--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:51:18 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2614/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -923.42          -927.46
2       -923.36          -927.41
--------------------------------------
TOTAL     -923.39          -927.44
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.886245    0.091007    0.354042    1.476781    0.856829   1370.23   1435.62    1.000
r(A<->C){all}   0.165023    0.020648    0.000045    0.452090    0.123932    126.59    168.83    1.000
r(A<->G){all}   0.168702    0.021566    0.000028    0.459620    0.124966    194.07    260.24    1.001
r(A<->T){all}   0.168678    0.020616    0.000075    0.447774    0.129642    205.10    221.61    1.000
r(C<->G){all}   0.171336    0.020274    0.000167    0.455112    0.137901    167.63    230.82    1.003
r(C<->T){all}   0.153119    0.017409    0.000066    0.409588    0.116758    235.34    239.04    1.000
r(G<->T){all}   0.173143    0.019989    0.000017    0.451005    0.138652    162.67    266.84    1.000
pi(A){all}      0.212814    0.000255    0.181547    0.242384    0.212645   1010.19   1046.96    1.000
pi(C){all}      0.284723    0.000305    0.252523    0.319864    0.284504   1025.06   1118.36    1.000
pi(G){all}      0.300139    0.000314    0.265258    0.333001    0.300031    976.26   1068.46    1.000
pi(T){all}      0.202324    0.000243    0.172453    0.234383    0.202104   1307.60   1320.27    1.000
alpha{1,2}      0.416738    0.232762    0.000150    1.427186    0.243712   1311.05   1364.88    1.001
alpha{3}        0.458253    0.241201    0.000251    1.447010    0.287248   1163.09   1332.05    1.000
pinvar{all}     0.997606    0.000010    0.992225    0.999999    0.998572   1338.65   1354.15    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-884.530304
Model 2: PositiveSelection	-884.530381
Model 0: one-ratio	-884.530405
Model 7: beta	-884.530304
Model 8: beta&w>1	-884.530304


Model 0 vs 1	2.0199999994474638E-4

Model 2 vs 1	1.5400000006593473E-4

Model 8 vs 7	0.0
>C1
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C2
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C3
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C4
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C5
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C6
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=224 

C1              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C2              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C3              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C4              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C5              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C6              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
                **************************************************

C1              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C2              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C3              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C4              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C5              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C6              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
                **************************************************

C1              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C2              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C3              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C4              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C5              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C6              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
                **************************************************

C1              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C2              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C3              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C4              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C5              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C6              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
                **************************************************

C1              HWSLRLDVSDVDGKLMISHLESIR
C2              HWSLRLDVSDVDGKLMISHLESIR
C3              HWSLRLDVSDVDGKLMISHLESIR
C4              HWSLRLDVSDVDGKLMISHLESIR
C5              HWSLRLDVSDVDGKLMISHLESIR
C6              HWSLRLDVSDVDGKLMISHLESIR
                ************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  224 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  224 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6720]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6720]--->[6720]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.487 Mb, Max= 30.772 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C2              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C3              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C4              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C5              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C6              VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
                **************************************************

C1              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C2              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C3              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C4              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C5              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C6              STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
                **************************************************

C1              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C2              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C3              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C4              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C5              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C6              TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
                **************************************************

C1              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C2              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C3              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C4              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C5              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C6              ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
                **************************************************

C1              HWSLRLDVSDVDGKLMISHLESIR
C2              HWSLRLDVSDVDGKLMISHLESIR
C3              HWSLRLDVSDVDGKLMISHLESIR
C4              HWSLRLDVSDVDGKLMISHLESIR
C5              HWSLRLDVSDVDGKLMISHLESIR
C6              HWSLRLDVSDVDGKLMISHLESIR
                ************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
C2              GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
C3              GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
C4              GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
C5              GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
C6              GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
                **************************************************

C1              GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
C2              GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
C3              GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
C4              GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
C5              GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
C6              GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
                **************************************************

C1              CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
C2              CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
C3              CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
C4              CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
C5              CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
C6              CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
                **************************************************

C1              TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
C2              TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
C3              TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
C4              TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
C5              TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
C6              TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
                **************************************************

C1              CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
C2              CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
C3              CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
C4              CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
C5              CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
C6              CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
                **************************************************

