [-1427.356] (-1422.222) (-1421.494) * (-1421.705) [-1421.256] (-1422.027) (-1426.644) -- 0:01:11
      53500 -- (-1420.883) [-1422.950] (-1423.052) (-1419.336) * (-1421.655) (-1420.567) (-1421.838) [-1425.102] -- 0:01:10
      54000 -- (-1421.156) [-1419.055] (-1424.091) (-1420.854) * (-1423.416) (-1420.399) (-1421.845) [-1430.605] -- 0:01:10
      54500 -- (-1422.662) [-1425.771] (-1422.913) (-1421.525) * (-1421.677) (-1421.514) [-1422.096] (-1426.364) -- 0:01:09
      55000 -- (-1420.238) [-1427.420] (-1423.165) (-1424.158) * (-1422.159) (-1422.679) [-1427.077] (-1427.618) -- 0:01:08

      Average standard deviation of split frequencies: 0.020823

      55500 -- (-1425.784) (-1427.386) (-1422.774) [-1422.397] * [-1421.637] (-1422.469) (-1426.021) (-1427.096) -- 0:01:08
      56000 -- (-1420.937) [-1423.477] (-1422.650) (-1426.308) * (-1421.208) (-1424.202) (-1426.769) [-1428.263] -- 0:01:07
      56500 -- (-1421.443) [-1423.247] (-1425.662) (-1425.373) * [-1420.480] (-1427.074) (-1427.141) (-1426.507) -- 0:01:06
      57000 -- (-1423.773) [-1424.650] (-1424.387) (-1421.387) * (-1423.194) (-1424.461) (-1421.279) [-1425.889] -- 0:01:06
      57500 -- [-1423.268] (-1432.898) (-1421.641) (-1422.691) * (-1419.621) (-1426.295) (-1421.611) [-1426.159] -- 0:01:05
      58000 -- [-1421.794] (-1425.022) (-1422.957) (-1421.196) * (-1421.412) (-1425.736) (-1421.746) [-1420.283] -- 0:01:04
      58500 -- (-1421.452) [-1426.151] (-1423.045) (-1420.022) * (-1420.779) (-1424.622) (-1421.361) [-1422.549] -- 0:01:04
      59000 -- [-1422.791] (-1426.947) (-1421.146) (-1419.879) * (-1424.027) [-1424.208] (-1423.824) (-1424.314) -- 0:01:03
      59500 -- [-1422.879] (-1425.667) (-1425.219) (-1422.167) * (-1426.705) (-1421.614) (-1421.554) [-1426.024] -- 0:01:03
      60000 -- (-1421.714) (-1426.608) [-1423.290] (-1422.843) * (-1422.249) (-1421.863) [-1421.362] (-1424.826) -- 0:01:02

      Average standard deviation of split frequencies: 0.030673

      60500 -- [-1422.474] (-1430.171) (-1421.776) (-1421.111) * (-1422.866) [-1422.682] (-1420.814) (-1434.868) -- 0:01:02
      61000 -- (-1423.428) (-1430.439) [-1422.495] (-1419.437) * [-1421.015] (-1423.397) (-1420.600) (-1430.305) -- 0:01:01
      61500 -- (-1426.903) (-1427.009) (-1423.947) [-1424.082] * (-1420.833) (-1421.184) (-1425.555) [-1427.119] -- 0:01:01
      62000 -- (-1422.517) [-1433.548] (-1422.546) (-1424.842) * (-1423.508) (-1421.005) (-1420.716) [-1423.818] -- 0:01:00
      62500 -- (-1425.423) [-1426.252] (-1419.399) (-1420.854) * (-1422.221) [-1421.110] (-1422.685) (-1420.366) -- 0:01:00
      63000 -- (-1424.372) [-1426.512] (-1421.585) (-1422.543) * (-1420.027) (-1419.230) (-1422.789) [-1424.763] -- 0:01:14
      63500 -- (-1420.565) (-1423.843) (-1421.002) [-1421.912] * (-1420.018) (-1426.118) (-1421.366) [-1425.697] -- 0:01:13
      64000 -- (-1425.008) (-1427.050) [-1423.272] (-1423.447) * (-1420.826) [-1422.334] (-1422.900) (-1423.955) -- 0:01:13
      64500 -- (-1423.996) [-1424.505] (-1421.830) (-1422.244) * (-1420.215) [-1422.575] (-1422.281) (-1425.842) -- 0:01:12
      65000 -- (-1421.876) (-1433.867) (-1423.220) [-1421.850] * [-1423.342] (-1421.028) (-1424.210) (-1424.190) -- 0:01:11

      Average standard deviation of split frequencies: 0.029998

      65500 -- [-1423.173] (-1436.473) (-1423.160) (-1423.085) * (-1424.995) (-1421.579) (-1419.534) [-1423.249] -- 0:01:11
      66000 -- (-1424.188) [-1432.201] (-1422.798) (-1420.644) * (-1425.390) (-1422.304) (-1422.722) [-1425.312] -- 0:01:10
      66500 -- (-1421.095) (-1433.242) [-1422.380] (-1422.054) * (-1423.597) (-1425.028) [-1422.866] (-1427.757) -- 0:01:10
      67000 -- (-1426.599) (-1426.763) [-1420.037] (-1421.595) * [-1423.481] (-1427.324) (-1422.717) (-1423.922) -- 0:01:09
      67500 -- (-1424.376) [-1424.463] (-1424.090) (-1424.489) * (-1420.289) (-1427.732) (-1424.617) [-1420.970] -- 0:01:09
      68000 -- [-1422.047] (-1430.649) (-1421.519) (-1423.136) * (-1422.683) [-1427.678] (-1422.271) (-1421.524) -- 0:01:08
      68500 -- (-1424.495) [-1427.460] (-1424.459) (-1421.866) * [-1423.671] (-1425.993) (-1422.723) (-1423.590) -- 0:01:07
      69000 -- (-1427.197) [-1426.594] (-1425.338) (-1422.776) * (-1424.437) (-1421.725) [-1422.309] (-1425.730) -- 0:01:07
      69500 -- (-1427.257) [-1424.832] (-1423.409) (-1424.703) * [-1421.036] (-1422.156) (-1425.252) (-1427.517) -- 0:01:06
      70000 -- (-1423.296) [-1429.438] (-1422.658) (-1429.107) * (-1420.376) [-1421.175] (-1425.602) (-1423.322) -- 0:01:06

      Average standard deviation of split frequencies: 0.032687

      70500 -- (-1422.500) (-1429.561) [-1423.309] (-1423.926) * (-1422.157) [-1420.580] (-1422.341) (-1432.025) -- 0:01:05
      71000 -- [-1421.399] (-1424.178) (-1423.260) (-1420.967) * (-1420.571) [-1423.140] (-1423.037) (-1428.119) -- 0:01:05
      71500 -- [-1420.336] (-1429.769) (-1421.447) (-1422.123) * (-1419.552) (-1422.429) [-1421.263] (-1430.397) -- 0:01:04
      72000 -- [-1422.445] (-1427.955) (-1421.961) (-1421.669) * [-1421.732] (-1423.177) (-1423.045) (-1424.170) -- 0:01:04
      72500 -- [-1423.341] (-1433.903) (-1422.696) (-1420.291) * (-1422.658) (-1424.146) (-1421.567) [-1427.160] -- 0:01:03
      73000 -- [-1422.155] (-1424.502) (-1422.087) (-1423.438) * (-1420.611) (-1424.536) [-1421.249] (-1431.446) -- 0:01:03
      73500 -- (-1422.288) (-1424.958) (-1422.950) [-1422.248] * (-1422.685) (-1422.162) (-1420.203) [-1431.833] -- 0:01:03
      74000 -- (-1425.496) [-1425.841] (-1422.276) (-1423.651) * (-1425.509) (-1422.484) (-1422.180) [-1425.448] -- 0:01:02
      74500 -- (-1424.789) (-1427.201) [-1422.430] (-1425.980) * (-1422.914) (-1420.411) (-1419.970) [-1426.560] -- 0:01:02
      75000 -- (-1420.124) [-1429.134] (-1423.991) (-1425.775) * (-1422.730) (-1421.419) [-1420.580] (-1428.059) -- 0:01:01

      Average standard deviation of split frequencies: 0.033952

      75500 -- [-1420.526] (-1428.431) (-1422.446) (-1424.394) * (-1421.603) (-1422.481) [-1420.181] (-1427.576) -- 0:01:01
      76000 -- (-1420.864) (-1424.327) [-1419.847] (-1427.201) * [-1420.265] (-1424.150) (-1421.951) (-1432.963) -- 0:01:00
      76500 -- (-1421.718) (-1428.726) (-1422.598) [-1423.168] * (-1419.370) (-1422.301) (-1423.125) [-1433.355] -- 0:01:00
      77000 -- [-1420.661] (-1424.387) (-1425.623) (-1422.321) * (-1421.489) (-1425.536) (-1421.937) [-1425.776] -- 0:00:59
      77500 -- (-1422.175) [-1421.807] (-1421.254) (-1424.962) * (-1424.685) (-1424.346) (-1420.499) [-1425.244] -- 0:00:59
      78000 -- (-1424.155) (-1423.185) [-1420.546] (-1430.441) * (-1422.282) [-1420.133] (-1421.535) (-1426.975) -- 0:01:10
      78500 -- (-1421.497) [-1426.783] (-1424.382) (-1434.894) * (-1420.216) (-1422.355) (-1424.772) [-1421.144] -- 0:01:10
      79000 -- (-1423.210) [-1430.004] (-1423.603) (-1423.183) * (-1427.641) [-1420.032] (-1421.208) (-1425.504) -- 0:01:09
      79500 -- (-1420.493) [-1433.983] (-1424.891) (-1423.969) * (-1420.731) (-1421.887) (-1421.282) [-1424.476] -- 0:01:09
      80000 -- [-1421.194] (-1425.720) (-1423.689) (-1422.370) * (-1421.497) (-1421.467) (-1425.687) [-1429.586] -- 0:01:09

      Average standard deviation of split frequencies: 0.035751

      80500 -- (-1424.404) (-1428.514) (-1426.638) [-1421.472] * (-1421.933) [-1419.785] (-1430.681) (-1438.518) -- 0:01:08
      81000 -- (-1422.505) (-1432.895) (-1425.157) [-1421.584] * [-1420.973] (-1421.483) (-1433.048) (-1436.581) -- 0:01:08
      81500 -- (-1424.132) (-1426.941) [-1423.841] (-1422.690) * [-1421.583] (-1421.572) (-1431.895) (-1428.836) -- 0:01:07
      82000 -- (-1422.479) (-1432.298) (-1420.109) [-1422.238] * (-1427.274) [-1420.443] (-1422.579) (-1428.445) -- 0:01:07
      82500 -- (-1422.162) [-1426.109] (-1423.339) (-1425.888) * (-1424.732) (-1424.855) (-1423.377) [-1429.098] -- 0:01:06
      83000 -- (-1421.159) (-1427.480) [-1421.199] (-1424.436) * [-1421.954] (-1424.022) (-1423.694) (-1432.776) -- 0:01:06
      83500 -- (-1422.939) (-1428.881) [-1422.809] (-1423.756) * [-1423.367] (-1423.319) (-1422.350) (-1429.849) -- 0:01:05
      84000 -- (-1423.560) [-1424.376] (-1423.589) (-1422.535) * (-1422.166) [-1422.532] (-1422.129) (-1434.212) -- 0:01:05
      84500 -- (-1420.254) [-1425.109] (-1423.593) (-1425.605) * [-1427.458] (-1424.285) (-1422.266) (-1431.320) -- 0:01:05
      85000 -- [-1420.518] (-1422.775) (-1422.666) (-1426.732) * (-1423.079) (-1422.911) (-1423.301) [-1421.742] -- 0:01:04

      Average standard deviation of split frequencies: 0.032889

      85500 -- (-1421.978) (-1422.852) [-1422.669] (-1421.900) * (-1422.862) (-1421.964) (-1421.103) [-1424.994] -- 0:01:04
      86000 -- (-1425.289) (-1425.392) [-1424.696] (-1420.591) * (-1423.647) [-1423.074] (-1419.967) (-1430.482) -- 0:01:03
      86500 -- (-1423.012) (-1423.216) (-1425.064) [-1419.608] * (-1424.230) [-1421.812] (-1420.730) (-1423.370) -- 0:01:03
      87000 -- (-1421.358) [-1419.753] (-1423.502) (-1422.911) * [-1426.117] (-1423.871) (-1420.122) (-1426.968) -- 0:01:02
      87500 -- (-1421.067) [-1427.564] (-1423.720) (-1419.960) * (-1421.568) (-1420.264) (-1419.846) [-1426.512] -- 0:01:02
      88000 -- (-1423.140) (-1430.150) (-1424.212) [-1423.211] * (-1424.931) (-1421.201) (-1424.600) [-1419.914] -- 0:01:02
      88500 -- [-1421.928] (-1425.812) (-1425.869) (-1420.226) * (-1424.412) (-1422.007) (-1422.492) [-1431.729] -- 0:01:01
      89000 -- (-1423.787) (-1429.857) (-1424.542) [-1420.834] * (-1424.028) (-1425.166) [-1424.630] (-1427.096) -- 0:01:01
      89500 -- (-1422.455) (-1422.147) [-1422.795] (-1422.713) * (-1424.016) (-1420.348) (-1423.025) [-1424.578] -- 0:01:01
      90000 -- (-1422.464) (-1427.545) (-1422.827) [-1425.590] * [-1423.952] (-1420.411) (-1423.383) (-1425.239) -- 0:01:00

      Average standard deviation of split frequencies: 0.031502

      90500 -- (-1427.162) [-1423.572] (-1424.194) (-1423.696) * (-1422.923) (-1420.704) [-1421.659] (-1421.904) -- 0:01:00
      91000 -- (-1424.265) [-1426.013] (-1424.208) (-1424.806) * [-1424.793] (-1420.467) (-1423.486) (-1428.426) -- 0:00:59
      91500 -- [-1422.002] (-1421.681) (-1422.656) (-1425.650) * [-1421.910] (-1421.200) (-1422.578) (-1427.439) -- 0:00:59
      92000 -- [-1423.108] (-1430.551) (-1426.083) (-1426.391) * (-1419.488) (-1422.280) (-1422.535) [-1421.995] -- 0:00:59
      92500 -- (-1426.509) [-1427.598] (-1425.394) (-1426.957) * (-1422.731) (-1421.665) (-1428.417) [-1424.629] -- 0:00:58
      93000 -- (-1423.775) [-1425.210] (-1424.385) (-1424.222) * (-1421.243) (-1421.546) (-1420.092) [-1424.450] -- 0:01:08
      93500 -- (-1422.987) [-1425.718] (-1425.200) (-1421.934) * (-1422.867) (-1420.181) (-1420.630) [-1419.090] -- 0:01:07
      94000 -- (-1423.093) (-1429.182) [-1424.572] (-1422.692) * (-1425.104) [-1419.141] (-1421.928) (-1428.923) -- 0:01:07
      94500 -- (-1421.076) [-1419.990] (-1433.107) (-1421.291) * (-1425.398) [-1421.447] (-1421.395) (-1429.077) -- 0:01:07
      95000 -- (-1424.705) (-1424.278) (-1432.123) [-1420.734] * (-1423.633) (-1422.643) (-1423.532) [-1424.586] -- 0:01:06

      Average standard deviation of split frequencies: 0.030907

      95500 -- (-1425.127) (-1423.550) (-1426.787) [-1419.006] * (-1422.045) (-1426.676) [-1420.949] (-1423.821) -- 0:01:06
      96000 -- (-1422.238) [-1425.239] (-1420.832) (-1420.318) * (-1423.673) (-1420.741) (-1422.530) [-1428.807] -- 0:01:05
      96500 -- (-1420.982) [-1428.671] (-1421.296) (-1422.335) * (-1423.912) (-1425.429) (-1427.409) [-1424.554] -- 0:01:05
      97000 -- (-1421.038) (-1426.635) (-1424.396) [-1424.150] * (-1423.999) [-1425.671] (-1423.619) (-1432.344) -- 0:01:05
      97500 -- [-1420.790] (-1425.384) (-1424.403) (-1421.523) * (-1422.144) (-1426.798) [-1422.070] (-1425.356) -- 0:01:04
      98000 -- [-1421.133] (-1433.543) (-1422.858) (-1424.131) * (-1422.264) (-1423.295) [-1422.812] (-1427.137) -- 0:01:04
      98500 -- (-1423.778) [-1437.170] (-1423.178) (-1429.680) * (-1425.211) (-1422.218) (-1425.745) [-1425.374] -- 0:01:04
      99000 -- (-1422.026) (-1433.753) (-1421.957) [-1426.887] * (-1422.981) (-1430.267) (-1425.266) [-1421.923] -- 0:01:03
      99500 -- [-1422.933] (-1424.091) (-1425.480) (-1423.254) * (-1420.872) (-1423.276) (-1421.585) [-1428.696] -- 0:01:03
      100000 -- (-1424.029) [-1421.618] (-1422.252) (-1421.663) * (-1422.210) (-1419.201) [-1422.571] (-1427.068) -- 0:01:02

      Average standard deviation of split frequencies: 0.031127

      100500 -- (-1423.351) [-1431.031] (-1422.884) (-1420.566) * (-1420.597) [-1420.917] (-1425.515) (-1426.694) -- 0:01:02
      101000 -- (-1423.800) (-1429.989) (-1422.852) [-1420.238] * [-1419.446] (-1423.289) (-1422.917) (-1427.767) -- 0:01:02
      101500 -- (-1422.098) (-1426.305) (-1422.774) [-1420.016] * (-1420.937) (-1423.644) (-1422.763) [-1426.318] -- 0:01:01
      102000 -- [-1422.466] (-1423.041) (-1422.789) (-1420.736) * (-1419.541) (-1419.187) [-1423.554] (-1422.389) -- 0:01:01
      102500 -- (-1421.385) [-1424.230] (-1424.575) (-1419.921) * [-1418.817] (-1424.077) (-1423.597) (-1425.184) -- 0:01:01
      103000 -- (-1424.788) (-1430.546) (-1423.825) [-1422.186] * (-1423.261) (-1421.867) [-1424.320] (-1425.525) -- 0:01:00
      103500 -- (-1425.638) [-1422.098] (-1421.318) (-1426.333) * [-1422.855] (-1424.441) (-1421.886) (-1428.589) -- 0:01:00
      104000 -- (-1424.979) [-1430.602] (-1421.137) (-1424.003) * (-1426.842) (-1420.587) [-1422.845] (-1427.305) -- 0:01:00
      104500 -- (-1424.709) [-1427.340] (-1423.035) (-1421.270) * (-1423.279) [-1420.350] (-1421.232) (-1425.311) -- 0:00:59
      105000 -- (-1428.490) (-1436.595) (-1420.943) [-1423.045] * (-1422.504) [-1419.754] (-1420.463) (-1426.989) -- 0:00:59