C1              ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
C2              ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
C3              ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
C4              ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
C5              ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
C6              ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
                **************************************************

C1              ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
C2              ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
C3              ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
C4              ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
C5              ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
C6              ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
                **************************************************

C1              AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
C2              AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
C3              AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
C4              AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
C5              AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
C6              AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
                **************************************************

C1              TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
C2              TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
C3              TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
C4              TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
C5              TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
C6              TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
                **************************************************

C1              GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
C2              GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
C3              GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
C4              GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
C5              GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
C6              GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
                **************************************************

C1              GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
C2              GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
C3              GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
C4              GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
C5              GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
C6              GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
                **************************************************

C1              TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
C2              TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
C3              TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
C4              TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
C5              TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
C6              TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
                **************************************************

C1              CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
C2              CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
C3              CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
C4              CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
C5              CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
C6              CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
                **************************************************

C1              CTCTCACCTTGAGTCAATCCGA
C2              CTCTCACCTTGAGTCAATCCGA
C3              CTCTCACCTTGAGTCAATCCGA
C4              CTCTCACCTTGAGTCAATCCGA
C5              CTCTCACCTTGAGTCAATCCGA
C6              CTCTCACCTTGAGTCAATCCGA
                **********************



>C1
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C2
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C3
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C4
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C5
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C6
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C1
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C2
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C3
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C4
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C5
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C6
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 672 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859398
      Setting output file names to "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 940442006
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5743920978
      Seed = 589812322
      Swapseed = 1579859398
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1503.968130 -- -24.965149
         Chain 2 -- -1503.967988 -- -24.965149
         Chain 3 -- -1503.968130 -- -24.965149
         Chain 4 -- -1503.968217 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1503.968217 -- -24.965149
         Chain 2 -- -1503.968217 -- -24.965149
         Chain 3 -- -1503.968130 -- -24.965149
         Chain 4 -- -1503.967988 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1503.968] (-1503.968) (-1503.968) (-1503.968) * [-1503.968] (-1503.968) (-1503.968) (-1503.968) 
        500 -- [-932.751] (-935.367) (-935.933) (-931.971) * (-931.712) (-937.830) (-930.582) [-936.382] -- 0:00:00
       1000 -- (-932.432) [-931.876] (-933.434) (-941.189) * (-938.174) (-932.899) [-930.291] (-928.763) -- 0:00:00
       1500 -- (-932.556) (-931.586) (-937.205) [-931.922] * (-936.680) (-932.106) [-929.135] (-928.665) -- 0:00:00
       2000 -- (-937.343) (-938.903) [-928.296] (-931.719) * (-930.815) (-928.950) (-931.641) [-933.492] -- 0:00:00
       2500 -- (-938.162) (-930.350) [-934.149] (-931.664) * [-930.548] (-927.341) (-938.770) (-929.397) -- 0:00:00
       3000 -- [-938.451] (-927.782) (-927.303) (-930.327) * (-935.684) (-930.453) (-930.553) [-935.819] -- 0:00:00
       3500 -- [-932.847] (-932.073) (-926.945) (-935.425) * [-927.141] (-933.363) (-938.403) (-930.046) -- 0:00:00
       4000 -- (-933.006) (-932.252) [-930.286] (-936.591) * (-933.952) [-930.726] (-933.262) (-933.160) -- 0:00:00
       4500 -- (-938.815) (-929.267) (-940.395) [-934.072] * (-936.967) [-931.965] (-938.670) (-934.549) -- 0:00:00
       5000 -- (-930.856) [-934.783] (-932.250) (-932.723) * (-934.080) (-939.242) [-935.135] (-932.406) -- 0:00:00

      Average standard deviation of split frequencies: 0.107137

       5500 -- (-931.307) (-933.330) [-931.444] (-940.793) * [-931.134] (-929.275) (-935.192) (-934.654) -- 0:00:00
       6000 -- (-937.820) [-932.951] (-932.987) (-943.592) * (-943.746) (-933.903) [-931.058] (-928.396) -- 0:00:00
       6500 -- [-933.161] (-927.210) (-931.679) (-930.279) * (-930.084) (-936.581) (-936.761) [-932.241] -- 0:00:00
       7000 -- [-929.475] (-938.098) (-934.910) (-939.343) * (-926.973) (-928.790) [-933.875] (-936.581) -- 0:00:00
       7500 -- (-937.114) [-931.743] (-927.015) (-932.873) * (-939.924) (-930.321) (-930.495) [-934.002] -- 0:00:00
       8000 -- (-934.269) (-938.134) [-930.784] (-925.337) * (-932.212) (-933.461) [-932.312] (-932.989) -- 0:00:00
       8500 -- (-935.793) [-930.369] (-936.385) (-922.410) * (-940.433) (-939.890) [-935.010] (-937.367) -- 0:00:00
       9000 -- (-931.609) (-931.905) [-928.038] (-923.198) * [-930.225] (-942.095) (-938.490) (-939.879) -- 0:00:00
       9500 -- (-931.094) (-935.514) [-925.652] (-923.325) * [-937.112] (-929.994) (-929.833) (-932.116) -- 0:00:00
      10000 -- (-934.987) [-938.081] (-934.608) (-923.404) * (-929.920) (-936.967) [-940.626] (-928.683) -- 0:00:00

      Average standard deviation of split frequencies: 0.061872

      10500 -- (-930.191) (-943.574) (-936.329) [-924.467] * (-937.762) (-936.432) [-933.170] (-930.571) -- 0:00:00
      11000 -- (-940.393) (-940.640) (-932.723) [-923.355] * (-930.526) (-940.474) (-934.742) [-929.841] -- 0:00:00
      11500 -- (-939.351) [-936.579] (-936.432) (-923.559) * (-931.091) (-930.273) (-933.078) [-929.375] -- 0:00:00
      12000 -- (-928.077) [-933.011] (-931.259) (-925.254) * [-930.239] (-930.420) (-934.827) (-939.505) -- 0:00:00
      12500 -- (-934.823) (-939.465) (-938.566) [-923.315] * (-932.475) (-941.017) (-928.779) [-923.989] -- 0:00:00
      13000 -- (-934.345) (-938.801) (-941.338) [-923.473] * (-939.497) (-929.690) [-931.045] (-923.870) -- 0:00:00
      13500 -- [-936.680] (-938.385) (-926.543) (-924.223) * [-934.216] (-933.126) (-940.160) (-923.347) -- 0:00:00
      14000 -- (-935.686) [-933.269] (-923.337) (-925.811) * (-931.273) [-931.604] (-931.584) (-923.554) -- 0:01:10
      14500 -- (-936.089) [-936.847] (-925.378) (-927.893) * (-938.672) (-936.655) [-932.995] (-924.247) -- 0:01:07
      15000 -- (-931.083) [-931.724] (-925.242) (-929.480) * (-931.640) [-936.961] (-935.515) (-924.658) -- 0:01:05

      Average standard deviation of split frequencies: 0.045667

      15500 -- (-953.599) [-931.417] (-923.555) (-930.614) * (-931.201) (-935.833) (-942.547) [-922.874] -- 0:01:03
      16000 -- [-932.231] (-934.618) (-923.006) (-931.835) * (-936.099) (-938.648) [-934.155] (-922.321) -- 0:01:01
      16500 -- (-934.826) (-934.751) [-924.656] (-928.195) * (-933.387) [-928.369] (-938.430) (-923.914) -- 0:00:59
      17000 -- [-939.052] (-938.325) (-923.015) (-924.177) * [-933.328] (-933.909) (-939.926) (-923.265) -- 0:00:57
      17500 -- (-930.736) [-937.626] (-922.094) (-926.515) * (-938.614) (-933.086) (-930.557) [-923.124] -- 0:00:56
      18000 -- (-940.592) [-932.259] (-923.176) (-923.393) * [-929.997] (-930.074) (-923.255) (-923.909) -- 0:00:54
      18500 -- [-929.466] (-931.235) (-922.189) (-923.573) * [-943.570] (-926.721) (-928.066) (-924.933) -- 0:00:53
      19000 -- (-940.351) (-942.625) [-924.370] (-924.872) * (-924.679) (-935.421) [-922.361] (-924.835) -- 0:00:51
      19500 -- (-947.667) [-936.090] (-922.806) (-930.611) * (-923.479) (-935.536) (-927.591) [-924.195] -- 0:00:50
      20000 -- (-932.287) (-931.984) [-922.698] (-924.616) * [-927.335] (-939.598) (-924.627) (-927.911) -- 0:00:49