      Average standard deviation of split frequencies: 0.033485

      105500 -- (-1428.657) [-1424.755] (-1422.615) (-1421.162) * [-1421.580] (-1421.158) (-1423.206) (-1431.667) -- 0:00:59
      106000 -- [-1424.864] (-1424.266) (-1421.922) (-1419.319) * (-1423.259) [-1420.435] (-1425.763) (-1428.655) -- 0:00:59
      106500 -- (-1424.295) (-1433.294) (-1421.617) [-1421.023] * (-1424.084) (-1423.828) (-1422.574) [-1423.518] -- 0:00:58
      107000 -- (-1422.845) (-1423.663) (-1422.603) [-1420.627] * (-1421.762) (-1423.899) [-1422.445] (-1425.275) -- 0:00:58
      107500 -- (-1429.363) [-1424.771] (-1422.538) (-1421.383) * (-1426.384) (-1422.562) (-1425.170) [-1420.917] -- 0:00:58
      108000 -- (-1422.885) [-1430.835] (-1420.205) (-1425.519) * (-1422.726) (-1425.179) (-1423.148) [-1433.505] -- 0:01:06
      108500 -- (-1423.618) (-1454.415) (-1421.335) [-1424.228] * (-1421.956) (-1424.732) [-1419.681] (-1428.631) -- 0:01:05
      109000 -- (-1425.822) (-1425.001) (-1425.337) [-1422.566] * (-1423.403) (-1429.455) [-1420.611] (-1430.534) -- 0:01:05
      109500 -- (-1423.745) (-1422.897) [-1426.181] (-1423.381) * (-1423.029) [-1420.697] (-1422.931) (-1422.674) -- 0:01:05
      110000 -- (-1421.349) [-1422.325] (-1425.684) (-1423.174) * (-1424.215) (-1423.031) (-1427.680) [-1426.260] -- 0:01:04

      Average standard deviation of split frequencies: 0.030068

      110500 -- (-1425.969) [-1419.443] (-1424.190) (-1421.219) * (-1423.934) (-1420.597) (-1429.207) [-1425.500] -- 0:01:04
      111000 -- (-1422.735) (-1425.433) [-1422.045] (-1421.585) * (-1422.141) [-1422.073] (-1423.999) (-1429.166) -- 0:01:04
      111500 -- (-1422.773) [-1424.725] (-1423.473) (-1420.804) * (-1425.042) (-1422.809) (-1419.015) [-1427.896] -- 0:01:03
      112000 -- (-1426.360) [-1428.406] (-1422.618) (-1422.303) * (-1426.295) (-1423.020) [-1421.068] (-1432.575) -- 0:01:03
      112500 -- [-1425.271] (-1428.577) (-1425.229) (-1420.758) * (-1426.807) (-1422.548) (-1421.681) [-1427.365] -- 0:01:03
      113000 -- (-1421.352) (-1423.270) [-1423.229] (-1421.985) * (-1425.452) [-1423.194] (-1424.218) (-1429.839) -- 0:01:02
      113500 -- (-1422.380) (-1422.115) (-1424.050) [-1421.606] * (-1423.805) (-1424.690) (-1421.280) [-1425.363] -- 0:01:02
      114000 -- [-1421.656] (-1422.427) (-1421.499) (-1425.825) * (-1421.135) (-1421.843) (-1429.198) [-1432.587] -- 0:01:02
      114500 -- (-1422.122) (-1423.593) [-1420.036] (-1425.682) * (-1421.095) (-1421.344) [-1424.553] (-1425.595) -- 0:01:01
      115000 -- (-1420.354) (-1429.034) (-1420.974) [-1421.342] * (-1423.674) (-1422.462) [-1419.988] (-1427.393) -- 0:01:01

      Average standard deviation of split frequencies: 0.028925

      115500 -- (-1422.209) (-1427.628) [-1419.817] (-1419.207) * (-1422.904) (-1421.517) [-1424.098] (-1429.196) -- 0:01:01
      116000 -- (-1420.601) [-1420.390] (-1425.127) (-1421.413) * (-1424.666) (-1422.061) (-1422.137) [-1431.309] -- 0:01:00
      116500 -- (-1420.425) (-1421.974) (-1422.497) [-1422.109] * (-1424.224) (-1422.147) [-1420.982] (-1430.621) -- 0:01:00
      117000 -- (-1419.959) [-1419.356] (-1420.697) (-1424.456) * (-1423.931) (-1422.380) (-1423.218) [-1429.080] -- 0:01:00
      117500 -- (-1421.573) [-1419.228] (-1422.407) (-1425.154) * (-1423.011) [-1421.639] (-1424.113) (-1443.114) -- 0:01:00
      118000 -- (-1420.970) [-1420.361] (-1421.198) (-1430.180) * (-1423.747) (-1422.187) [-1422.382] (-1426.557) -- 0:00:59
      118500 -- (-1421.999) [-1420.169] (-1422.334) (-1427.428) * (-1422.124) [-1422.039] (-1422.843) (-1428.391) -- 0:00:59
      119000 -- (-1421.700) (-1421.409) (-1422.355) [-1423.025] * (-1423.747) (-1422.515) (-1423.512) [-1427.255] -- 0:00:59
      119500 -- (-1420.705) [-1419.186] (-1423.064) (-1422.548) * (-1423.363) (-1425.571) [-1419.957] (-1428.997) -- 0:00:58
      120000 -- (-1421.567) (-1421.302) [-1422.311] (-1424.289) * (-1422.778) (-1423.443) (-1421.289) [-1428.567] -- 0:00:58

      Average standard deviation of split frequencies: 0.030602

      120500 -- (-1420.256) [-1419.836] (-1423.015) (-1425.432) * (-1421.937) (-1424.247) (-1422.660) [-1428.969] -- 0:00:58
      121000 -- [-1421.868] (-1424.299) (-1422.353) (-1420.201) * (-1422.903) (-1425.404) (-1421.620) [-1426.873] -- 0:00:58
      121500 -- (-1419.418) [-1420.731] (-1420.900) (-1419.722) * (-1420.912) (-1423.970) (-1422.881) [-1423.943] -- 0:00:57
      122000 -- [-1420.277] (-1423.586) (-1424.401) (-1421.315) * [-1420.167] (-1430.462) (-1424.879) (-1423.330) -- 0:00:57
      122500 -- (-1422.441) (-1428.062) [-1423.275] (-1421.859) * (-1422.128) [-1421.390] (-1422.471) (-1427.496) -- 0:01:04
      123000 -- [-1421.946] (-1420.472) (-1424.849) (-1424.530) * (-1421.258) (-1421.520) (-1423.233) [-1423.063] -- 0:01:04
      123500 -- (-1422.236) (-1420.893) [-1424.125] (-1424.202) * (-1421.335) (-1420.266) (-1423.274) [-1419.566] -- 0:01:03
      124000 -- [-1421.404] (-1425.278) (-1421.477) (-1424.907) * (-1427.970) [-1419.792] (-1423.081) (-1424.983) -- 0:01:03
      124500 -- [-1421.641] (-1426.037) (-1425.098) (-1425.288) * (-1425.945) (-1424.192) [-1421.139] (-1425.211) -- 0:01:03
      125000 -- [-1422.725] (-1422.602) (-1423.995) (-1428.031) * (-1422.262) [-1422.808] (-1420.809) (-1423.251) -- 0:01:03

      Average standard deviation of split frequencies: 0.028830

      125500 -- [-1423.079] (-1420.525) (-1421.207) (-1423.742) * (-1423.657) (-1421.699) (-1424.022) [-1425.823] -- 0:01:02
      126000 -- [-1422.226] (-1421.801) (-1423.848) (-1422.145) * (-1422.288) [-1422.227] (-1422.220) (-1429.018) -- 0:01:02
      126500 -- (-1420.198) [-1424.235] (-1421.453) (-1425.161) * (-1422.654) (-1422.287) (-1420.034) [-1426.797] -- 0:01:02
      127000 -- [-1419.912] (-1420.542) (-1422.422) (-1424.452) * (-1421.477) [-1423.482] (-1418.967) (-1429.880) -- 0:01:01
      127500 -- (-1419.495) [-1419.616] (-1430.565) (-1421.913) * (-1421.411) (-1421.821) [-1420.786] (-1427.754) -- 0:01:01
      128000 -- (-1420.807) [-1424.258] (-1420.964) (-1422.699) * (-1422.048) (-1423.612) (-1419.196) [-1430.229] -- 0:01:01
      128500 -- (-1423.806) (-1422.941) [-1421.161] (-1421.693) * (-1420.699) (-1423.775) (-1418.398) [-1427.712] -- 0:01:01
      129000 -- (-1423.865) (-1422.736) [-1425.128] (-1421.773) * (-1422.070) (-1426.990) (-1419.636) [-1429.004] -- 0:01:00
      129500 -- [-1421.660] (-1422.460) (-1420.593) (-1421.669) * (-1422.877) (-1425.228) (-1426.017) [-1426.173] -- 0:01:00
      130000 -- [-1423.396] (-1425.095) (-1421.339) (-1420.811) * (-1423.387) (-1423.937) [-1419.792] (-1427.847) -- 0:01:00

      Average standard deviation of split frequencies: 0.024193

      130500 -- [-1422.853] (-1423.603) (-1423.593) (-1421.458) * [-1422.735] (-1426.353) (-1422.081) (-1428.193) -- 0:00:59
      131000 -- (-1420.661) (-1420.741) [-1419.507] (-1425.366) * (-1423.303) (-1421.959) [-1422.966] (-1431.551) -- 0:00:59
      131500 -- (-1420.536) [-1423.376] (-1422.143) (-1422.656) * (-1424.872) (-1423.603) (-1419.586) [-1420.740] -- 0:00:59
      132000 -- [-1420.083] (-1423.116) (-1419.119) (-1422.422) * (-1425.682) [-1421.378] (-1421.111) (-1438.772) -- 0:00:59
      132500 -- (-1421.509) [-1422.133] (-1420.785) (-1422.539) * (-1426.860) (-1421.411) [-1421.844] (-1425.722) -- 0:00:58
      133000 -- [-1420.922] (-1422.012) (-1420.245) (-1423.496) * (-1424.224) (-1422.299) (-1421.129) [-1421.510] -- 0:00:58
      133500 -- (-1424.296) (-1422.312) [-1419.024] (-1422.508) * (-1422.323) [-1422.237] (-1419.731) (-1420.235) -- 0:00:58
      134000 -- [-1421.342] (-1423.197) (-1424.880) (-1425.500) * (-1421.610) (-1421.778) (-1421.417) [-1420.991] -- 0:00:58
      134500 -- (-1421.328) (-1422.716) [-1421.734] (-1425.481) * (-1422.616) [-1420.691] (-1423.821) (-1422.515) -- 0:00:57
      135000 -- (-1421.557) [-1422.037] (-1422.731) (-1421.826) * (-1421.782) [-1420.924] (-1422.967) (-1424.099) -- 0:00:57

      Average standard deviation of split frequencies: 0.023878

      135500 -- (-1423.411) [-1427.937] (-1423.921) (-1424.328) * (-1421.506) (-1423.427) [-1423.004] (-1424.952) -- 0:00:57
      136000 -- [-1421.428] (-1427.524) (-1424.236) (-1427.083) * (-1423.598) (-1424.055) [-1422.962] (-1424.289) -- 0:00:57
      136500 -- [-1421.636] (-1422.944) (-1421.653) (-1427.478) * (-1420.993) (-1422.981) (-1422.839) [-1423.948] -- 0:00:56
      137000 -- (-1425.560) (-1421.593) [-1419.640] (-1424.561) * (-1421.842) (-1423.950) (-1419.698) [-1422.150] -- 0:00:56
      137500 -- [-1427.019] (-1421.919) (-1420.074) (-1422.152) * [-1424.658] (-1422.710) (-1420.221) (-1421.550) -- 0:01:02
      138000 -- [-1422.654] (-1421.123) (-1422.410) (-1421.916) * [-1425.311] (-1423.885) (-1420.602) (-1424.161) -- 0:01:02
      138500 -- (-1425.180) [-1422.354] (-1419.612) (-1426.887) * (-1423.867) (-1425.032) (-1420.439) [-1423.218] -- 0:01:02
      139000 -- [-1420.491] (-1420.201) (-1422.017) (-1425.023) * (-1424.103) (-1423.593) (-1421.168) [-1421.353] -- 0:01:01
      139500 -- (-1423.323) (-1421.758) [-1421.473] (-1424.815) * (-1423.643) (-1423.134) (-1425.297) [-1419.598] -- 0:01:01
      140000 -- (-1421.357) (-1422.735) [-1423.374] (-1423.655) * [-1425.370] (-1423.227) (-1424.093) (-1421.654) -- 0:01:01

      Average standard deviation of split frequencies: 0.021597

      140500 -- (-1421.230) (-1421.787) [-1420.276] (-1426.023) * (-1423.131) (-1426.034) [-1423.076] (-1421.298) -- 0:01:01
      141000 -- (-1423.133) (-1421.173) [-1422.875] (-1427.339) * (-1423.692) [-1421.898] (-1423.350) (-1423.067) -- 0:01:00
      141500 -- (-1425.255) (-1421.557) (-1423.184) [-1422.267] * (-1424.063) (-1421.266) (-1422.886) [-1421.881] -- 0:01:00
      142000 -- (-1423.817) [-1424.278] (-1424.903) (-1422.596) * [-1422.573] (-1423.112) (-1425.294) (-1421.616) -- 0:01:00
      142500 -- (-1424.825) [-1423.152] (-1426.002) (-1421.263) * (-1421.064) [-1420.245] (-1421.164) (-1422.998) -- 0:01:00
      143000 -- [-1427.082] (-1422.253) (-1422.267) (-1422.477) * (-1421.575) (-1420.214) [-1420.491] (-1420.893) -- 0:00:59
      143500 -- (-1425.738) (-1422.152) (-1421.079) [-1422.223] * (-1423.188) [-1420.362] (-1424.804) (-1421.573) -- 0:00:59
      144000 -- (-1424.382) [-1421.891] (-1421.941) (-1421.608) * [-1421.623] (-1420.221) (-1421.806) (-1424.921) -- 0:00:59
      144500 -- [-1424.001] (-1419.576) (-1421.276) (-1425.515) * (-1422.839) [-1420.932] (-1420.734) (-1427.376) -- 0:00:59
      145000 -- [-1421.156] (-1425.469) (-1421.891) (-1422.817) * (-1420.847) (-1420.174) [-1422.050] (-1421.543) -- 0:00:58

      Average standard deviation of split frequencies: 0.020732

      145500 -- [-1421.121] (-1425.632) (-1421.579) (-1421.876) * (-1422.642) [-1420.985] (-1422.413) (-1419.404) -- 0:00:58
      146000 -- (-1419.791) (-1423.737) [-1419.612] (-1424.977) * (-1422.685) (-1423.408) (-1423.767) [-1423.201] -- 0:00:58
      146500 -- (-1427.707) (-1426.317) [-1422.097] (-1421.959) * [-1422.792] (-1420.650) (-1421.564) (-1420.544) -- 0:00:58
      147000 -- (-1426.290) (-1421.087) [-1424.593] (-1424.018) * (-1423.569) [-1420.541] (-1422.611) (-1423.865) -- 0:00:58
      147500 -- (-1422.469) (-1419.952) (-1423.248) [-1421.687] * (-1423.361) [-1422.474] (-1421.645) (-1421.533) -- 0:00:57
      148000 -- (-1421.549) [-1424.537] (-1424.101) (-1422.019) * (-1424.424) (-1422.699) (-1423.882) [-1421.893] -- 0:00:57
      148500 -- [-1425.167] (-1421.075) (-1421.062) (-1422.016) * (-1426.624) (-1422.996) (-1422.976) [-1420.113] -- 0:00:57
      149000 -- (-1422.250) (-1419.879) (-1423.289) [-1421.824] * [-1424.916] (-1424.766) (-1422.699) (-1421.786) -- 0:00:57
      149500 -- (-1423.688) (-1420.309) [-1421.718] (-1423.457) * (-1425.698) [-1423.415] (-1422.433) (-1421.634) -- 0:00:56
      150000 -- [-1420.719] (-1419.813) (-1429.441) (-1422.239) * (-1423.349) (-1423.623) [-1421.465] (-1419.374) -- 0:00:56

      Average standard deviation of split frequencies: 0.020163

      150500 -- (-1419.930) [-1425.810] (-1428.716) (-1425.181) * (-1423.632) (-1422.081) (-1422.111) [-1422.486] -- 0:00:56
      151000 -- [-1419.790] (-1426.327) (-1423.836) (-1427.824) * [-1422.498] (-1420.833) (-1423.163) (-1422.577) -- 0:00:56
      151500 -- [-1420.926] (-1422.824) (-1424.336) (-1423.166) * [-1421.456] (-1425.309) (-1421.005) (-1423.113) -- 0:00:56
      152000 -- (-1424.777) [-1422.816] (-1428.385) (-1424.840) * [-1423.896] (-1422.952) (-1425.023) (-1423.161) -- 0:01:01
      152500 -- [-1424.473] (-1423.731) (-1422.483) (-1425.043) * (-1423.692) (-1423.165) (-1421.791) [-1422.347] -- 0:01:01
      153000 -- (-1420.428) [-1423.298] (-1420.076) (-1425.854) * [-1422.235] (-1422.322) (-1422.417) (-1422.192) -- 0:01:00
      153500 -- (-1421.584) (-1421.424) [-1423.417] (-1422.239) * (-1422.110) (-1423.003) [-1421.411] (-1424.839) -- 0:01:00
      154000 -- (-1427.142) [-1421.562] (-1425.685) (-1422.939) * (-1424.674) (-1421.612) [-1422.830] (-1422.387) -- 0:01:00
      154500 -- (-1423.361) (-1422.657) [-1422.810] (-1422.708) * [-1424.156] (-1422.821) (-1425.281) (-1422.245) -- 0:01:00
      155000 -- [-1423.334] (-1427.390) (-1426.351) (-1424.724) * [-1422.305] (-1422.113) (-1421.363) (-1426.883) -- 0:00:59