      Average standard deviation of split frequencies: 0.058165

      20500 -- (-927.099) (-932.228) (-923.986) [-925.216] * (-927.516) [-935.911] (-926.511) (-925.881) -- 0:00:47
      21000 -- [-928.562] (-936.384) (-925.748) (-928.369) * (-923.824) (-938.090) (-923.915) [-924.795] -- 0:00:46
      21500 -- [-932.911] (-941.201) (-923.833) (-927.189) * (-923.928) (-928.221) [-924.461] (-924.575) -- 0:00:45
      22000 -- (-931.386) [-939.905] (-924.631) (-923.411) * (-922.129) (-929.653) [-925.779] (-924.911) -- 0:00:44
      22500 -- (-931.249) (-934.554) [-923.792] (-924.303) * (-922.504) (-937.381) (-922.899) [-922.802] -- 0:00:43
      23000 -- [-929.303] (-937.135) (-924.923) (-923.499) * (-923.070) [-934.261] (-923.985) (-925.597) -- 0:00:42
      23500 -- (-936.659) [-928.737] (-924.372) (-924.177) * (-924.169) [-930.053] (-923.953) (-925.528) -- 0:00:41
      24000 -- (-931.467) [-931.805] (-924.020) (-923.366) * (-923.278) [-931.559] (-923.356) (-926.823) -- 0:00:40
      24500 -- (-934.121) [-938.431] (-924.562) (-924.436) * (-923.038) (-932.495) [-923.050] (-928.564) -- 0:00:39
      25000 -- (-934.950) (-927.947) [-924.749] (-927.035) * [-923.869] (-938.202) (-924.317) (-923.495) -- 0:00:39

      Average standard deviation of split frequencies: 0.054393

      25500 -- (-930.608) [-929.147] (-925.208) (-923.975) * (-926.518) (-933.607) [-925.927] (-922.146) -- 0:00:38
      26000 -- (-936.966) [-926.131] (-926.649) (-922.954) * (-923.598) [-938.667] (-924.242) (-923.490) -- 0:00:37
      26500 -- (-939.373) (-923.826) [-925.767] (-925.354) * [-923.891] (-929.542) (-923.894) (-923.105) -- 0:00:36
      27000 -- (-936.480) [-922.519] (-922.936) (-927.920) * [-923.037] (-934.622) (-926.387) (-926.231) -- 0:00:36
      27500 -- (-937.094) (-923.890) (-925.187) [-926.825] * (-925.131) (-932.250) (-927.357) [-925.765] -- 0:00:35
      28000 -- [-933.727] (-923.739) (-926.237) (-924.591) * [-928.133] (-941.097) (-922.791) (-922.377) -- 0:00:34
      28500 -- [-927.181] (-924.513) (-923.605) (-927.474) * (-922.616) [-933.269] (-924.215) (-922.667) -- 0:00:34
      29000 -- (-931.148) [-925.286] (-924.139) (-927.367) * (-922.738) (-937.467) (-922.482) [-922.430] -- 0:00:33
      29500 -- (-925.443) (-924.777) (-926.159) [-922.156] * (-922.808) (-931.761) [-922.354] (-925.371) -- 0:00:32
      30000 -- (-923.829) (-923.189) (-925.654) [-922.946] * (-922.730) (-931.465) [-922.940] (-924.652) -- 0:00:32