      Average standard deviation of split frequencies: 0.020313

      155500 -- (-1420.200) (-1422.924) [-1422.641] (-1423.073) * (-1423.222) (-1428.676) [-1423.426] (-1425.151) -- 0:00:59
      156000 -- (-1420.805) [-1422.765] (-1421.570) (-1423.260) * (-1425.060) (-1426.009) [-1422.219] (-1424.009) -- 0:00:59
      156500 -- (-1419.927) [-1421.689] (-1421.648) (-1428.485) * (-1422.132) (-1423.760) (-1421.723) [-1423.952] -- 0:00:59
      157000 -- (-1425.780) (-1422.831) (-1420.051) [-1422.402] * (-1420.970) [-1420.278] (-1424.852) (-1423.100) -- 0:00:59
      157500 -- [-1422.469] (-1421.706) (-1418.863) (-1420.691) * [-1421.737] (-1424.495) (-1424.038) (-1420.888) -- 0:00:58
      158000 -- (-1424.334) (-1422.859) [-1419.154] (-1422.892) * (-1425.673) (-1423.708) (-1422.816) [-1420.932] -- 0:00:58
      158500 -- (-1423.730) (-1421.400) [-1421.428] (-1420.818) * (-1424.111) (-1421.765) (-1423.824) [-1422.883] -- 0:00:58
      159000 -- (-1427.696) [-1421.224] (-1420.952) (-1420.510) * (-1425.261) [-1421.729] (-1421.972) (-1420.020) -- 0:00:58
      159500 -- [-1420.014] (-1421.012) (-1423.104) (-1427.058) * [-1425.605] (-1422.511) (-1424.228) (-1422.428) -- 0:00:57
      160000 -- (-1423.816) (-1421.717) [-1423.469] (-1423.342) * (-1425.970) (-1423.754) (-1423.620) [-1422.052] -- 0:00:57

      Average standard deviation of split frequencies: 0.019560

      160500 -- (-1422.413) (-1421.679) [-1421.498] (-1424.887) * (-1421.913) (-1421.568) [-1425.307] (-1420.422) -- 0:00:57
      161000 -- (-1421.920) (-1420.878) [-1421.642] (-1420.526) * (-1423.755) (-1424.332) [-1425.049] (-1421.300) -- 0:00:57
      161500 -- (-1421.047) (-1422.738) (-1420.391) [-1420.604] * [-1421.939] (-1425.250) (-1427.961) (-1422.941) -- 0:00:57
      162000 -- (-1422.212) [-1421.620] (-1422.668) (-1420.453) * [-1420.350] (-1431.126) (-1422.998) (-1423.630) -- 0:00:56
      162500 -- (-1424.388) [-1423.658] (-1420.027) (-1420.745) * [-1421.271] (-1422.270) (-1420.530) (-1420.839) -- 0:00:56
      163000 -- (-1420.783) (-1420.142) (-1422.400) [-1421.824] * [-1424.005] (-1423.568) (-1424.442) (-1422.106) -- 0:00:56
      163500 -- [-1420.629] (-1421.162) (-1422.479) (-1418.484) * [-1422.446] (-1422.859) (-1424.915) (-1421.788) -- 0:00:56
      164000 -- (-1421.457) (-1421.553) (-1422.135) [-1421.506] * [-1423.373] (-1420.205) (-1422.558) (-1423.720) -- 0:00:56
      164500 -- [-1422.378] (-1422.070) (-1421.267) (-1419.823) * [-1422.559] (-1420.631) (-1424.230) (-1423.014) -- 0:00:55
      165000 -- (-1424.364) [-1422.691] (-1422.354) (-1420.418) * (-1430.037) [-1421.409] (-1423.296) (-1423.922) -- 0:00:55

      Average standard deviation of split frequencies: 0.019405

      165500 -- [-1422.221] (-1419.722) (-1422.998) (-1418.649) * (-1426.843) [-1419.957] (-1423.246) (-1424.563) -- 0:00:55
      166000 -- (-1422.208) (-1422.032) (-1422.375) [-1422.411] * (-1425.470) (-1422.348) (-1422.831) [-1425.697] -- 0:00:55
      166500 -- (-1422.009) [-1421.290] (-1423.191) (-1420.061) * (-1426.291) (-1424.116) [-1422.051] (-1419.700) -- 0:01:00
      167000 -- (-1421.640) [-1421.194] (-1422.994) (-1421.534) * (-1424.051) [-1424.388] (-1422.300) (-1421.243) -- 0:00:59
      167500 -- (-1421.926) [-1423.632] (-1423.106) (-1419.930) * [-1424.013] (-1421.782) (-1421.490) (-1425.627) -- 0:00:59
      168000 -- [-1422.038] (-1425.351) (-1421.864) (-1420.549) * [-1420.433] (-1421.701) (-1422.829) (-1422.798) -- 0:00:59
      168500 -- (-1430.967) [-1421.046] (-1419.158) (-1423.325) * (-1422.470) (-1424.704) (-1424.119) [-1421.910] -- 0:00:59
      169000 -- (-1422.576) (-1422.412) [-1421.255] (-1423.764) * (-1422.168) [-1420.225] (-1424.890) (-1421.692) -- 0:00:59
      169500 -- (-1423.152) (-1421.394) [-1423.029] (-1422.178) * (-1424.759) (-1421.175) (-1425.981) [-1421.275] -- 0:00:58
      170000 -- (-1422.746) (-1422.276) (-1422.545) [-1422.082] * (-1423.650) (-1425.103) (-1421.201) [-1421.216] -- 0:00:58

      Average standard deviation of split frequencies: 0.019181

      170500 -- (-1425.894) [-1421.107] (-1425.428) (-1419.421) * (-1428.261) (-1423.011) [-1419.657] (-1418.958) -- 0:00:58
      171000 -- (-1424.236) (-1420.092) [-1421.952] (-1423.721) * (-1422.750) (-1425.067) (-1421.829) [-1420.164] -- 0:00:58
      171500 -- (-1423.032) [-1422.392] (-1426.387) (-1428.191) * [-1421.889] (-1423.788) (-1426.351) (-1422.154) -- 0:00:57
      172000 -- [-1423.788] (-1421.851) (-1423.067) (-1421.816) * (-1423.563) (-1422.076) (-1423.118) [-1421.735] -- 0:00:57
      172500 -- (-1423.286) [-1422.868] (-1423.123) (-1421.599) * [-1421.905] (-1422.181) (-1424.362) (-1421.952) -- 0:00:57
      173000 -- (-1423.833) [-1420.653] (-1423.264) (-1423.593) * (-1423.889) (-1421.620) [-1423.162] (-1423.368) -- 0:00:57
      173500 -- [-1420.453] (-1424.671) (-1422.166) (-1422.393) * (-1424.916) (-1421.331) [-1420.126] (-1421.774) -- 0:00:57
      174000 -- (-1421.174) [-1422.204] (-1421.728) (-1422.435) * (-1421.445) (-1421.355) [-1424.477] (-1423.959) -- 0:00:56
      174500 -- (-1422.892) [-1419.629] (-1420.998) (-1418.836) * [-1420.088] (-1422.265) (-1427.439) (-1421.949) -- 0:00:56
      175000 -- (-1421.428) [-1420.683] (-1424.390) (-1419.811) * (-1421.739) (-1423.959) (-1422.877) [-1425.905] -- 0:00:56

      Average standard deviation of split frequencies: 0.018467

      175500 -- (-1424.454) (-1422.270) (-1421.135) [-1420.411] * (-1426.533) [-1423.236] (-1422.723) (-1423.746) -- 0:00:56
      176000 -- (-1426.141) (-1426.012) [-1421.920] (-1421.807) * [-1422.505] (-1422.462) (-1422.257) (-1421.667) -- 0:00:56
      176500 -- (-1421.407) (-1421.778) (-1422.203) [-1421.713] * (-1425.673) (-1425.515) [-1424.647] (-1422.852) -- 0:00:55
      177000 -- (-1421.078) (-1424.880) (-1424.422) [-1421.884] * (-1424.242) (-1422.869) (-1426.441) [-1423.003] -- 0:00:55
      177500 -- (-1422.004) (-1424.644) [-1424.753] (-1421.514) * (-1423.654) (-1424.147) (-1422.427) [-1419.206] -- 0:00:55
      178000 -- (-1422.822) (-1420.098) (-1424.533) [-1420.784] * [-1422.540] (-1427.300) (-1422.012) (-1423.819) -- 0:00:55
      178500 -- (-1423.921) (-1422.767) [-1424.072] (-1424.922) * (-1423.433) (-1426.292) (-1426.250) [-1421.250] -- 0:00:55
      179000 -- (-1424.462) [-1421.167] (-1421.791) (-1419.656) * (-1422.139) (-1421.644) [-1422.271] (-1423.688) -- 0:00:55
      179500 -- (-1420.826) (-1421.446) (-1421.907) [-1419.641] * (-1422.032) (-1420.777) (-1425.008) [-1418.780] -- 0:00:54
      180000 -- (-1422.489) [-1422.325] (-1422.924) (-1419.714) * (-1422.400) (-1424.630) (-1422.873) [-1421.554] -- 0:00:54

      Average standard deviation of split frequencies: 0.016891

      180500 -- (-1422.305) [-1419.246] (-1421.546) (-1421.482) * [-1421.738] (-1423.551) (-1423.800) (-1421.926) -- 0:00:59
      181000 -- [-1420.355] (-1420.618) (-1421.295) (-1421.550) * (-1423.158) (-1422.192) [-1422.932] (-1421.980) -- 0:00:58
      181500 -- [-1421.945] (-1420.954) (-1422.869) (-1422.509) * (-1425.170) (-1422.998) [-1422.521] (-1425.100) -- 0:00:58
      182000 -- (-1423.834) (-1420.657) (-1421.982) [-1421.492] * (-1425.325) (-1421.574) [-1419.635] (-1424.262) -- 0:00:58
      182500 -- (-1424.755) (-1425.871) [-1420.388] (-1421.552) * (-1424.401) [-1423.444] (-1422.702) (-1425.597) -- 0:00:58
      183000 -- (-1426.188) (-1428.452) [-1420.106] (-1422.345) * (-1427.112) (-1424.949) (-1420.127) [-1423.128] -- 0:00:58
      183500 -- (-1424.069) [-1424.035] (-1420.177) (-1425.227) * (-1421.548) [-1421.904] (-1424.544) (-1422.994) -- 0:00:57
      184000 -- (-1422.621) (-1423.841) [-1422.912] (-1422.323) * [-1422.680] (-1419.335) (-1422.588) (-1424.106) -- 0:00:57
      184500 -- (-1422.524) (-1426.755) (-1420.612) [-1420.300] * (-1425.954) (-1421.314) (-1424.955) [-1423.626] -- 0:00:57
      185000 -- (-1425.521) (-1423.970) (-1426.367) [-1421.472] * [-1425.327] (-1423.762) (-1424.915) (-1425.971) -- 0:00:57

      Average standard deviation of split frequencies: 0.016274

      185500 -- (-1423.729) (-1423.579) (-1425.568) [-1421.490] * (-1424.131) (-1421.764) (-1423.760) [-1424.086] -- 0:00:57
      186000 -- [-1424.428] (-1423.691) (-1425.352) (-1420.294) * (-1418.810) (-1422.491) (-1431.892) [-1424.429] -- 0:00:56
      186500 -- (-1420.369) (-1422.150) (-1420.448) [-1419.452] * (-1422.677) (-1420.794) (-1423.362) [-1422.758] -- 0:00:56
      187000 -- (-1421.380) (-1424.449) (-1420.938) [-1421.257] * [-1425.430] (-1428.454) (-1422.525) (-1423.662) -- 0:00:56
      187500 -- (-1421.251) (-1428.272) [-1419.907] (-1420.883) * (-1425.930) (-1433.784) [-1423.806] (-1423.088) -- 0:00:56
      188000 -- (-1420.593) (-1428.163) (-1422.076) [-1421.150] * [-1421.933] (-1422.890) (-1422.356) (-1425.466) -- 0:00:56
      188500 -- [-1421.516] (-1425.854) (-1422.359) (-1419.785) * (-1419.115) (-1426.087) [-1425.257] (-1428.524) -- 0:00:55
      189000 -- (-1423.650) (-1421.281) (-1420.121) [-1419.199] * (-1420.024) (-1424.674) (-1426.132) [-1423.640] -- 0:00:55
      189500 -- (-1424.478) (-1420.896) [-1420.148] (-1422.579) * [-1420.980] (-1424.162) (-1422.159) (-1425.377) -- 0:00:55
      190000 -- (-1425.288) (-1424.404) [-1421.096] (-1428.807) * [-1420.473] (-1426.518) (-1422.105) (-1422.422) -- 0:00:55

      Average standard deviation of split frequencies: 0.014834

      190500 -- (-1421.267) (-1420.990) (-1420.988) [-1419.758] * [-1420.974] (-1422.861) (-1423.108) (-1420.604) -- 0:00:55
      191000 -- (-1422.963) [-1422.940] (-1422.501) (-1422.224) * [-1421.677] (-1423.512) (-1422.010) (-1420.460) -- 0:00:55
      191500 -- [-1426.303] (-1422.972) (-1419.123) (-1425.046) * (-1423.189) (-1425.899) (-1428.490) [-1422.118] -- 0:00:54
      192000 -- (-1421.714) (-1421.708) (-1420.032) [-1422.320] * [-1420.956] (-1422.505) (-1421.483) (-1422.212) -- 0:00:54
      192500 -- (-1420.901) [-1424.434] (-1420.667) (-1424.097) * (-1420.890) [-1420.863] (-1419.237) (-1423.205) -- 0:00:54
      193000 -- [-1424.507] (-1422.874) (-1420.991) (-1423.260) * (-1420.471) [-1425.714] (-1419.683) (-1423.408) -- 0:00:54
      193500 -- [-1422.114] (-1421.037) (-1423.098) (-1421.107) * (-1421.607) (-1422.058) [-1421.153] (-1422.492) -- 0:00:54
      194000 -- (-1421.316) (-1419.939) [-1422.577] (-1421.203) * (-1422.304) [-1423.695] (-1424.191) (-1428.379) -- 0:00:54
      194500 -- [-1421.459] (-1422.337) (-1423.267) (-1421.096) * (-1420.731) (-1423.343) (-1425.246) [-1422.002] -- 0:00:53
      195000 -- [-1422.646] (-1421.726) (-1429.331) (-1424.155) * [-1420.888] (-1423.302) (-1423.322) (-1422.007) -- 0:00:57

      Average standard deviation of split frequencies: 0.014684

      195500 -- [-1420.316] (-1420.918) (-1423.746) (-1420.892) * [-1422.491] (-1419.900) (-1421.158) (-1421.254) -- 0:00:57
      196000 -- (-1422.997) [-1420.850] (-1421.865) (-1422.712) * (-1421.379) [-1419.761] (-1422.716) (-1422.989) -- 0:00:57
      196500 -- (-1422.489) (-1422.842) [-1420.924] (-1422.919) * (-1421.788) (-1419.327) [-1420.947] (-1424.339) -- 0:00:57
      197000 -- (-1422.841) (-1424.044) [-1421.010] (-1420.074) * [-1420.883] (-1422.651) (-1420.370) (-1425.523) -- 0:00:57
      197500 -- [-1421.765] (-1420.965) (-1424.094) (-1422.630) * (-1421.101) (-1422.205) (-1421.166) [-1423.828] -- 0:00:56
      198000 -- (-1423.542) [-1421.832] (-1420.915) (-1423.328) * (-1420.139) (-1421.909) (-1423.319) [-1421.413] -- 0:00:56
      198500 -- (-1424.146) (-1420.804) (-1420.968) [-1427.919] * (-1422.499) (-1420.395) [-1422.840] (-1421.121) -- 0:00:56
      199000 -- [-1424.585] (-1423.898) (-1422.806) (-1423.675) * [-1420.510] (-1422.665) (-1421.648) (-1422.381) -- 0:00:56
      199500 -- [-1422.141] (-1425.192) (-1425.210) (-1424.356) * (-1421.845) [-1421.268] (-1420.588) (-1421.669) -- 0:00:56
      200000 -- (-1421.795) (-1423.012) [-1423.480] (-1425.938) * (-1424.202) (-1423.526) (-1421.192) [-1423.199] -- 0:00:55

      Average standard deviation of split frequencies: 0.014917

      200500 -- [-1423.456] (-1421.045) (-1422.272) (-1427.645) * (-1423.805) (-1425.414) (-1423.789) [-1423.970] -- 0:00:55
      201000 -- (-1422.303) (-1423.576) [-1419.778] (-1430.095) * (-1427.194) (-1427.488) [-1422.313] (-1426.642) -- 0:00:55
      201500 -- [-1421.661] (-1423.016) (-1420.347) (-1423.219) * (-1420.066) (-1426.129) (-1422.458) [-1424.247] -- 0:00:55
      202000 -- (-1422.158) (-1424.754) [-1421.329] (-1422.434) * [-1421.291] (-1423.010) (-1421.425) (-1422.550) -- 0:00:55
      202500 -- (-1424.466) (-1422.408) [-1422.719] (-1422.572) * [-1419.532] (-1423.141) (-1419.447) (-1421.604) -- 0:00:55
      203000 -- (-1424.312) [-1422.785] (-1421.667) (-1421.418) * (-1421.872) [-1422.546] (-1419.834) (-1423.016) -- 0:00:54
      203500 -- (-1425.575) (-1424.537) [-1420.276] (-1421.673) * [-1421.705] (-1422.388) (-1422.367) (-1423.297) -- 0:00:54
      204000 -- (-1420.899) [-1423.187] (-1420.825) (-1424.633) * (-1425.204) [-1425.960] (-1422.138) (-1422.393) -- 0:00:54
      204500 -- [-1422.678] (-1423.597) (-1421.485) (-1423.146) * (-1420.770) (-1425.072) (-1424.998) [-1422.189] -- 0:00:54
      205000 -- (-1422.628) (-1422.716) [-1422.765] (-1422.615) * (-1420.790) (-1423.675) (-1422.672) [-1423.715] -- 0:00:54

      Average standard deviation of split frequencies: 0.015474

      205500 -- (-1424.501) [-1422.651] (-1429.484) (-1422.610) * (-1420.052) (-1421.968) [-1419.033] (-1422.796) -- 0:00:54
      206000 -- (-1423.991) (-1424.339) (-1427.722) [-1421.899] * (-1420.715) [-1421.415] (-1420.771) (-1422.743) -- 0:00:53
      206500 -- [-1424.990] (-1425.438) (-1422.622) (-1422.697) * (-1422.483) (-1421.667) (-1420.167) [-1421.121] -- 0:00:53
      207000 -- [-1421.810] (-1426.838) (-1422.527) (-1423.630) * (-1424.243) (-1421.570) [-1421.190] (-1420.753) -- 0:00:53
      207500 -- (-1427.970) (-1423.197) (-1422.670) [-1423.304] * (-1421.182) (-1429.654) (-1424.670) [-1419.464] -- 0:00:53
      208000 -- (-1421.480) [-1420.095] (-1422.030) (-1423.221) * [-1419.844] (-1421.575) (-1425.174) (-1423.909) -- 0:00:53
      208500 -- (-1426.547) (-1422.253) (-1421.166) [-1420.598] * (-1421.685) (-1421.769) (-1423.901) [-1423.611] -- 0:00:53
      209000 -- (-1422.177) (-1421.455) [-1421.562] (-1422.788) * (-1426.195) [-1421.502] (-1422.510) (-1424.660) -- 0:00:52
      209500 -- (-1424.322) (-1421.484) (-1421.317) [-1422.712] * (-1423.493) [-1420.586] (-1423.035) (-1420.447) -- 0:00:56
      210000 -- [-1423.311] (-1421.521) (-1425.649) (-1420.158) * (-1427.806) [-1419.759] (-1422.369) (-1421.532) -- 0:00:56

      Average standard deviation of split frequencies: 0.015216

      210500 -- (-1421.054) (-1420.588) [-1424.551] (-1422.073) * (-1419.364) [-1420.769] (-1422.802) (-1422.870) -- 0:00:56
      211000 -- [-1420.410] (-1420.644) (-1423.305) (-1420.540) * (-1420.343) (-1419.992) [-1424.007] (-1422.591) -- 0:00:56
      211500 -- (-1423.902) (-1423.251) [-1423.424] (-1419.748) * (-1420.685) [-1420.380] (-1423.530) (-1423.823) -- 0:00:55
      212000 -- (-1421.447) (-1424.837) (-1421.701) [-1422.515] * (-1421.507) [-1420.148] (-1420.867) (-1421.885) -- 0:00:55
      212500 -- [-1421.112] (-1425.201) (-1424.485) (-1421.203) * [-1421.718] (-1422.400) (-1421.239) (-1419.301) -- 0:00:55
      213000 -- (-1420.966) (-1425.898) (-1424.591) [-1421.084] * (-1422.062) (-1425.160) (-1423.215) [-1419.858] -- 0:00:55
      213500 -- (-1421.485) [-1420.560] (-1420.844) (-1422.356) * (-1419.417) (-1422.611) (-1419.720) [-1421.241] -- 0:00:55
      214000 -- (-1421.017) [-1423.726] (-1422.428) (-1425.422) * [-1420.396] (-1424.544) (-1422.160) (-1419.615) -- 0:00:55
      214500 -- (-1423.773) (-1426.102) [-1422.312] (-1425.723) * (-1420.792) [-1424.220] (-1419.335) (-1425.438) -- 0:00:54
      215000 -- (-1425.155) [-1420.789] (-1422.636) (-1423.330) * (-1418.622) (-1421.695) [-1422.672] (-1424.557) -- 0:00:54

      Average standard deviation of split frequencies: 0.014588

      215500 -- [-1423.225] (-1421.511) (-1421.808) (-1420.112) * (-1419.120) [-1420.064] (-1424.000) (-1426.115) -- 0:00:54
      216000 -- (-1425.241) (-1424.351) [-1422.650] (-1422.781) * (-1421.792) (-1420.979) (-1429.549) [-1423.226] -- 0:00:54
      216500 -- (-1425.408) (-1423.861) (-1424.129) [-1420.634] * (-1419.985) [-1421.904] (-1426.313) (-1422.082) -- 0:00:54
      217000 -- (-1424.613) [-1421.483] (-1424.168) (-1421.390) * [-1423.467] (-1422.273) (-1424.887) (-1421.780) -- 0:00:54
      217500 -- (-1422.439) (-1420.908) (-1427.138) [-1421.060] * (-1423.162) [-1421.464] (-1423.361) (-1423.151) -- 0:00:53
      218000 -- (-1423.172) [-1422.605] (-1423.686) (-1419.601) * [-1424.009] (-1421.612) (-1419.688) (-1423.844) -- 0:00:53
      218500 -- (-1421.001) (-1422.362) [-1421.583] (-1423.875) * (-1420.421) (-1421.442) [-1420.663] (-1422.951) -- 0:00:53
      219000 -- [-1422.354] (-1428.826) (-1423.059) (-1424.977) * (-1421.045) [-1422.621] (-1420.539) (-1422.922) -- 0:00:53
      219500 -- (-1421.065) (-1425.598) [-1421.596] (-1423.341) * [-1419.538] (-1422.359) (-1418.268) (-1424.327) -- 0:00:53
      220000 -- (-1423.125) (-1423.254) [-1420.413] (-1423.760) * [-1421.111] (-1422.352) (-1418.803) (-1422.141) -- 0:00:53

      Average standard deviation of split frequencies: 0.015915

      220500 -- (-1429.121) (-1430.049) (-1421.410) [-1420.872] * (-1419.470) [-1420.971] (-1418.471) (-1422.136) -- 0:00:53
      221000 -- [-1423.338] (-1421.461) (-1421.513) (-1422.005) * (-1420.450) [-1420.604] (-1427.619) (-1422.899) -- 0:00:52
      221500 -- [-1424.850] (-1421.899) (-1422.996) (-1422.411) * [-1422.627] (-1422.066) (-1431.713) (-1421.184) -- 0:00:52
      222000 -- (-1420.874) (-1421.112) [-1421.225] (-1424.606) * (-1424.228) [-1420.403] (-1428.051) (-1424.162) -- 0:00:52
      222500 -- (-1422.526) (-1424.109) (-1421.047) [-1422.523] * (-1421.815) [-1418.966] (-1426.077) (-1421.707) -- 0:00:52
      223000 -- [-1422.375] (-1424.520) (-1421.025) (-1421.556) * (-1421.625) [-1423.150] (-1422.497) (-1420.576) -- 0:00:52
      223500 -- (-1425.674) (-1428.192) [-1421.547] (-1421.704) * [-1421.523] (-1422.100) (-1422.890) (-1421.237) -- 0:00:52
      224000 -- (-1421.999) (-1425.282) [-1423.391] (-1424.284) * (-1420.590) (-1422.873) (-1422.197) [-1420.867] -- 0:00:55
      224500 -- [-1423.203] (-1426.046) (-1420.765) (-1422.712) * (-1427.247) (-1423.213) (-1421.114) [-1422.578] -- 0:00:55
      225000 -- (-1421.849) (-1422.753) [-1422.318] (-1425.647) * (-1422.537) (-1423.233) [-1424.167] (-1422.310) -- 0:00:55

      Average standard deviation of split frequencies: 0.015748

      225500 -- [-1420.029] (-1423.960) (-1422.188) (-1423.869) * (-1421.705) [-1420.357] (-1422.459) (-1422.077) -- 0:00:54
      226000 -- [-1422.560] (-1422.099) (-1420.751) (-1422.893) * [-1420.201] (-1422.372) (-1423.274) (-1422.804) -- 0:00:54
      226500 -- (-1422.856) (-1421.841) [-1420.297] (-1422.501) * (-1419.980) (-1423.341) [-1420.460] (-1425.347) -- 0:00:54
      227000 -- (-1421.955) [-1422.093] (-1425.343) (-1422.900) * [-1420.998] (-1422.188) (-1424.887) (-1423.020) -- 0:00:54
      227500 -- [-1422.625] (-1419.845) (-1421.859) (-1424.162) * [-1419.357] (-1422.759) (-1421.318) (-1419.717) -- 0:00:54
      228000 -- (-1422.836) (-1421.353) (-1422.302) [-1422.379] * (-1419.458) (-1423.268) (-1424.792) [-1423.585] -- 0:00:54
      228500 -- (-1425.690) (-1420.809) [-1421.642] (-1424.917) * (-1425.072) (-1424.755) (-1420.691) [-1425.987] -- 0:00:54
      229000 -- [-1424.475] (-1432.492) (-1420.220) (-1423.993) * (-1424.951) (-1423.623) [-1422.901] (-1423.397) -- 0:00:53
      229500 -- (-1424.422) (-1424.901) (-1420.433) [-1421.881] * (-1423.601) (-1422.988) [-1424.072] (-1430.467) -- 0:00:53
      230000 -- (-1421.212) (-1422.466) (-1419.463) [-1422.612] * (-1424.521) [-1422.548] (-1424.140) (-1422.222) -- 0:00:53

      Average standard deviation of split frequencies: 0.015327

      230500 -- (-1423.290) (-1421.730) [-1421.810] (-1423.043) * [-1422.264] (-1423.596) (-1428.316) (-1425.953) -- 0:00:53
      231000 -- [-1419.824] (-1422.942) (-1420.622) (-1423.399) * [-1422.175] (-1423.054) (-1422.819) (-1426.053) -- 0:00:53
      231500 -- (-1420.195) [-1421.852] (-1420.731) (-1425.403) * [-1421.472] (-1422.548) (-1427.534) (-1422.404) -- 0:00:53
      232000 -- (-1422.064) (-1422.697) (-1421.924) [-1425.732] * [-1419.461] (-1424.377) (-1421.362) (-1425.260) -- 0:00:52
      232500 -- (-1425.057) [-1422.870] (-1422.096) (-1425.577) * (-1424.021) (-1426.104) (-1425.152) [-1423.158] -- 0:00:52
      233000 -- (-1424.955) (-1422.166) [-1422.424] (-1427.830) * (-1422.665) (-1422.198) (-1423.436) [-1422.276] -- 0:00:52
      233500 -- (-1422.720) [-1420.981] (-1420.563) (-1425.479) * (-1421.333) (-1422.335) (-1422.745) [-1421.678] -- 0:00:52
      234000 -- (-1421.437) (-1430.784) [-1421.110] (-1424.449) * (-1421.814) (-1423.496) (-1421.742) [-1422.493] -- 0:00:52
      234500 -- (-1425.471) (-1428.170) (-1424.004) [-1423.474] * [-1421.413] (-1422.727) (-1422.256) (-1422.674) -- 0:00:52
      235000 -- (-1422.379) [-1423.801] (-1424.204) (-1421.881) * (-1421.566) (-1422.411) [-1421.664] (-1423.304) -- 0:00:52

      Average standard deviation of split frequencies: 0.014929

      235500 -- [-1421.827] (-1422.102) (-1422.946) (-1424.012) * (-1422.304) (-1425.820) [-1422.598] (-1422.293) -- 0:00:51
      236000 -- (-1422.422) (-1420.384) [-1421.794] (-1427.460) * (-1421.301) [-1422.554] (-1424.321) (-1422.716) -- 0:00:51
      236500 -- (-1419.617) [-1423.213] (-1422.292) (-1421.449) * (-1422.248) [-1421.330] (-1424.311) (-1422.139) -- 0:00:51
      237000 -- (-1420.925) [-1422.876] (-1428.177) (-1420.845) * (-1422.570) [-1421.662] (-1420.677) (-1423.895) -- 0:00:51
      237500 -- (-1425.801) (-1421.961) (-1422.919) [-1420.829] * [-1420.297] (-1424.391) (-1423.272) (-1425.078) -- 0:00:51
      238000 -- (-1419.532) (-1421.376) (-1427.001) [-1421.693] * (-1419.106) [-1424.142] (-1422.053) (-1421.721) -- 0:00:54
      238500 -- (-1421.434) (-1424.034) (-1419.077) [-1420.476] * (-1420.105) [-1421.911] (-1421.815) (-1421.385) -- 0:00:54
      239000 -- [-1421.938] (-1423.342) (-1421.674) (-1421.499) * (-1422.018) [-1422.170] (-1424.458) (-1423.790) -- 0:00:54
      239500 -- (-1423.922) [-1422.899] (-1420.471) (-1421.113) * (-1421.673) [-1419.763] (-1422.188) (-1420.206) -- 0:00:53
      240000 -- (-1422.981) [-1424.153] (-1419.856) (-1423.830) * [-1420.385] (-1425.465) (-1422.571) (-1421.604) -- 0:00:53

      Average standard deviation of split frequencies: 0.016804

      240500 -- (-1425.155) (-1422.021) (-1419.897) [-1422.365] * (-1419.837) (-1424.929) [-1421.913] (-1421.361) -- 0:00:53
      241000 -- (-1420.596) (-1426.292) [-1422.247] (-1422.036) * [-1424.226] (-1422.074) (-1422.812) (-1421.194) -- 0:00:53
      241500 -- (-1421.805) (-1426.018) [-1418.886] (-1422.982) * [-1422.249] (-1428.190) (-1420.913) (-1422.276) -- 0:00:53
      242000 -- (-1420.768) (-1425.617) (-1422.985) [-1423.040] * (-1418.641) (-1424.210) [-1420.610] (-1421.751) -- 0:00:53
      242500 -- [-1425.377] (-1424.147) (-1426.810) (-1422.509) * (-1420.644) (-1424.475) (-1427.100) [-1422.385] -- 0:00:53
      243000 -- [-1422.872] (-1421.681) (-1425.266) (-1421.138) * [-1420.155] (-1427.607) (-1422.916) (-1422.298) -- 0:00:52
      243500 -- (-1419.582) (-1423.603) (-1422.224) [-1421.250] * (-1420.295) (-1423.898) (-1425.081) [-1421.413] -- 0:00:52
      244000 -- [-1421.598] (-1423.230) (-1422.325) (-1418.930) * (-1421.798) (-1424.969) [-1422.768] (-1420.455) -- 0:00:52
      244500 -- (-1422.082) (-1421.161) [-1420.870] (-1422.179) * (-1421.086) (-1423.562) (-1424.300) [-1422.716] -- 0:00:52
      245000 -- (-1424.102) (-1422.789) (-1424.710) [-1421.957] * [-1420.425] (-1423.865) (-1423.036) (-1423.475) -- 0:00:52

      Average standard deviation of split frequencies: 0.016097

      245500 -- (-1425.764) (-1422.101) [-1422.452] (-1424.767) * (-1422.127) (-1427.353) (-1421.780) [-1420.785] -- 0:00:52
      246000 -- (-1426.552) [-1421.967] (-1423.576) (-1420.560) * (-1424.487) (-1425.225) [-1424.119] (-1422.650) -- 0:00:52
      246500 -- [-1420.889] (-1421.825) (-1423.575) (-1420.869) * (-1422.523) (-1425.996) [-1421.436] (-1424.508) -- 0:00:51
      247000 -- [-1420.484] (-1421.411) (-1423.710) (-1425.512) * (-1419.602) (-1425.795) (-1421.448) [-1421.875] -- 0:00:51
      247500 -- [-1420.985] (-1425.100) (-1421.940) (-1421.779) * [-1419.002] (-1425.124) (-1421.706) (-1422.548) -- 0:00:51
      248000 -- (-1419.363) (-1423.279) [-1420.240] (-1423.503) * [-1422.396] (-1424.031) (-1422.324) (-1421.718) -- 0:00:51
      248500 -- (-1423.039) (-1422.627) (-1421.342) [-1423.422] * [-1420.815] (-1429.542) (-1422.288) (-1422.661) -- 0:00:51
      249000 -- (-1424.416) [-1419.712] (-1421.998) (-1424.061) * (-1422.914) (-1425.549) (-1423.367) [-1420.856] -- 0:00:51
      249500 -- (-1425.825) (-1425.105) (-1423.257) [-1422.207] * [-1423.606] (-1423.135) (-1420.988) (-1419.853) -- 0:00:51
      250000 -- (-1422.341) (-1425.241) (-1422.603) [-1423.443] * (-1421.307) (-1421.520) (-1421.991) [-1420.917] -- 0:00:51

      Average standard deviation of split frequencies: 0.018336

      250500 -- [-1418.468] (-1421.791) (-1421.933) (-1424.564) * [-1422.071] (-1421.697) (-1422.543) (-1423.403) -- 0:00:50
      251000 -- (-1420.489) (-1421.433) [-1420.322] (-1424.238) * (-1419.795) (-1423.749) [-1419.596] (-1423.614) -- 0:00:50
      251500 -- (-1423.885) (-1421.757) (-1421.244) [-1422.958] * (-1421.258) [-1421.585] (-1423.195) (-1421.818) -- 0:00:50
      252000 -- (-1420.807) (-1422.837) (-1420.599) [-1420.447] * (-1422.320) (-1422.606) (-1422.510) [-1424.186] -- 0:00:50
      252500 -- [-1420.003] (-1422.299) (-1421.967) (-1422.331) * (-1423.081) (-1420.389) [-1422.959] (-1424.682) -- 0:00:50
      253000 -- [-1422.561] (-1420.921) (-1427.624) (-1426.881) * (-1423.877) (-1420.343) [-1423.441] (-1425.672) -- 0:00:53
      253500 -- (-1424.337) [-1422.281] (-1424.145) (-1422.047) * (-1421.370) (-1420.258) (-1423.284) [-1424.625] -- 0:00:53
      254000 -- [-1425.291] (-1424.049) (-1423.091) (-1422.345) * (-1423.832) [-1423.458] (-1422.787) (-1419.498) -- 0:00:52
      254500 -- (-1424.879) (-1427.078) [-1422.396] (-1420.440) * [-1423.018] (-1424.307) (-1425.493) (-1420.340) -- 0:00:52
      255000 -- (-1421.554) (-1425.453) [-1422.158] (-1419.723) * [-1421.869] (-1425.707) (-1425.267) (-1419.268) -- 0:00:52