      Average standard deviation of split frequencies: 0.051240

      30500 -- (-923.790) (-925.893) [-922.803] (-924.568) * (-926.511) (-932.591) [-923.632] (-924.063) -- 0:01:03
      31000 -- (-922.596) [-924.276] (-922.587) (-925.109) * (-923.436) [-934.372] (-924.564) (-924.537) -- 0:01:02
      31500 -- [-922.713] (-926.523) (-923.538) (-928.643) * (-925.064) (-937.903) (-924.804) [-929.289] -- 0:01:01
      32000 -- [-925.268] (-926.006) (-927.008) (-923.691) * (-924.798) [-930.272] (-927.285) (-926.120) -- 0:01:00
      32500 -- (-927.123) (-925.730) (-923.320) [-923.579] * (-923.065) [-929.528] (-929.668) (-924.261) -- 0:00:59
      33000 -- (-928.313) (-925.774) (-922.988) [-923.204] * (-922.279) (-935.343) [-922.798] (-924.107) -- 0:00:58
      33500 -- (-923.825) (-925.772) (-923.085) [-923.109] * (-926.410) (-930.897) (-923.602) [-924.416] -- 0:00:57
      34000 -- [-922.247] (-922.816) (-926.199) (-924.226) * (-922.496) (-934.638) (-923.828) [-922.936] -- 0:00:56
      34500 -- (-924.661) [-923.363] (-925.961) (-923.597) * (-922.554) (-933.505) [-924.152] (-923.598) -- 0:00:55
      35000 -- (-923.591) (-923.156) [-924.850] (-924.141) * (-922.546) (-936.230) [-924.367] (-924.962) -- 0:00:55

      Average standard deviation of split frequencies: 0.037101

      35500 -- (-922.991) [-922.916] (-927.247) (-923.345) * (-922.573) (-930.087) [-924.195] (-924.942) -- 0:00:54
      36000 -- (-927.414) [-927.817] (-924.061) (-923.823) * (-924.965) (-937.471) (-926.160) [-925.412] -- 0:00:53
      36500 -- (-928.349) [-929.181] (-925.591) (-924.180) * (-922.101) (-929.860) [-928.400] (-922.724) -- 0:00:52
      37000 -- (-925.831) (-923.391) [-926.968] (-924.081) * (-921.973) (-931.924) [-924.543] (-922.135) -- 0:00:52
      37500 -- [-922.362] (-924.756) (-927.487) (-924.408) * (-927.975) (-930.636) (-922.479) [-922.588] -- 0:00:51
      38000 -- (-926.957) (-922.199) (-925.733) [-925.511] * (-926.240) (-940.441) (-922.849) [-924.940] -- 0:00:50
      38500 -- [-924.508] (-923.722) (-923.342) (-923.729) * (-927.635) [-926.212] (-924.338) (-922.581) -- 0:00:49
      39000 -- (-922.481) (-922.747) [-922.934] (-923.784) * (-924.095) [-930.665] (-923.208) (-924.585) -- 0:00:49
      39500 -- (-923.525) (-924.224) (-925.607) [-923.272] * (-924.201) (-930.664) (-923.802) [-924.626] -- 0:00:48
      40000 -- (-922.361) (-922.505) (-923.030) [-926.400] * (-924.994) [-936.899] (-923.772) (-923.178) -- 0:00:48

      Average standard deviation of split frequencies: 0.034776

      40500 -- [-925.039] (-928.212) (-925.280) (-924.814) * [-923.415] (-933.450) (-923.972) (-923.491) -- 0:00:47
      41000 -- (-927.106) (-924.390) (-922.233) [-922.434] * (-922.919) (-931.447) [-924.455] (-924.186) -- 0:00:46
      41500 -- [-924.144] (-923.033) (-923.161) (-922.616) * (-924.120) (-936.494) [-922.538] (-926.121) -- 0:00:46
      42000 -- (-923.972) (-922.842) [-923.804] (-927.189) * (-923.045) [-936.470] (-924.090) (-925.032) -- 0:00:45
      42500 -- (-924.152) (-923.981) [-923.219] (-925.370) * (-927.215) (-930.933) (-923.682) [-924.535] -- 0:00:45
      43000 -- (-928.993) (-924.138) (-923.206) [-924.951] * (-924.439) (-937.097) (-924.430) [-923.948] -- 0:00:44
      43500 -- (-925.210) (-922.592) [-924.969] (-922.874) * [-921.993] (-935.402) (-927.398) (-925.410) -- 0:00:43
      44000 -- (-923.275) (-925.049) [-924.820] (-923.638) * (-921.863) [-930.817] (-925.289) (-926.781) -- 0:00:43
      44500 -- [-924.345] (-922.958) (-924.227) (-923.925) * (-923.743) (-946.730) [-923.180] (-924.063) -- 0:00:42
      45000 -- [-924.244] (-923.471) (-927.176) (-925.803) * [-922.005] (-935.284) (-923.473) (-923.107) -- 0:00:42