      Average standard deviation of split frequencies: 0.017309

      255500 -- (-1420.852) (-1423.991) (-1420.060) [-1420.372] * (-1422.653) (-1422.211) (-1422.659) [-1421.466] -- 0:00:52
      256000 -- [-1420.845] (-1424.213) (-1423.421) (-1421.794) * (-1418.775) [-1422.196] (-1423.721) (-1421.374) -- 0:00:52
      256500 -- [-1421.317] (-1424.487) (-1425.155) (-1420.578) * [-1421.074] (-1426.833) (-1423.984) (-1422.348) -- 0:00:52
      257000 -- (-1421.726) [-1421.305] (-1424.328) (-1427.672) * (-1421.056) (-1431.403) [-1424.261] (-1420.569) -- 0:00:52
      257500 -- (-1424.570) [-1422.382] (-1423.099) (-1420.338) * (-1423.020) [-1424.701] (-1425.717) (-1421.817) -- 0:00:51
      258000 -- (-1420.453) [-1422.722] (-1422.482) (-1421.673) * (-1422.167) (-1424.597) (-1422.862) [-1421.674] -- 0:00:51
      258500 -- (-1425.005) (-1433.926) (-1423.403) [-1420.163] * [-1421.685] (-1424.031) (-1420.512) (-1423.440) -- 0:00:51
      259000 -- [-1420.924] (-1424.760) (-1421.145) (-1423.413) * [-1421.371] (-1424.440) (-1422.383) (-1423.454) -- 0:00:51
      259500 -- (-1419.566) (-1423.009) (-1420.794) [-1422.293] * (-1421.281) [-1423.909] (-1425.286) (-1422.144) -- 0:00:51
      260000 -- (-1420.982) (-1423.829) (-1419.927) [-1422.944] * [-1419.980] (-1424.510) (-1423.756) (-1421.242) -- 0:00:51

      Average standard deviation of split frequencies: 0.017609

      260500 -- [-1421.004] (-1422.521) (-1421.622) (-1424.933) * (-1421.178) (-1425.485) (-1422.657) [-1424.429] -- 0:00:51
      261000 -- [-1420.631] (-1425.647) (-1422.555) (-1422.555) * [-1423.408] (-1421.722) (-1423.110) (-1421.909) -- 0:00:50
      261500 -- (-1422.909) (-1425.330) [-1423.828] (-1424.415) * (-1419.861) (-1420.854) [-1422.800] (-1422.895) -- 0:00:50
      262000 -- (-1422.364) (-1426.638) (-1422.810) [-1420.864] * (-1421.077) (-1421.999) (-1423.077) [-1424.313] -- 0:00:50
      262500 -- (-1423.733) [-1422.503] (-1424.834) (-1421.950) * (-1423.158) (-1422.069) [-1420.846] (-1422.690) -- 0:00:50
      263000 -- [-1420.052] (-1422.392) (-1423.315) (-1424.574) * [-1418.961] (-1421.488) (-1423.542) (-1422.104) -- 0:00:50
      263500 -- (-1427.763) (-1425.021) (-1425.790) [-1422.264] * (-1420.493) (-1423.404) (-1422.688) [-1421.894] -- 0:00:50
      264000 -- (-1423.382) (-1423.326) (-1423.327) [-1423.867] * (-1420.116) (-1424.716) (-1425.193) [-1423.228] -- 0:00:50
      264500 -- [-1422.645] (-1423.944) (-1420.748) (-1424.216) * (-1422.830) [-1422.241] (-1420.268) (-1422.751) -- 0:00:50
      265000 -- [-1422.498] (-1423.940) (-1423.055) (-1424.998) * [-1421.780] (-1421.782) (-1423.163) (-1425.626) -- 0:00:49

      Average standard deviation of split frequencies: 0.015684

      265500 -- (-1424.906) (-1422.021) [-1424.038] (-1426.659) * [-1420.063] (-1423.693) (-1422.500) (-1422.091) -- 0:00:49
      266000 -- (-1423.472) [-1422.025] (-1423.947) (-1423.578) * (-1423.219) (-1421.223) [-1422.428] (-1422.088) -- 0:00:49
      266500 -- (-1423.317) (-1423.022) [-1424.251] (-1422.431) * (-1423.472) [-1421.259] (-1422.350) (-1421.816) -- 0:00:49
      267000 -- (-1426.666) (-1424.696) (-1423.343) [-1421.432] * [-1425.064] (-1423.795) (-1423.391) (-1427.773) -- 0:00:49
      267500 -- (-1428.121) (-1424.729) [-1418.978] (-1422.566) * (-1422.794) (-1423.219) [-1424.063] (-1424.867) -- 0:00:49
      268000 -- (-1425.615) (-1427.928) [-1421.541] (-1426.453) * (-1424.691) (-1425.617) (-1424.703) [-1422.746] -- 0:00:51
      268500 -- (-1429.896) (-1426.930) [-1421.397] (-1421.040) * [-1420.165] (-1424.375) (-1421.607) (-1425.732) -- 0:00:51
      269000 -- (-1424.828) (-1424.765) [-1422.460] (-1424.612) * (-1423.500) (-1423.902) [-1420.072] (-1420.612) -- 0:00:51
      269500 -- (-1421.768) (-1425.407) (-1421.485) [-1425.803] * (-1423.205) [-1421.771] (-1420.319) (-1423.113) -- 0:00:51
      270000 -- (-1422.304) (-1426.573) [-1421.644] (-1424.909) * (-1424.410) (-1421.501) [-1420.906] (-1426.626) -- 0:00:51

      Average standard deviation of split frequencies: 0.017029

      270500 -- (-1422.060) (-1425.976) (-1422.872) [-1421.826] * (-1423.543) (-1424.745) [-1422.876] (-1422.766) -- 0:00:51
      271000 -- (-1423.520) (-1423.359) (-1424.486) [-1424.346] * (-1423.933) (-1421.605) (-1423.732) [-1424.687] -- 0:00:51
      271500 -- [-1422.036] (-1428.571) (-1422.232) (-1424.317) * (-1421.281) [-1422.145] (-1423.755) (-1422.255) -- 0:00:50
      272000 -- (-1421.882) [-1425.851] (-1423.157) (-1425.079) * (-1419.952) (-1422.997) [-1422.305] (-1420.658) -- 0:00:50
      272500 -- (-1421.140) (-1425.047) (-1422.319) [-1422.562] * (-1422.797) (-1423.439) [-1422.303] (-1421.167) -- 0:00:50
      273000 -- (-1424.538) (-1424.201) [-1421.128] (-1421.298) * (-1418.597) (-1423.604) [-1424.403] (-1423.586) -- 0:00:50
      273500 -- (-1422.603) (-1422.524) [-1424.259] (-1423.883) * (-1422.902) (-1422.292) (-1421.030) [-1423.719] -- 0:00:50
      274000 -- (-1422.922) (-1423.059) [-1422.288] (-1421.689) * (-1420.375) [-1423.392] (-1427.658) (-1423.409) -- 0:00:50
      274500 -- (-1423.394) [-1422.111] (-1421.610) (-1423.937) * (-1422.834) (-1425.043) [-1428.125] (-1424.171) -- 0:00:50
      275000 -- (-1425.293) (-1425.066) [-1423.370] (-1423.453) * (-1424.188) (-1421.883) [-1420.327] (-1425.232) -- 0:00:50

      Average standard deviation of split frequencies: 0.015846

      275500 -- [-1425.122] (-1424.289) (-1424.206) (-1419.587) * (-1421.686) (-1419.626) [-1423.921] (-1426.413) -- 0:00:49
      276000 -- (-1423.302) [-1425.104] (-1427.777) (-1420.437) * (-1419.290) [-1420.800] (-1423.280) (-1424.913) -- 0:00:49
      276500 -- (-1423.195) (-1424.179) [-1422.322] (-1422.499) * (-1422.064) [-1422.134] (-1422.204) (-1421.418) -- 0:00:49
      277000 -- (-1423.638) (-1423.289) [-1419.292] (-1421.886) * [-1421.065] (-1421.001) (-1420.244) (-1421.120) -- 0:00:49
      277500 -- (-1422.756) (-1422.168) [-1419.391] (-1420.828) * [-1422.343] (-1420.146) (-1421.157) (-1423.397) -- 0:00:49
      278000 -- [-1423.061] (-1422.165) (-1420.249) (-1423.649) * (-1421.393) (-1424.774) (-1423.273) [-1421.140] -- 0:00:49
      278500 -- [-1421.551] (-1422.427) (-1420.812) (-1423.349) * (-1421.423) (-1420.721) (-1424.108) [-1422.962] -- 0:00:49
      279000 -- (-1423.695) (-1424.019) [-1426.373] (-1422.889) * (-1422.347) (-1424.450) (-1420.277) [-1426.071] -- 0:00:49
      279500 -- (-1422.131) [-1423.112] (-1421.313) (-1422.056) * (-1421.238) [-1422.058] (-1420.027) (-1422.767) -- 0:00:48
      280000 -- (-1423.893) (-1423.628) [-1420.357] (-1418.700) * [-1424.805] (-1421.729) (-1422.854) (-1424.479) -- 0:00:48

      Average standard deviation of split frequencies: 0.014128

      280500 -- (-1421.307) (-1425.739) [-1423.708] (-1425.208) * (-1428.663) [-1423.859] (-1419.775) (-1421.840) -- 0:00:48
      281000 -- (-1421.020) [-1422.921] (-1423.998) (-1424.383) * [-1422.012] (-1422.685) (-1421.887) (-1423.882) -- 0:00:48
      281500 -- [-1422.870] (-1422.926) (-1421.594) (-1421.440) * (-1423.517) (-1422.409) (-1422.960) [-1424.497] -- 0:00:48
      282000 -- [-1422.851] (-1423.610) (-1421.445) (-1425.560) * (-1422.955) (-1422.638) (-1420.041) [-1422.556] -- 0:00:48
      282500 -- [-1422.802] (-1421.649) (-1423.013) (-1418.918) * [-1422.279] (-1420.779) (-1421.483) (-1423.870) -- 0:00:50
      283000 -- [-1423.800] (-1425.352) (-1423.150) (-1423.379) * (-1422.814) [-1420.724] (-1419.996) (-1420.762) -- 0:00:50
      283500 -- (-1421.820) (-1422.824) [-1422.628] (-1420.360) * (-1421.783) (-1427.059) (-1420.548) [-1420.010] -- 0:00:50
      284000 -- [-1422.550] (-1423.504) (-1425.756) (-1420.616) * (-1424.577) (-1424.130) [-1422.103] (-1422.780) -- 0:00:50
      284500 -- (-1425.226) [-1422.016] (-1422.808) (-1420.978) * (-1422.833) (-1421.366) [-1421.712] (-1421.108) -- 0:00:50
      285000 -- (-1423.687) [-1422.031] (-1422.725) (-1419.801) * (-1420.613) [-1422.224] (-1422.454) (-1422.091) -- 0:00:50

      Average standard deviation of split frequencies: 0.014253

      285500 -- [-1425.103] (-1422.526) (-1422.721) (-1422.053) * (-1421.148) (-1425.096) (-1422.774) [-1420.698] -- 0:00:50
      286000 -- [-1422.287] (-1425.249) (-1424.045) (-1424.243) * (-1426.058) [-1422.725] (-1422.687) (-1420.270) -- 0:00:49
      286500 -- (-1425.595) (-1422.980) [-1420.563] (-1424.409) * (-1422.832) (-1424.334) (-1425.352) [-1422.636] -- 0:00:49
      287000 -- (-1422.497) (-1422.677) (-1422.315) [-1420.795] * (-1418.412) [-1421.835] (-1425.038) (-1424.992) -- 0:00:49
      287500 -- (-1423.385) (-1423.140) [-1420.474] (-1421.042) * [-1422.687] (-1427.453) (-1423.565) (-1423.999) -- 0:00:49
      288000 -- [-1423.896] (-1421.626) (-1424.439) (-1424.542) * (-1422.776) (-1420.592) (-1424.019) [-1422.498] -- 0:00:49
      288500 -- [-1428.378] (-1422.839) (-1421.802) (-1421.423) * (-1419.957) [-1424.759] (-1423.227) (-1421.449) -- 0:00:49
      289000 -- (-1422.311) (-1425.739) (-1421.490) [-1419.510] * [-1420.856] (-1422.916) (-1421.784) (-1425.882) -- 0:00:49
      289500 -- (-1420.517) (-1423.057) (-1422.301) [-1418.392] * (-1419.105) (-1424.747) (-1421.051) [-1424.528] -- 0:00:49
      290000 -- (-1421.570) (-1419.975) (-1420.777) [-1421.118] * (-1421.189) (-1420.514) [-1421.771] (-1419.539) -- 0:00:48

      Average standard deviation of split frequencies: 0.013515

      290500 -- [-1425.579] (-1423.103) (-1421.127) (-1423.106) * (-1422.186) (-1424.455) [-1420.986] (-1419.925) -- 0:00:48
      291000 -- [-1422.050] (-1421.648) (-1423.956) (-1420.646) * (-1421.634) (-1421.233) (-1423.064) [-1420.876] -- 0:00:48
      291500 -- [-1421.515] (-1422.371) (-1427.548) (-1421.334) * [-1420.327] (-1420.017) (-1420.586) (-1421.212) -- 0:00:48
      292000 -- (-1426.792) (-1421.817) [-1422.560] (-1421.031) * [-1421.079] (-1426.071) (-1421.169) (-1422.370) -- 0:00:48
      292500 -- (-1424.986) (-1422.291) [-1421.364] (-1422.905) * [-1420.506] (-1422.040) (-1420.945) (-1421.096) -- 0:00:48
      293000 -- (-1423.552) (-1421.908) (-1426.737) [-1427.430] * [-1420.028] (-1421.955) (-1425.954) (-1421.292) -- 0:00:48
      293500 -- (-1422.802) (-1422.292) [-1421.823] (-1423.082) * (-1420.323) (-1422.898) [-1425.748] (-1422.048) -- 0:00:48
      294000 -- (-1422.919) (-1422.507) [-1423.685] (-1421.409) * (-1421.545) [-1421.706] (-1423.729) (-1422.823) -- 0:00:48
      294500 -- [-1421.961] (-1422.241) (-1422.193) (-1420.147) * [-1420.349] (-1420.551) (-1421.946) (-1420.979) -- 0:00:47
      295000 -- (-1420.017) (-1422.326) (-1422.139) [-1422.955] * [-1420.660] (-1420.455) (-1423.578) (-1426.741) -- 0:00:47

      Average standard deviation of split frequencies: 0.012475

      295500 -- (-1421.703) [-1422.388] (-1422.834) (-1422.750) * (-1421.548) (-1424.543) [-1427.508] (-1428.636) -- 0:00:47
      296000 -- (-1422.594) (-1425.415) (-1424.011) [-1421.572] * (-1425.201) [-1419.513] (-1426.861) (-1422.584) -- 0:00:47
      296500 -- (-1422.071) (-1421.216) [-1421.866] (-1422.495) * (-1421.055) (-1422.517) (-1423.480) [-1419.376] -- 0:00:47
      297000 -- (-1425.043) (-1428.731) [-1421.499] (-1425.092) * (-1419.960) (-1421.843) (-1421.726) [-1419.719] -- 0:00:47
      297500 -- [-1421.989] (-1422.295) (-1423.590) (-1424.978) * (-1419.608) [-1423.060] (-1422.492) (-1421.964) -- 0:00:49
      298000 -- (-1420.951) (-1424.858) [-1421.809] (-1420.582) * (-1421.591) (-1422.714) (-1422.656) [-1423.462] -- 0:00:49
      298500 -- (-1420.076) (-1423.449) [-1421.656] (-1420.817) * (-1421.419) (-1426.097) (-1424.028) [-1421.601] -- 0:00:49
      299000 -- (-1421.985) (-1422.490) (-1421.277) [-1423.388] * (-1421.113) [-1421.598] (-1423.822) (-1423.567) -- 0:00:49
      299500 -- [-1422.713] (-1426.041) (-1421.872) (-1423.283) * (-1421.390) (-1422.287) (-1423.612) [-1419.972] -- 0:00:49
      300000 -- (-1422.339) (-1423.258) (-1425.855) [-1421.026] * (-1420.537) (-1423.755) (-1420.397) [-1421.331] -- 0:00:48

      Average standard deviation of split frequencies: 0.012727

      300500 -- (-1421.149) [-1420.575] (-1422.519) (-1422.065) * [-1419.813] (-1423.901) (-1422.686) (-1421.365) -- 0:00:48
      301000 -- (-1422.889) (-1426.903) (-1423.535) [-1428.498] * (-1421.427) (-1425.174) (-1425.818) [-1421.909] -- 0:00:48
      301500 -- (-1425.386) (-1425.791) (-1423.841) [-1422.985] * (-1425.634) [-1422.545] (-1423.641) (-1420.849) -- 0:00:48
      302000 -- (-1424.678) (-1423.070) (-1423.137) [-1425.442] * [-1419.665] (-1421.851) (-1423.384) (-1419.970) -- 0:00:48
      302500 -- [-1422.575] (-1421.776) (-1422.891) (-1422.171) * (-1422.708) [-1423.267] (-1422.370) (-1424.173) -- 0:00:48
      303000 -- (-1421.184) [-1421.552] (-1422.138) (-1422.805) * (-1422.434) (-1425.022) [-1422.310] (-1420.761) -- 0:00:48
      303500 -- (-1422.329) [-1420.558] (-1424.237) (-1421.631) * (-1426.042) (-1422.036) (-1419.006) [-1423.218] -- 0:00:48
      304000 -- (-1427.978) (-1420.747) (-1424.275) [-1421.677] * (-1421.820) (-1421.984) [-1420.983] (-1421.472) -- 0:00:48
      304500 -- (-1422.248) (-1422.839) [-1424.633] (-1422.194) * (-1421.664) (-1423.067) (-1421.813) [-1422.590] -- 0:00:47
      305000 -- [-1424.672] (-1421.341) (-1422.957) (-1421.722) * [-1423.224] (-1422.707) (-1422.202) (-1420.757) -- 0:00:47

      Average standard deviation of split frequencies: 0.012153

      305500 -- (-1423.199) (-1421.703) (-1424.786) [-1420.719] * (-1422.300) [-1422.727] (-1419.246) (-1419.469) -- 0:00:47
      306000 -- (-1422.349) (-1421.249) [-1420.719] (-1420.149) * (-1422.784) [-1422.684] (-1421.996) (-1420.030) -- 0:00:47
      306500 -- [-1419.587] (-1419.559) (-1426.362) (-1421.288) * [-1422.659] (-1427.861) (-1422.497) (-1420.137) -- 0:00:47
      307000 -- (-1425.576) (-1422.100) [-1427.351] (-1422.333) * (-1422.564) (-1425.574) (-1421.892) [-1422.443] -- 0:00:47
      307500 -- (-1424.635) [-1421.428] (-1422.657) (-1424.262) * (-1421.085) (-1428.284) (-1420.636) [-1421.217] -- 0:00:47
      308000 -- (-1423.707) [-1421.493] (-1422.973) (-1428.030) * (-1422.363) (-1425.857) [-1422.986] (-1424.019) -- 0:00:47
      308500 -- (-1425.874) (-1422.892) (-1422.202) [-1421.966] * (-1420.371) (-1422.487) [-1420.385] (-1424.071) -- 0:00:47
      309000 -- [-1421.268] (-1422.452) (-1423.845) (-1424.264) * [-1418.598] (-1421.515) (-1423.131) (-1421.169) -- 0:00:46
      309500 -- (-1421.625) [-1422.604] (-1424.345) (-1422.131) * [-1419.210] (-1422.906) (-1420.136) (-1420.738) -- 0:00:46
      310000 -- [-1422.262] (-1427.253) (-1424.839) (-1422.237) * [-1422.417] (-1420.848) (-1421.214) (-1422.310) -- 0:00:46

      Average standard deviation of split frequencies: 0.011549

      310500 -- (-1422.036) (-1424.483) [-1422.419] (-1423.742) * (-1421.290) [-1422.709] (-1425.694) (-1422.765) -- 0:00:46
      311000 -- (-1420.666) (-1423.400) (-1420.238) [-1421.385] * (-1422.849) [-1427.338] (-1420.381) (-1426.516) -- 0:00:46
      311500 -- (-1421.762) (-1422.231) (-1421.788) [-1420.377] * [-1421.767] (-1423.622) (-1421.415) (-1425.058) -- 0:00:46
      312000 -- (-1422.033) [-1422.155] (-1424.055) (-1423.372) * [-1422.600] (-1423.400) (-1422.883) (-1427.070) -- 0:00:48
      312500 -- [-1420.698] (-1422.220) (-1422.032) (-1420.351) * (-1421.745) (-1424.638) [-1423.115] (-1421.194) -- 0:00:48
      313000 -- (-1422.551) (-1422.432) [-1423.564] (-1420.337) * (-1424.416) (-1424.045) [-1421.415] (-1421.687) -- 0:00:48
      313500 -- (-1425.456) [-1422.333] (-1424.566) (-1422.316) * [-1422.478] (-1424.415) (-1422.860) (-1420.354) -- 0:00:48
      314000 -- (-1422.794) [-1423.435] (-1425.895) (-1420.690) * (-1422.690) [-1420.157] (-1422.425) (-1421.201) -- 0:00:48
      314500 -- (-1424.662) [-1424.353] (-1423.710) (-1422.462) * (-1421.554) (-1427.768) [-1421.270] (-1419.886) -- 0:00:47
      315000 -- (-1423.159) [-1422.237] (-1423.524) (-1421.372) * (-1421.199) (-1427.943) [-1421.684] (-1423.820) -- 0:00:47

      Average standard deviation of split frequencies: 0.010691

      315500 -- (-1420.835) (-1425.379) (-1423.354) [-1420.779] * (-1425.027) [-1426.806] (-1424.962) (-1420.809) -- 0:00:47
      316000 -- (-1425.741) (-1424.854) [-1423.452] (-1421.647) * (-1424.756) (-1422.671) (-1424.020) [-1422.525] -- 0:00:47
      316500 -- (-1422.015) (-1419.836) (-1426.681) [-1425.609] * (-1424.453) (-1425.438) (-1420.176) [-1422.388] -- 0:00:47
      317000 -- [-1423.290] (-1419.920) (-1424.117) (-1422.953) * [-1423.606] (-1421.872) (-1423.193) (-1420.078) -- 0:00:47
      317500 -- [-1422.898] (-1424.148) (-1424.051) (-1424.643) * [-1419.917] (-1421.098) (-1424.662) (-1419.497) -- 0:00:47
      318000 -- [-1422.682] (-1420.774) (-1422.547) (-1422.905) * (-1425.991) (-1428.441) [-1425.411] (-1421.447) -- 0:00:47
      318500 -- (-1421.527) (-1427.059) (-1424.783) [-1424.843] * [-1420.782] (-1425.640) (-1420.413) (-1420.820) -- 0:00:47
      319000 -- [-1422.325] (-1422.520) (-1426.155) (-1423.013) * (-1420.077) (-1422.097) (-1421.114) [-1420.142] -- 0:00:46
      319500 -- [-1419.761] (-1420.923) (-1422.247) (-1424.262) * (-1420.623) [-1422.235] (-1423.184) (-1421.960) -- 0:00:46
      320000 -- (-1423.828) [-1425.754] (-1421.825) (-1420.205) * (-1420.654) (-1419.953) (-1424.795) [-1420.229] -- 0:00:46

      Average standard deviation of split frequencies: 0.009372

      320500 -- [-1426.583] (-1425.687) (-1421.635) (-1420.450) * (-1421.547) [-1425.348] (-1423.733) (-1425.993) -- 0:00:46
      321000 -- (-1421.823) [-1420.883] (-1422.454) (-1421.791) * (-1422.258) [-1421.684] (-1424.751) (-1422.698) -- 0:00:46
      321500 -- (-1423.941) (-1418.572) (-1424.115) [-1419.579] * (-1424.080) (-1421.585) (-1426.622) [-1423.061] -- 0:00:46
      322000 -- (-1422.511) (-1423.708) [-1422.361] (-1420.037) * (-1426.606) (-1422.411) [-1420.624] (-1421.704) -- 0:00:46
      322500 -- (-1423.971) (-1421.750) (-1422.900) [-1419.223] * [-1424.182] (-1422.038) (-1420.620) (-1421.316) -- 0:00:46
      323000 -- (-1422.980) (-1421.755) (-1432.462) [-1420.348] * [-1421.237] (-1423.920) (-1421.909) (-1423.219) -- 0:00:46
      323500 -- (-1424.031) [-1420.226] (-1423.329) (-1422.509) * (-1421.022) (-1422.831) [-1419.800] (-1427.546) -- 0:00:46
      324000 -- (-1423.557) (-1419.703) (-1427.354) [-1419.734] * (-1422.340) [-1421.915] (-1419.712) (-1425.383) -- 0:00:45
      324500 -- (-1424.176) [-1423.570] (-1421.551) (-1421.192) * (-1420.129) [-1429.673] (-1423.370) (-1423.012) -- 0:00:45
      325000 -- [-1421.257] (-1426.851) (-1422.884) (-1420.800) * [-1422.074] (-1421.847) (-1428.940) (-1422.870) -- 0:00:45

      Average standard deviation of split frequencies: 0.010444

      325500 -- (-1422.978) [-1421.668] (-1420.155) (-1418.830) * (-1422.972) (-1422.450) [-1424.569] (-1421.473) -- 0:00:45
      326000 -- (-1422.581) (-1422.811) (-1420.968) [-1420.865] * (-1424.484) (-1424.398) (-1422.240) [-1422.822] -- 0:00:45
      326500 -- (-1422.674) [-1423.061] (-1424.117) (-1423.508) * (-1420.422) [-1422.108] (-1422.917) (-1424.871) -- 0:00:47
      327000 -- (-1426.946) [-1420.199] (-1422.873) (-1424.610) * (-1420.260) [-1426.856] (-1419.980) (-1424.099) -- 0:00:47
      327500 -- (-1427.390) [-1422.664] (-1423.387) (-1421.549) * [-1419.367] (-1422.784) (-1422.228) (-1422.556) -- 0:00:47
      328000 -- (-1420.957) (-1421.639) [-1428.982] (-1423.000) * (-1420.126) [-1423.476] (-1423.096) (-1422.239) -- 0:00:47
      328500 -- [-1420.338] (-1420.391) (-1422.595) (-1424.666) * (-1424.405) [-1422.441] (-1421.574) (-1421.482) -- 0:00:47
      329000 -- (-1419.031) [-1421.993] (-1425.214) (-1420.721) * (-1424.066) [-1422.981] (-1422.828) (-1426.257) -- 0:00:46
      329500 -- [-1419.971] (-1422.746) (-1421.358) (-1426.189) * (-1423.550) (-1425.553) [-1421.281] (-1422.765) -- 0:00:46
      330000 -- [-1422.257] (-1421.219) (-1421.700) (-1422.960) * [-1422.911] (-1423.004) (-1424.681) (-1422.872) -- 0:00:46

      Average standard deviation of split frequencies: 0.009392

      330500 -- (-1426.492) (-1420.593) (-1422.897) [-1423.041] * (-1422.735) (-1420.689) [-1426.415] (-1423.749) -- 0:00:46
      331000 -- [-1421.954] (-1420.263) (-1426.116) (-1428.017) * (-1427.685) [-1421.115] (-1424.752) (-1425.244) -- 0:00:46
      331500 -- (-1422.518) [-1421.773] (-1428.669) (-1425.084) * (-1420.549) [-1420.766] (-1421.941) (-1431.480) -- 0:00:46
      332000 -- [-1422.615] (-1420.143) (-1422.903) (-1424.923) * (-1422.822) [-1425.247] (-1423.087) (-1421.467) -- 0:00:46
      332500 -- [-1424.658] (-1419.864) (-1422.201) (-1421.408) * [-1419.528] (-1424.116) (-1420.465) (-1421.094) -- 0:00:46
      333000 -- (-1421.588) [-1423.656] (-1422.367) (-1421.550) * (-1422.122) (-1428.094) [-1423.879] (-1422.522) -- 0:00:46
      333500 -- (-1419.137) [-1423.046] (-1424.161) (-1420.078) * (-1421.338) [-1424.518] (-1429.483) (-1426.095) -- 0:00:45
      334000 -- (-1419.325) [-1422.526] (-1418.914) (-1424.579) * [-1425.232] (-1422.139) (-1425.401) (-1422.200) -- 0:00:45
      334500 -- (-1421.656) (-1422.795) (-1423.776) [-1420.652] * (-1422.892) (-1421.450) (-1424.540) [-1425.520] -- 0:00:45
      335000 -- (-1424.168) [-1424.360] (-1423.201) (-1424.165) * [-1422.677] (-1423.812) (-1424.094) (-1430.059) -- 0:00:45

      Average standard deviation of split frequencies: 0.010069

      335500 -- (-1426.178) [-1422.429] (-1418.877) (-1426.782) * [-1422.854] (-1421.742) (-1424.638) (-1422.438) -- 0:00:45
      336000 -- (-1422.826) (-1420.860) [-1420.771] (-1424.170) * (-1425.193) (-1424.118) [-1421.303] (-1421.761) -- 0:00:45
      336500 -- (-1426.232) [-1419.852] (-1424.073) (-1422.901) * (-1422.372) (-1423.546) [-1418.895] (-1420.590) -- 0:00:45
      337000 -- [-1422.023] (-1419.538) (-1421.454) (-1420.474) * (-1420.243) (-1426.806) [-1423.978] (-1421.491) -- 0:00:45
      337500 -- (-1421.525) (-1419.742) [-1419.758] (-1421.778) * (-1419.615) (-1430.781) [-1421.044] (-1424.625) -- 0:00:45
      338000 -- (-1421.055) (-1426.003) (-1421.423) [-1421.188] * (-1424.460) (-1422.466) (-1418.289) [-1423.277] -- 0:00:45
      338500 -- [-1421.652] (-1420.677) (-1422.620) (-1424.261) * [-1423.226] (-1422.784) (-1419.346) (-1423.509) -- 0:00:44
      339000 -- (-1422.768) [-1422.246] (-1426.271) (-1422.334) * (-1423.781) [-1423.034] (-1428.619) (-1423.510) -- 0:00:44
      339500 -- [-1422.087] (-1419.931) (-1423.599) (-1422.037) * (-1423.586) [-1422.211] (-1423.452) (-1427.832) -- 0:00:46
      340000 -- (-1421.333) [-1422.338] (-1423.665) (-1422.161) * [-1420.525] (-1423.468) (-1422.426) (-1427.075) -- 0:00:46

      Average standard deviation of split frequencies: 0.010205

      340500 -- (-1421.843) (-1421.854) [-1424.741] (-1421.756) * (-1423.042) (-1421.622) [-1421.227] (-1422.172) -- 0:00:46
      341000 -- [-1421.484] (-1422.719) (-1422.723) (-1421.576) * (-1426.432) (-1421.673) (-1422.171) [-1423.909] -- 0:00:46
      341500 -- (-1425.949) [-1423.331] (-1419.914) (-1424.260) * (-1424.623) (-1420.851) [-1424.559] (-1424.400) -- 0:00:46
      342000 -- [-1423.334] (-1420.114) (-1423.544) (-1422.548) * (-1424.059) (-1424.636) (-1423.566) [-1424.219] -- 0:00:46
      342500 -- (-1426.107) (-1421.355) (-1420.649) [-1422.723] * [-1421.909] (-1423.373) (-1424.826) (-1422.889) -- 0:00:46
      343000 -- (-1420.590) (-1424.694) [-1420.564] (-1422.761) * [-1421.202] (-1422.034) (-1420.995) (-1423.859) -- 0:00:45
      343500 -- (-1419.904) [-1423.559] (-1419.755) (-1422.334) * (-1424.127) (-1421.824) [-1422.283] (-1427.881) -- 0:00:45
      344000 -- [-1421.093] (-1421.506) (-1419.852) (-1423.782) * (-1421.510) (-1423.208) [-1420.546] (-1424.548) -- 0:00:45
      344500 -- (-1420.455) (-1421.849) (-1422.108) [-1422.781] * [-1420.914] (-1422.942) (-1422.657) (-1423.464) -- 0:00:45
      345000 -- (-1419.831) (-1424.272) (-1420.950) [-1421.947] * [-1426.725] (-1422.372) (-1421.919) (-1423.131) -- 0:00:45

      Average standard deviation of split frequencies: 0.011300

      345500 -- (-1422.084) (-1422.993) (-1423.441) [-1422.686] * [-1422.138] (-1421.919) (-1423.035) (-1420.537) -- 0:00:45
      346000 -- (-1423.222) (-1422.011) (-1422.402) [-1423.004] * [-1422.971] (-1420.167) (-1425.240) (-1427.793) -- 0:00:45
      346500 -- (-1425.361) [-1418.757] (-1420.480) (-1421.463) * [-1423.835] (-1422.742) (-1421.720) (-1423.512) -- 0:00:45
      347000 -- [-1422.953] (-1420.523) (-1420.532) (-1421.805) * (-1422.609) (-1423.875) (-1421.645) [-1423.270] -- 0:00:45
      347500 -- (-1423.424) (-1421.904) [-1421.300] (-1422.940) * (-1422.646) (-1422.113) [-1420.049] (-1424.735) -- 0:00:45
      348000 -- (-1422.934) (-1422.792) (-1423.463) [-1422.161] * (-1426.902) (-1422.410) [-1424.383] (-1424.888) -- 0:00:44
      348500 -- (-1421.561) (-1422.212) [-1423.783] (-1423.513) * [-1423.976] (-1422.007) (-1422.565) (-1421.235) -- 0:00:44
      349000 -- (-1423.069) [-1422.062] (-1422.418) (-1422.259) * (-1423.816) (-1423.441) (-1421.929) [-1421.141] -- 0:00:44
      349500 -- (-1425.825) (-1423.397) [-1419.921] (-1422.025) * [-1420.931] (-1423.992) (-1421.583) (-1422.502) -- 0:00:44
      350000 -- (-1423.206) [-1423.881] (-1420.120) (-1422.139) * (-1420.271) (-1424.573) (-1425.311) [-1421.529] -- 0:00:44

      Average standard deviation of split frequencies: 0.009964

      350500 -- [-1418.336] (-1422.368) (-1421.585) (-1421.398) * [-1419.947] (-1430.206) (-1422.919) (-1421.528) -- 0:00:44
      351000 -- (-1421.432) (-1423.365) (-1421.981) [-1421.782] * (-1422.837) (-1424.259) (-1423.097) [-1421.812] -- 0:00:44
      351500 -- (-1420.544) (-1423.548) (-1421.996) [-1420.502] * [-1423.521] (-1421.925) (-1429.925) (-1421.961) -- 0:00:44
      352000 -- (-1420.900) (-1421.907) [-1420.346] (-1427.399) * (-1423.302) (-1422.932) [-1431.131] (-1420.897) -- 0:00:44
      352500 -- (-1424.975) (-1423.833) [-1421.004] (-1422.440) * (-1423.351) (-1422.825) (-1430.675) [-1421.441] -- 0:00:44
      353000 -- (-1422.340) (-1420.032) (-1420.407) [-1420.267] * [-1422.667] (-1418.899) (-1420.345) (-1421.151) -- 0:00:43
      353500 -- (-1425.731) (-1421.502) (-1421.695) [-1425.631] * (-1426.519) (-1423.907) [-1421.081] (-1426.477) -- 0:00:45
      354000 -- (-1420.603) [-1422.099] (-1421.274) (-1423.713) * (-1421.838) (-1420.267) [-1419.859] (-1423.702) -- 0:00:45
      354500 -- (-1423.968) (-1423.461) (-1421.774) [-1422.355] * (-1422.420) [-1423.365] (-1421.235) (-1422.719) -- 0:00:45
      355000 -- (-1420.464) (-1425.257) (-1420.293) [-1422.540] * (-1425.224) (-1424.128) (-1421.433) [-1427.169] -- 0:00:45