      Average standard deviation of split frequencies: 0.035868

      45500 -- (-922.482) (-923.101) [-923.534] (-926.436) * (-925.461) (-935.029) [-922.154] (-923.402) -- 0:00:41
      46000 -- (-922.871) [-923.321] (-923.776) (-929.018) * (-930.963) (-931.435) [-922.157] (-922.783) -- 0:00:41
      46500 -- [-924.087] (-923.661) (-925.057) (-923.220) * [-922.167] (-935.426) (-925.211) (-923.122) -- 0:01:01
      47000 -- [-923.763] (-923.470) (-927.333) (-923.198) * (-921.889) (-933.688) (-924.164) [-922.944] -- 0:01:00
      47500 -- (-923.415) (-924.310) [-924.261] (-923.907) * (-930.392) (-937.259) (-930.145) [-922.357] -- 0:01:00
      48000 -- (-926.320) [-922.828] (-922.437) (-923.714) * (-922.802) [-935.556] (-927.593) (-924.729) -- 0:00:59
      48500 -- (-926.598) (-922.389) [-925.406] (-923.879) * [-923.442] (-942.372) (-927.861) (-925.058) -- 0:00:58
      49000 -- (-926.178) [-923.061] (-925.137) (-925.814) * (-923.526) (-940.356) [-924.622] (-924.380) -- 0:00:58
      49500 -- (-926.209) (-922.827) [-928.489] (-924.516) * (-922.738) [-923.441] (-926.314) (-925.403) -- 0:00:57
      50000 -- (-922.871) [-922.820] (-925.118) (-923.922) * (-922.321) (-923.343) (-925.487) [-928.060] -- 0:00:57

      Average standard deviation of split frequencies: 0.035257

      50500 -- [-922.093] (-922.237) (-924.278) (-927.139) * (-923.419) (-924.878) [-923.758] (-924.392) -- 0:00:56
      51000 -- [-922.940] (-926.121) (-928.108) (-923.146) * (-926.119) [-924.316] (-925.813) (-923.453) -- 0:00:55
      51500 -- (-924.947) [-924.868] (-925.522) (-924.319) * (-930.687) (-923.641) (-922.991) [-925.342] -- 0:00:55
      52000 -- [-923.800] (-925.479) (-925.893) (-924.427) * (-928.472) (-922.525) [-923.691] (-930.550) -- 0:00:54
      52500 -- (-925.126) (-924.102) [-922.988] (-925.438) * (-923.626) [-925.494] (-923.531) (-925.139) -- 0:00:54
      53000 -- (-923.532) (-923.544) [-923.637] (-924.812) * (-923.454) [-924.794] (-922.300) (-925.388) -- 0:00:53
      53500 -- (-926.101) (-925.067) (-926.609) [-923.999] * (-923.588) [-926.015] (-923.420) (-923.909) -- 0:00:53
      54000 -- [-924.038] (-927.632) (-924.039) (-923.052) * [-922.822] (-926.947) (-923.397) (-923.858) -- 0:00:52
      54500 -- [-926.249] (-925.577) (-923.682) (-924.042) * (-927.751) [-924.430] (-924.212) (-922.800) -- 0:00:52
      55000 -- [-923.606] (-922.855) (-924.426) (-924.144) * (-928.788) (-924.260) (-922.017) [-924.164] -- 0:00:51

      Average standard deviation of split frequencies: 0.037216

      55500 -- [-924.577] (-926.351) (-922.559) (-923.547) * (-925.144) (-922.310) [-922.154] (-923.036) -- 0:00:51
      56000 -- (-926.578) [-923.089] (-922.519) (-927.958) * (-924.557) (-923.042) (-926.600) [-923.642] -- 0:00:50
      56500 -- (-927.217) (-924.249) (-923.316) [-922.779] * [-923.619] (-923.437) (-926.136) (-923.475) -- 0:00:50
      57000 -- (-922.246) (-924.946) (-924.302) [-923.320] * (-923.587) (-926.156) (-924.524) [-923.681] -- 0:00:49
      57500 -- [-924.034] (-925.540) (-923.306) (-922.035) * (-925.401) (-923.275) (-928.412) [-928.911] -- 0:00:49
      58000 -- (-929.404) (-926.293) (-924.723) [-922.197] * (-927.570) (-924.946) [-922.774] (-926.523) -- 0:00:48
      58500 -- (-926.985) [-925.985] (-924.162) (-921.850) * (-924.260) [-925.894] (-923.642) (-924.468) -- 0:00:48
      59000 -- (-928.197) [-923.137] (-924.945) (-922.396) * (-929.397) (-923.828) [-923.108] (-923.958) -- 0:00:47
      59500 -- (-922.340) [-922.555] (-923.641) (-922.984) * (-930.434) (-922.793) (-922.788) [-923.995] -- 0:00:47
      60000 -- (-922.929) (-922.671) (-924.538) [-924.313] * (-923.781) [-923.308] (-922.603) (-923.366) -- 0:00:47

      Average standard deviation of split frequencies: 0.027585

      60500 -- (-927.359) (-922.663) (-923.408) [-923.499] * [-925.078] (-922.616) (-925.341) (-923.402) -- 0:00:46
      61000 -- [-925.854] (-922.843) (-923.296) (-925.111) * (-924.368) [-923.889] (-923.653) (-922.964) -- 0:00:46
      61500 -- (-924.398) (-923.719) (-922.211) [-924.724] * [-926.725] (-923.022) (-923.451) (-923.052) -- 0:00:45
      62000 -- (-923.365) [-922.155] (-922.968) (-923.754) * [-924.300] (-922.961) (-924.030) (-922.411) -- 0:00:45
      62500 -- (-925.471) (-924.362) [-923.991] (-922.465) * [-927.015] (-922.523) (-923.515) (-922.462) -- 0:00:45
      63000 -- [-926.174] (-922.269) (-924.237) (-924.297) * (-924.433) [-923.826] (-923.784) (-925.670) -- 0:00:44
      63500 -- (-922.803) (-922.298) [-926.604] (-924.824) * (-923.678) [-925.921] (-925.445) (-924.536) -- 0:00:58
      64000 -- (-926.404) (-923.413) (-922.844) [-922.589] * [-925.379] (-928.234) (-928.544) (-924.625) -- 0:00:58
      64500 -- (-923.858) (-922.547) (-924.680) [-923.941] * (-925.877) [-924.694] (-925.541) (-929.042) -- 0:00:58
      65000 -- (-923.544) [-922.603] (-924.619) (-923.011) * (-924.509) [-924.329] (-924.911) (-925.262) -- 0:00:57

      Average standard deviation of split frequencies: 0.028230

      65500 -- (-927.867) [-923.700] (-927.830) (-925.126) * (-927.544) (-923.157) [-925.104] (-925.529) -- 0:00:57
      66000 -- (-924.458) (-924.053) (-925.834) [-924.212] * (-924.713) (-922.076) [-924.470] (-924.093) -- 0:00:56
      66500 -- (-923.396) (-924.662) (-925.005) [-924.906] * (-923.076) (-922.181) [-924.277] (-925.036) -- 0:00:56
      67000 -- (-924.144) [-924.271] (-926.015) (-927.396) * (-926.320) (-922.375) (-922.281) [-922.477] -- 0:00:55
      67500 -- (-923.419) (-925.560) [-923.264] (-925.584) * (-926.167) (-925.227) (-922.388) [-922.296] -- 0:00:55
      68000 -- (-926.216) [-925.033] (-924.307) (-925.545) * (-924.202) [-926.452] (-922.511) (-925.176) -- 0:00:54
      68500 -- (-928.527) [-924.923] (-922.101) (-927.127) * (-926.283) (-923.767) (-924.166) [-926.159] -- 0:00:54
      69000 -- (-926.154) (-927.882) (-926.061) [-922.279] * (-928.241) (-926.573) (-924.100) [-923.905] -- 0:00:53
      69500 -- (-923.154) (-925.614) (-924.318) [-926.140] * (-923.364) (-926.352) [-927.111] (-922.429) -- 0:00:53
      70000 -- (-925.300) [-924.184] (-922.022) (-924.684) * (-925.584) (-925.015) (-923.383) [-925.782] -- 0:00:53