      Average standard deviation of split frequencies: 0.009186

      355500 -- (-1421.844) [-1423.853] (-1421.087) (-1422.426) * [-1420.836] (-1422.656) (-1422.221) (-1424.136) -- 0:00:45
      356000 -- (-1424.208) (-1422.499) (-1423.849) [-1421.178] * (-1422.671) (-1429.802) [-1423.011] (-1421.670) -- 0:00:45
      356500 -- (-1422.700) (-1423.970) (-1425.168) [-1421.627] * (-1423.981) (-1429.808) [-1422.713] (-1421.860) -- 0:00:45
      357000 -- (-1425.623) (-1420.812) (-1424.632) [-1420.494] * [-1421.838] (-1420.716) (-1420.006) (-1425.514) -- 0:00:45
      357500 -- [-1422.407] (-1421.729) (-1425.523) (-1422.410) * [-1423.497] (-1421.247) (-1423.560) (-1422.628) -- 0:00:44
      358000 -- (-1425.627) [-1421.075] (-1422.890) (-1423.276) * (-1422.578) (-1427.511) [-1424.610] (-1422.572) -- 0:00:44
      358500 -- [-1422.546] (-1424.681) (-1421.353) (-1424.339) * (-1423.778) (-1423.354) [-1422.226] (-1423.574) -- 0:00:44
      359000 -- [-1421.808] (-1423.613) (-1422.850) (-1423.690) * (-1424.805) (-1421.979) (-1424.961) [-1423.585] -- 0:00:44
      359500 -- (-1424.908) (-1424.541) (-1425.404) [-1422.918] * (-1427.715) [-1423.084] (-1424.389) (-1425.133) -- 0:00:44
      360000 -- (-1421.291) (-1425.375) [-1420.134] (-1422.813) * (-1427.168) (-1425.068) (-1423.847) [-1424.034] -- 0:00:44

      Average standard deviation of split frequencies: 0.009313

      360500 -- (-1421.837) (-1422.919) (-1423.507) [-1419.877] * (-1425.753) (-1424.593) (-1421.992) [-1423.742] -- 0:00:44
      361000 -- (-1425.970) (-1421.698) [-1421.289] (-1421.751) * (-1422.106) [-1422.944] (-1428.328) (-1423.459) -- 0:00:44
      361500 -- [-1421.036] (-1421.737) (-1423.962) (-1423.832) * [-1422.978] (-1421.280) (-1423.886) (-1422.804) -- 0:00:44
      362000 -- (-1423.782) (-1424.104) [-1424.253] (-1424.580) * (-1424.971) (-1422.670) [-1422.127] (-1421.267) -- 0:00:44
      362500 -- (-1423.659) (-1421.956) (-1422.378) [-1421.208] * (-1424.938) (-1424.925) (-1423.475) [-1419.884] -- 0:00:43
      363000 -- (-1422.395) (-1423.578) [-1421.998] (-1424.366) * [-1423.061] (-1424.870) (-1423.285) (-1422.407) -- 0:00:43
      363500 -- (-1420.954) (-1424.302) [-1423.028] (-1422.846) * (-1422.065) [-1423.862] (-1423.106) (-1422.748) -- 0:00:43
      364000 -- [-1422.317] (-1423.673) (-1422.227) (-1421.804) * [-1420.767] (-1421.789) (-1424.457) (-1421.523) -- 0:00:43
      364500 -- (-1422.747) (-1422.666) [-1421.272] (-1423.363) * (-1421.663) (-1427.640) (-1423.603) [-1421.679] -- 0:00:43
      365000 -- (-1425.415) (-1422.669) (-1423.876) [-1426.548] * [-1423.620] (-1426.425) (-1422.414) (-1422.826) -- 0:00:43

      Average standard deviation of split frequencies: 0.010304

      365500 -- (-1426.141) [-1423.657] (-1426.221) (-1428.637) * (-1423.047) (-1435.876) (-1421.883) [-1426.138] -- 0:00:43
      366000 -- (-1421.857) (-1425.380) (-1423.023) [-1425.615] * [-1421.922] (-1426.834) (-1419.654) (-1424.498) -- 0:00:43
      366500 -- (-1425.749) (-1424.288) [-1420.229] (-1418.756) * (-1422.523) (-1425.411) (-1422.360) [-1423.408] -- 0:00:43
      367000 -- (-1423.863) (-1425.609) (-1420.030) [-1419.890] * (-1425.294) (-1422.192) [-1420.700] (-1420.390) -- 0:00:43
      367500 -- (-1423.688) [-1422.956] (-1421.947) (-1422.396) * (-1423.097) [-1423.431] (-1423.180) (-1423.190) -- 0:00:43
      368000 -- (-1425.708) [-1421.166] (-1424.982) (-1420.578) * (-1420.556) (-1425.616) [-1422.391] (-1422.425) -- 0:00:44
      368500 -- (-1424.917) [-1421.710] (-1421.850) (-1418.645) * (-1421.374) (-1421.843) (-1424.127) [-1421.757] -- 0:00:44
      369000 -- (-1421.833) (-1420.522) (-1422.211) [-1419.286] * (-1420.326) (-1422.383) (-1425.111) [-1423.226] -- 0:00:44
      369500 -- (-1420.479) (-1425.197) (-1423.254) [-1420.906] * (-1424.232) (-1423.347) (-1423.290) [-1422.233] -- 0:00:44
      370000 -- (-1424.805) (-1421.573) (-1424.759) [-1421.045] * (-1421.034) (-1422.192) (-1425.931) [-1424.308] -- 0:00:44

      Average standard deviation of split frequencies: 0.010773

      370500 -- (-1425.288) [-1421.768] (-1423.320) (-1422.351) * (-1421.773) [-1421.766] (-1423.834) (-1422.225) -- 0:00:44
      371000 -- (-1424.115) (-1424.687) [-1423.601] (-1420.180) * (-1422.210) (-1424.227) (-1423.197) [-1421.523] -- 0:00:44
      371500 -- (-1422.316) [-1423.176] (-1421.903) (-1421.783) * [-1424.052] (-1422.467) (-1421.782) (-1421.546) -- 0:00:43
      372000 -- (-1425.914) [-1423.247] (-1423.126) (-1422.480) * (-1421.220) (-1422.595) [-1421.236] (-1422.041) -- 0:00:43
      372500 -- [-1420.993] (-1423.875) (-1420.359) (-1422.262) * (-1423.592) [-1425.616] (-1424.667) (-1422.271) -- 0:00:43
      373000 -- (-1423.985) (-1424.204) (-1421.493) [-1419.792] * (-1423.791) (-1428.768) [-1421.288] (-1422.283) -- 0:00:43
      373500 -- (-1427.031) (-1422.585) [-1422.210] (-1422.208) * [-1421.399] (-1426.336) (-1420.389) (-1423.811) -- 0:00:43
      374000 -- (-1421.636) [-1424.421] (-1420.005) (-1423.121) * [-1419.801] (-1423.567) (-1421.581) (-1423.444) -- 0:00:43
      374500 -- [-1423.470] (-1423.687) (-1420.791) (-1421.695) * (-1422.728) (-1424.442) (-1422.892) [-1422.705] -- 0:00:43
      375000 -- (-1424.722) [-1424.070] (-1425.710) (-1421.966) * (-1421.792) [-1431.878] (-1422.183) (-1424.790) -- 0:00:43

      Average standard deviation of split frequencies: 0.009716

      375500 -- [-1420.995] (-1423.480) (-1422.647) (-1419.575) * (-1421.948) (-1429.875) (-1420.942) [-1423.314] -- 0:00:43
      376000 -- (-1421.809) [-1426.025] (-1421.944) (-1422.661) * (-1421.423) (-1423.542) (-1421.049) [-1422.233] -- 0:00:43
      376500 -- (-1420.607) [-1423.677] (-1423.171) (-1421.225) * [-1421.439] (-1423.212) (-1422.925) (-1422.309) -- 0:00:43
      377000 -- (-1421.940) (-1422.626) (-1422.649) [-1421.831] * [-1419.913] (-1421.588) (-1421.498) (-1424.237) -- 0:00:42
      377500 -- (-1422.170) (-1425.134) [-1422.194] (-1422.160) * (-1422.101) (-1423.457) (-1422.353) [-1422.018] -- 0:00:42
      378000 -- (-1421.813) (-1423.578) [-1421.541] (-1422.829) * (-1418.722) [-1422.215] (-1423.421) (-1423.208) -- 0:00:42
      378500 -- (-1424.905) [-1427.509] (-1423.490) (-1419.012) * (-1424.731) [-1422.928] (-1422.439) (-1421.897) -- 0:00:42
      379000 -- (-1427.032) (-1424.080) [-1421.800] (-1421.402) * (-1421.453) (-1421.461) (-1423.612) [-1420.484] -- 0:00:42
      379500 -- (-1423.271) (-1423.451) [-1421.893] (-1419.109) * [-1421.966] (-1421.508) (-1428.003) (-1421.748) -- 0:00:42
      380000 -- (-1425.568) (-1424.890) [-1421.603] (-1421.517) * (-1424.547) (-1421.643) [-1422.650] (-1424.785) -- 0:00:42

      Average standard deviation of split frequencies: 0.009830

      380500 -- (-1425.472) [-1421.908] (-1423.056) (-1425.176) * (-1422.172) [-1421.129] (-1426.751) (-1420.152) -- 0:00:42
      381000 -- [-1421.620] (-1422.274) (-1424.997) (-1419.760) * (-1422.938) [-1423.657] (-1422.092) (-1421.717) -- 0:00:42
      381500 -- (-1421.074) (-1422.659) [-1421.220] (-1419.611) * (-1421.795) [-1421.930] (-1422.427) (-1421.437) -- 0:00:42
      382000 -- (-1421.799) (-1423.437) [-1421.831] (-1421.124) * [-1421.742] (-1420.884) (-1420.969) (-1425.347) -- 0:00:42
      382500 -- [-1422.629] (-1421.154) (-1419.662) (-1422.790) * (-1421.599) (-1421.419) [-1422.075] (-1421.122) -- 0:00:41
      383000 -- (-1423.775) (-1423.406) (-1422.665) [-1422.199] * (-1424.399) (-1420.037) [-1424.247] (-1421.552) -- 0:00:43
      383500 -- (-1422.209) (-1422.062) [-1423.652] (-1427.621) * (-1423.032) (-1423.542) (-1424.002) [-1423.612] -- 0:00:43
      384000 -- (-1423.482) (-1420.002) [-1425.478] (-1421.802) * [-1422.009] (-1421.262) (-1424.715) (-1427.924) -- 0:00:43
      384500 -- (-1423.271) (-1420.437) (-1423.159) [-1420.055] * (-1422.469) [-1422.190] (-1423.924) (-1423.326) -- 0:00:43
      385000 -- (-1426.789) [-1421.324] (-1423.509) (-1421.013) * (-1421.363) [-1422.583] (-1421.771) (-1421.850) -- 0:00:43

      Average standard deviation of split frequencies: 0.009465

      385500 -- (-1423.838) (-1425.529) (-1424.666) [-1420.353] * (-1422.346) (-1423.344) (-1423.911) [-1425.712] -- 0:00:43
      386000 -- (-1422.487) (-1421.828) [-1428.353] (-1421.800) * (-1420.425) [-1425.236] (-1422.006) (-1423.816) -- 0:00:42
      386500 -- (-1425.391) (-1420.632) (-1423.585) [-1421.452] * [-1422.408] (-1422.736) (-1429.649) (-1424.346) -- 0:00:42
      387000 -- (-1425.688) (-1421.016) (-1423.388) [-1420.234] * [-1421.900] (-1423.856) (-1421.782) (-1422.864) -- 0:00:42
      387500 -- [-1423.683] (-1427.759) (-1424.477) (-1423.225) * [-1427.211] (-1423.183) (-1426.044) (-1421.908) -- 0:00:42
      388000 -- (-1422.010) (-1427.146) (-1423.459) [-1420.512] * (-1423.726) (-1427.577) [-1423.045] (-1425.526) -- 0:00:42
      388500 -- (-1425.499) (-1421.230) (-1423.022) [-1423.541] * (-1425.002) (-1421.293) [-1419.851] (-1422.612) -- 0:00:42
      389000 -- (-1423.207) [-1420.956] (-1420.555) (-1422.495) * (-1424.605) (-1422.319) [-1420.965] (-1423.378) -- 0:00:42
      389500 -- (-1420.970) [-1419.258] (-1424.641) (-1421.147) * [-1423.760] (-1419.984) (-1422.034) (-1426.198) -- 0:00:42
      390000 -- (-1424.038) (-1423.194) [-1424.698] (-1423.405) * (-1424.894) (-1421.842) (-1423.739) [-1421.687] -- 0:00:42

      Average standard deviation of split frequencies: 0.009352

      390500 -- (-1422.303) (-1423.315) [-1422.809] (-1423.903) * (-1424.110) [-1420.782] (-1422.957) (-1421.555) -- 0:00:42
      391000 -- (-1421.622) (-1426.059) [-1421.591] (-1422.318) * [-1423.485] (-1421.786) (-1425.435) (-1421.615) -- 0:00:42
      391500 -- [-1423.378] (-1423.778) (-1419.501) (-1421.001) * [-1422.947] (-1423.654) (-1428.001) (-1422.184) -- 0:00:41
      392000 -- (-1423.953) (-1421.456) (-1422.347) [-1421.844] * (-1422.075) (-1425.586) [-1425.185] (-1425.188) -- 0:00:41
      392500 -- (-1423.872) (-1425.504) (-1420.473) [-1421.530] * [-1421.925] (-1423.927) (-1422.065) (-1424.627) -- 0:00:41
      393000 -- (-1424.106) [-1422.403] (-1423.120) (-1425.808) * [-1422.218] (-1424.354) (-1422.685) (-1422.963) -- 0:00:41
      393500 -- (-1422.344) (-1420.919) [-1421.745] (-1422.232) * (-1421.822) (-1421.867) [-1421.993] (-1425.499) -- 0:00:41
      394000 -- [-1422.358] (-1420.980) (-1423.385) (-1420.359) * (-1425.038) [-1421.299] (-1426.798) (-1425.134) -- 0:00:41
      394500 -- [-1427.218] (-1420.046) (-1427.805) (-1421.424) * (-1423.619) [-1423.348] (-1425.929) (-1421.956) -- 0:00:41
      395000 -- (-1422.199) [-1422.392] (-1421.142) (-1424.150) * [-1426.640] (-1423.753) (-1422.482) (-1424.318) -- 0:00:41

      Average standard deviation of split frequencies: 0.009803

      395500 -- (-1422.252) [-1419.925] (-1420.120) (-1422.062) * [-1426.934] (-1422.401) (-1422.021) (-1424.947) -- 0:00:41
      396000 -- [-1422.640] (-1421.339) (-1421.180) (-1423.532) * (-1423.693) [-1424.309] (-1421.808) (-1421.372) -- 0:00:41
      396500 -- [-1421.046] (-1422.132) (-1421.251) (-1421.690) * [-1425.142] (-1422.388) (-1422.821) (-1424.005) -- 0:00:41
      397000 -- (-1421.960) (-1423.928) [-1422.992] (-1422.732) * (-1423.168) (-1421.623) (-1422.811) [-1421.544] -- 0:00:41
      397500 -- (-1421.363) (-1420.609) [-1421.211] (-1423.641) * [-1421.713] (-1422.457) (-1423.880) (-1425.769) -- 0:00:42
      398000 -- (-1423.245) (-1423.144) [-1420.485] (-1432.354) * (-1423.099) (-1421.924) (-1423.504) [-1420.934] -- 0:00:42
      398500 -- (-1421.771) [-1418.615] (-1420.210) (-1427.450) * (-1426.074) (-1421.657) (-1423.468) [-1423.867] -- 0:00:42
      399000 -- (-1424.353) [-1418.340] (-1424.347) (-1425.425) * (-1427.989) [-1421.311] (-1422.377) (-1426.252) -- 0:00:42
      399500 -- (-1425.590) (-1423.865) (-1421.529) [-1422.652] * [-1422.123] (-1422.082) (-1421.565) (-1426.412) -- 0:00:42
      400000 -- (-1424.797) [-1423.287] (-1420.416) (-1424.994) * (-1421.262) (-1422.765) [-1420.999] (-1429.781) -- 0:00:41

      Average standard deviation of split frequencies: 0.009274

      400500 -- (-1426.119) [-1421.046] (-1422.161) (-1424.610) * (-1422.031) (-1423.087) (-1423.811) [-1422.089] -- 0:00:41
      401000 -- (-1423.701) (-1424.146) [-1421.469] (-1421.688) * (-1422.018) (-1423.524) (-1422.492) [-1422.793] -- 0:00:41
      401500 -- (-1422.583) (-1421.253) (-1424.168) [-1422.318] * [-1423.662] (-1424.643) (-1422.703) (-1420.862) -- 0:00:41
      402000 -- [-1423.287] (-1421.142) (-1427.330) (-1422.812) * (-1423.699) (-1422.544) (-1422.000) [-1422.068] -- 0:00:41
      402500 -- [-1421.696] (-1421.704) (-1422.362) (-1421.892) * (-1421.909) (-1423.000) [-1421.784] (-1422.486) -- 0:00:41
      403000 -- [-1421.469] (-1423.951) (-1422.567) (-1422.152) * [-1425.249] (-1422.379) (-1425.238) (-1426.941) -- 0:00:41
      403500 -- (-1420.880) [-1421.639] (-1423.700) (-1424.452) * (-1422.579) [-1421.611] (-1425.328) (-1420.610) -- 0:00:41
      404000 -- [-1425.690] (-1420.974) (-1422.742) (-1424.057) * (-1422.420) (-1423.352) [-1423.338] (-1421.657) -- 0:00:41
      404500 -- (-1423.009) (-1425.389) [-1422.468] (-1424.719) * (-1422.876) [-1421.539] (-1421.054) (-1425.023) -- 0:00:41
      405000 -- (-1420.964) (-1422.571) [-1421.217] (-1424.876) * (-1422.762) [-1426.437] (-1422.896) (-1422.517) -- 0:00:41

      Average standard deviation of split frequencies: 0.009425

      405500 -- (-1421.929) [-1420.476] (-1422.113) (-1419.119) * (-1419.723) (-1423.686) [-1423.003] (-1426.009) -- 0:00:41
      406000 -- (-1422.525) (-1423.087) (-1422.841) [-1420.744] * [-1422.338] (-1423.153) (-1423.008) (-1424.150) -- 0:00:40
      406500 -- (-1422.629) [-1424.648] (-1421.412) (-1421.750) * (-1422.257) [-1423.302] (-1421.151) (-1424.813) -- 0:00:40
      407000 -- (-1423.009) [-1420.496] (-1421.967) (-1423.457) * (-1420.874) (-1422.590) [-1421.798] (-1422.121) -- 0:00:40
      407500 -- (-1424.052) (-1421.097) (-1420.384) [-1420.704] * (-1421.969) [-1426.609] (-1421.290) (-1420.879) -- 0:00:40
      408000 -- (-1423.198) (-1421.385) [-1422.695] (-1421.501) * (-1423.429) (-1423.068) [-1421.970] (-1421.097) -- 0:00:40
      408500 -- (-1423.367) (-1420.993) [-1424.155] (-1423.473) * (-1426.053) (-1421.794) [-1419.934] (-1420.547) -- 0:00:40
      409000 -- [-1422.505] (-1423.394) (-1420.559) (-1423.827) * (-1422.504) (-1421.616) (-1424.184) [-1421.483] -- 0:00:40
      409500 -- (-1419.115) [-1422.378] (-1419.912) (-1422.044) * (-1423.824) (-1422.194) (-1420.154) [-1421.846] -- 0:00:40
      410000 -- (-1424.367) (-1425.734) (-1418.420) [-1424.689] * (-1427.522) [-1422.912] (-1422.929) (-1421.315) -- 0:00:40

      Average standard deviation of split frequencies: 0.008846

      410500 -- (-1422.995) [-1425.929] (-1422.400) (-1425.868) * [-1424.578] (-1422.894) (-1422.031) (-1420.493) -- 0:00:40
      411000 -- (-1420.183) [-1423.796] (-1420.855) (-1426.761) * (-1422.412) (-1424.290) [-1419.412] (-1425.413) -- 0:00:40
      411500 -- (-1420.863) (-1421.012) [-1421.659] (-1427.932) * (-1425.580) (-1423.247) [-1423.100] (-1422.624) -- 0:00:40
      412000 -- (-1421.322) [-1420.143] (-1420.982) (-1428.454) * (-1422.733) [-1424.926] (-1425.057) (-1422.895) -- 0:00:41
      412500 -- (-1425.961) (-1424.730) (-1422.227) [-1422.839] * [-1421.005] (-1423.502) (-1423.271) (-1422.476) -- 0:00:41
      413000 -- (-1424.077) (-1421.107) [-1420.650] (-1422.427) * (-1424.370) [-1422.801] (-1426.491) (-1423.875) -- 0:00:41
      413500 -- (-1420.430) (-1418.660) [-1422.498] (-1421.370) * (-1426.254) (-1421.736) (-1419.612) [-1422.049] -- 0:00:41
      414000 -- [-1421.984] (-1422.085) (-1420.568) (-1421.845) * (-1422.558) (-1422.392) (-1420.011) [-1422.281] -- 0:00:41
      414500 -- (-1429.958) (-1425.380) [-1419.528] (-1431.186) * (-1422.412) (-1426.864) (-1421.593) [-1421.547] -- 0:00:40
      415000 -- (-1423.999) (-1421.776) (-1422.430) [-1428.740] * (-1423.784) (-1421.506) (-1422.646) [-1421.452] -- 0:00:40

      Average standard deviation of split frequencies: 0.009065

      415500 -- (-1421.535) (-1426.956) (-1424.363) [-1424.963] * (-1422.181) (-1423.974) (-1423.067) [-1421.779] -- 0:00:40
      416000 -- (-1422.416) [-1421.801] (-1419.918) (-1423.181) * (-1424.884) (-1422.937) [-1421.483] (-1422.538) -- 0:00:40
      416500 -- [-1422.190] (-1422.891) (-1421.512) (-1424.386) * [-1423.495] (-1425.303) (-1423.299) (-1424.170) -- 0:00:40
      417000 -- (-1425.345) (-1422.099) (-1421.492) [-1420.633] * (-1424.941) (-1422.746) (-1425.860) [-1424.039] -- 0:00:40
      417500 -- [-1424.311] (-1420.102) (-1420.427) (-1422.330) * (-1423.552) [-1427.453] (-1426.412) (-1420.064) -- 0:00:40
      418000 -- (-1422.233) [-1421.829] (-1418.914) (-1425.754) * (-1422.347) (-1423.643) [-1425.302] (-1420.909) -- 0:00:40
      418500 -- (-1422.254) (-1420.414) [-1419.577] (-1421.344) * (-1420.726) (-1423.279) [-1424.803] (-1423.427) -- 0:00:40
      419000 -- (-1424.183) (-1424.599) (-1427.029) [-1422.496] * [-1422.127] (-1424.677) (-1424.808) (-1422.885) -- 0:00:40
      419500 -- (-1424.589) (-1422.657) (-1421.685) [-1420.856] * (-1421.936) (-1424.496) [-1424.659] (-1422.854) -- 0:00:40
      420000 -- [-1423.168] (-1421.748) (-1424.075) (-1422.458) * (-1421.741) [-1424.095] (-1421.745) (-1420.842) -- 0:00:40

      Average standard deviation of split frequencies: 0.008833

      420500 -- (-1421.770) [-1424.837] (-1422.804) (-1421.556) * (-1420.862) (-1423.863) [-1420.867] (-1423.322) -- 0:00:39
      421000 -- [-1421.375] (-1424.128) (-1422.588) (-1422.081) * (-1421.648) (-1424.428) (-1420.542) [-1419.852] -- 0:00:39
      421500 -- [-1419.649] (-1420.903) (-1422.593) (-1422.167) * (-1424.327) (-1423.561) [-1421.059] (-1420.943) -- 0:00:39
      422000 -- (-1422.169) [-1422.242] (-1423.376) (-1421.648) * (-1423.870) (-1422.382) (-1422.871) [-1422.026] -- 0:00:39
      422500 -- (-1422.227) (-1421.750) (-1421.937) [-1421.001] * (-1424.488) [-1421.826] (-1426.253) (-1425.428) -- 0:00:39
      423000 -- (-1421.602) (-1421.049) [-1425.768] (-1422.137) * (-1421.184) [-1422.102] (-1426.241) (-1421.385) -- 0:00:39
      423500 -- [-1429.191] (-1421.732) (-1426.044) (-1420.292) * [-1421.196] (-1424.132) (-1422.742) (-1422.271) -- 0:00:39
      424000 -- (-1423.061) [-1421.505] (-1421.930) (-1421.134) * (-1424.232) [-1422.684] (-1424.203) (-1420.373) -- 0:00:39
      424500 -- [-1423.792] (-1425.177) (-1422.078) (-1423.848) * (-1421.647) [-1424.533] (-1423.644) (-1427.684) -- 0:00:39
      425000 -- (-1422.753) [-1424.744] (-1424.923) (-1427.286) * (-1425.286) [-1422.097] (-1423.960) (-1424.990) -- 0:00:39

      Average standard deviation of split frequencies: 0.009373

      425500 -- (-1422.171) (-1424.490) (-1424.656) [-1420.453] * (-1422.039) [-1420.513] (-1421.802) (-1419.727) -- 0:00:39
      426000 -- [-1419.113] (-1421.901) (-1424.816) (-1422.535) * (-1426.170) (-1422.226) (-1427.760) [-1419.927] -- 0:00:39
      426500 -- [-1421.329] (-1423.881) (-1423.926) (-1421.179) * [-1424.952] (-1422.959) (-1422.260) (-1419.786) -- 0:00:40
      427000 -- (-1423.980) [-1423.288] (-1420.822) (-1426.099) * (-1425.049) (-1422.511) [-1421.104] (-1421.290) -- 0:00:40
      427500 -- (-1421.630) [-1420.866] (-1420.221) (-1422.098) * (-1426.935) (-1419.465) [-1420.679] (-1421.894) -- 0:00:40
      428000 -- [-1421.934] (-1421.573) (-1421.921) (-1424.080) * (-1428.155) [-1421.469] (-1421.907) (-1422.659) -- 0:00:40
      428500 -- (-1422.612) [-1421.909] (-1429.461) (-1423.184) * (-1419.416) (-1422.088) [-1423.313] (-1422.676) -- 0:00:40
      429000 -- (-1419.457) (-1421.196) (-1426.297) [-1423.225] * [-1424.135] (-1420.453) (-1423.046) (-1425.149) -- 0:00:39
      429500 -- (-1420.403) [-1420.633] (-1422.184) (-1422.131) * (-1427.630) [-1422.841] (-1422.290) (-1423.325) -- 0:00:39
      430000 -- (-1420.128) [-1419.667] (-1422.389) (-1422.826) * (-1426.279) (-1421.374) (-1420.688) [-1421.124] -- 0:00:39

      Average standard deviation of split frequencies: 0.009851

      430500 -- (-1421.836) (-1421.733) [-1422.449] (-1422.348) * [-1424.316] (-1420.477) (-1423.521) (-1419.537) -- 0:00:39
      431000 -- (-1424.757) (-1421.313) [-1422.126] (-1424.985) * [-1422.981] (-1422.582) (-1424.533) (-1422.962) -- 0:00:39
      431500 -- [-1418.495] (-1423.005) (-1419.894) (-1423.985) * [-1419.483] (-1423.258) (-1423.989) (-1423.122) -- 0:00:39
      432000 -- [-1420.431] (-1422.455) (-1423.015) (-1426.325) * (-1423.352) [-1420.568] (-1423.911) (-1422.143) -- 0:00:39
      432500 -- (-1426.898) (-1419.532) (-1424.335) [-1423.290] * (-1422.818) (-1420.055) (-1426.011) [-1420.580] -- 0:00:39
      433000 -- (-1423.319) (-1423.040) (-1421.869) [-1418.990] * (-1424.918) (-1422.583) (-1422.497) [-1419.372] -- 0:00:39
      433500 -- (-1422.704) (-1421.337) (-1422.645) [-1423.018] * (-1421.910) [-1426.082] (-1423.222) (-1422.800) -- 0:00:39
      434000 -- (-1421.078) [-1420.123] (-1427.521) (-1422.196) * (-1424.953) (-1426.761) (-1424.404) [-1423.338] -- 0:00:39
      434500 -- [-1422.570] (-1420.374) (-1422.093) (-1423.283) * (-1420.622) (-1421.674) (-1423.045) [-1421.178] -- 0:00:39
      435000 -- [-1421.017] (-1422.488) (-1421.055) (-1424.463) * [-1421.554] (-1424.727) (-1422.581) (-1422.256) -- 0:00:38

      Average standard deviation of split frequencies: 0.009922

      435500 -- (-1423.292) (-1422.799) (-1424.223) [-1424.865] * [-1421.435] (-1423.141) (-1421.433) (-1421.694) -- 0:00:38
      436000 -- (-1423.380) (-1419.142) (-1419.769) [-1422.165] * (-1424.349) (-1420.783) [-1420.958] (-1421.897) -- 0:00:38
      436500 -- (-1425.733) [-1420.354] (-1421.151) (-1422.460) * (-1426.968) (-1423.253) (-1422.167) [-1422.758] -- 0:00:38
      437000 -- (-1421.185) (-1427.015) [-1421.875] (-1421.819) * (-1424.842) (-1423.338) [-1421.581] (-1421.881) -- 0:00:38
      437500 -- [-1422.745] (-1422.346) (-1425.029) (-1421.268) * (-1423.936) (-1423.977) [-1423.043] (-1421.051) -- 0:00:38
      438000 -- (-1424.175) [-1419.264] (-1424.131) (-1422.775) * [-1420.633] (-1422.399) (-1422.032) (-1422.312) -- 0:00:38
      438500 -- (-1421.883) [-1422.400] (-1423.797) (-1424.959) * (-1422.917) [-1422.613] (-1425.185) (-1421.739) -- 0:00:38
      439000 -- (-1420.722) (-1421.182) [-1420.771] (-1421.313) * (-1425.814) (-1421.937) (-1421.757) [-1422.788] -- 0:00:38
      439500 -- (-1421.595) (-1423.913) [-1421.392] (-1421.306) * (-1427.522) (-1424.350) [-1422.818] (-1422.106) -- 0:00:38
      440000 -- (-1421.622) (-1424.369) [-1422.252] (-1424.366) * (-1424.039) (-1423.949) [-1422.216] (-1423.733) -- 0:00:38

      Average standard deviation of split frequencies: 0.009093

      440500 -- (-1421.347) (-1422.812) [-1421.897] (-1426.652) * [-1422.441] (-1423.031) (-1420.986) (-1425.681) -- 0:00:38
      441000 -- (-1421.761) [-1424.994] (-1421.847) (-1421.509) * (-1423.883) (-1423.151) (-1421.776) [-1421.274] -- 0:00:38
      441500 -- (-1422.208) (-1424.753) (-1422.066) [-1421.581] * (-1422.077) (-1427.428) (-1422.944) [-1422.929] -- 0:00:39
      442000 -- (-1422.416) [-1421.881] (-1424.315) (-1422.081) * [-1423.121] (-1422.605) (-1426.891) (-1425.464) -- 0:00:39
      442500 -- (-1424.220) [-1424.764] (-1422.079) (-1422.108) * [-1421.824] (-1421.301) (-1422.443) (-1420.078) -- 0:00:39
      443000 -- [-1422.001] (-1424.773) (-1424.840) (-1424.319) * [-1422.329] (-1423.358) (-1424.331) (-1423.522) -- 0:00:38
      443500 -- [-1421.501] (-1423.455) (-1421.162) (-1422.433) * [-1422.380] (-1428.307) (-1422.044) (-1422.904) -- 0:00:38
      444000 -- (-1420.153) (-1424.531) (-1421.274) [-1426.665] * (-1423.459) (-1426.211) [-1419.975] (-1422.232) -- 0:00:38
      444500 -- [-1419.676] (-1422.767) (-1420.491) (-1423.197) * (-1420.905) (-1424.507) [-1423.945] (-1421.701) -- 0:00:38
      445000 -- (-1421.126) (-1423.593) (-1424.336) [-1421.548] * (-1422.716) (-1425.618) (-1422.269) [-1421.883] -- 0:00:38

      Average standard deviation of split frequencies: 0.009761

      445500 -- [-1421.416] (-1422.830) (-1423.788) (-1427.068) * (-1421.545) [-1422.724] (-1424.715) (-1425.123) -- 0:00:38
      446000 -- (-1423.353) [-1425.035] (-1424.134) (-1426.673) * [-1426.091] (-1424.228) (-1424.140) (-1423.639) -- 0:00:38
      446500 -- (-1425.471) [-1422.754] (-1424.360) (-1421.929) * (-1422.092) [-1424.613] (-1422.394) (-1423.509) -- 0:00:38
      447000 -- (-1422.157) (-1429.280) (-1422.481) [-1422.286] * [-1419.382] (-1424.148) (-1423.892) (-1421.591) -- 0:00:38
      447500 -- (-1423.277) (-1424.620) (-1423.572) [-1423.414] * [-1422.360] (-1423.100) (-1423.489) (-1423.674) -- 0:00:38
      448000 -- (-1421.938) (-1422.687) [-1425.688] (-1426.392) * (-1423.221) [-1422.490] (-1424.441) (-1423.092) -- 0:00:38
      448500 -- (-1422.092) (-1425.371) (-1425.085) [-1425.747] * (-1419.949) (-1421.881) (-1421.616) [-1424.108] -- 0:00:38
      449000 -- (-1421.427) (-1424.014) (-1422.877) [-1421.364] * [-1421.302] (-1423.242) (-1421.918) (-1423.878) -- 0:00:38
      449500 -- (-1424.654) [-1427.719] (-1421.806) (-1424.003) * (-1421.558) [-1421.450] (-1421.878) (-1426.353) -- 0:00:37
      450000 -- (-1418.482) (-1428.810) [-1422.499] (-1421.882) * (-1424.374) [-1419.808] (-1421.878) (-1421.740) -- 0:00:37

      Average standard deviation of split frequencies: 0.009783

      450500 -- (-1421.960) (-1425.005) [-1421.929] (-1423.665) * (-1422.109) [-1423.356] (-1422.882) (-1423.809) -- 0:00:37
      451000 -- (-1423.292) (-1423.143) (-1421.976) [-1421.513] * (-1423.254) [-1422.118] (-1421.494) (-1421.421) -- 0:00:37
      451500 -- (-1421.537) (-1423.929) (-1423.315) [-1427.086] * (-1419.815) (-1422.543) (-1423.237) [-1423.218] -- 0:00:37
      452000 -- [-1424.158] (-1424.743) (-1426.822) (-1424.602) * (-1419.147) (-1422.468) (-1422.708) [-1422.615] -- 0:00:37
      452500 -- [-1422.950] (-1422.696) (-1423.377) (-1421.621) * (-1421.216) [-1422.826] (-1424.055) (-1421.130) -- 0:00:37
      453000 -- (-1422.377) (-1421.816) (-1421.083) [-1421.496] * [-1422.478] (-1421.041) (-1422.541) (-1422.789) -- 0:00:37
      453500 -- [-1421.237] (-1421.555) (-1421.718) (-1423.991) * (-1423.508) [-1422.682] (-1420.906) (-1425.241) -- 0:00:37
      454000 -- (-1425.010) [-1421.637] (-1424.399) (-1425.021) * (-1421.656) (-1429.067) (-1429.174) [-1428.919] -- 0:00:37
      454500 -- (-1421.802) (-1422.460) [-1421.953] (-1426.022) * (-1422.824) (-1425.711) (-1425.306) [-1427.544] -- 0:00:37
      455000 -- (-1423.119) (-1424.47