      Average standard deviation of split frequencies: 0.029352

      70500 -- (-923.914) (-923.232) (-924.334) [-924.998] * (-923.350) [-924.284] (-925.626) (-926.372) -- 0:00:52
      71000 -- [-923.504] (-925.450) (-925.657) (-925.514) * [-923.257] (-924.137) (-926.596) (-929.521) -- 0:00:52
      71500 -- (-924.039) (-924.123) [-922.049] (-923.666) * (-924.096) (-925.168) [-928.766] (-929.619) -- 0:00:51
      72000 -- (-923.830) (-926.072) (-923.579) [-926.801] * (-928.070) (-925.519) [-924.062] (-925.878) -- 0:00:51
      72500 -- (-924.233) (-925.832) (-923.636) [-924.874] * [-924.909] (-923.435) (-923.900) (-924.111) -- 0:00:51
      73000 -- [-926.306] (-923.167) (-924.205) (-922.755) * (-925.377) (-923.426) [-923.891] (-926.369) -- 0:00:50
      73500 -- [-923.693] (-923.975) (-922.586) (-924.803) * (-924.664) (-923.246) [-924.416] (-925.676) -- 0:00:50
      74000 -- (-927.416) (-923.897) [-924.944] (-922.658) * [-922.729] (-923.761) (-924.712) (-927.249) -- 0:00:50
      74500 -- (-923.258) (-922.254) (-925.770) [-922.549] * (-924.579) (-924.201) [-922.435] (-928.125) -- 0:00:49
      75000 -- (-927.261) (-924.385) (-924.068) [-922.800] * (-924.164) (-924.629) [-923.676] (-928.300) -- 0:00:49

      Average standard deviation of split frequencies: 0.024501

      75500 -- [-923.577] (-925.594) (-924.455) (-925.013) * (-926.325) (-923.265) (-927.000) [-923.195] -- 0:00:48
      76000 -- (-924.605) (-924.151) (-923.714) [-924.095] * (-923.045) [-927.424] (-924.216) (-923.094) -- 0:00:48
      76500 -- [-927.932] (-923.056) (-922.708) (-923.015) * (-925.193) (-924.837) (-922.927) [-924.420] -- 0:00:48
      77000 -- [-926.310] (-924.125) (-923.840) (-923.989) * [-923.537] (-925.422) (-923.946) (-923.779) -- 0:00:47
      77500 -- [-924.811] (-923.547) (-922.442) (-926.352) * (-923.039) (-923.822) [-923.803] (-925.375) -- 0:00:47
      78000 -- (-922.468) (-923.243) (-926.869) [-923.593] * [-925.075] (-923.012) (-924.784) (-927.044) -- 0:00:47
      78500 -- [-925.033] (-923.603) (-922.074) (-923.187) * [-925.088] (-923.411) (-927.183) (-929.997) -- 0:00:46
      79000 -- (-924.933) (-923.045) (-923.785) [-925.803] * (-922.597) (-922.950) (-932.423) [-923.329] -- 0:00:46
      79500 -- (-923.052) (-922.575) [-922.621] (-928.286) * (-923.628) [-923.004] (-925.785) (-925.370) -- 0:00:57
      80000 -- (-922.495) (-922.856) [-923.966] (-926.209) * (-922.446) [-924.363] (-923.977) (-922.615) -- 0:00:57

      Average standard deviation of split frequencies: 0.023668

      80500 -- (-922.906) (-925.888) (-922.059) [-923.378] * [-922.708] (-926.636) (-924.219) (-923.804) -- 0:00:57
      81000 -- [-928.606] (-922.841) (-924.964) (-923.374) * (-922.530) (-924.108) [-924.438] (-925.576) -- 0:00:56
      81500 -- [-924.956] (-923.045) (-929.048) (-922.005) * (-923.200) (-926.249) [-924.376] (-925.143) -- 0:00:56
      82000 -- (-923.806) (-923.457) (-926.332) [-923.524] * (-926.406) [-926.256] (-928.992) (-924.105) -- 0:00:55
      82500 -- (-925.026) [-923.827] (-927.060) (-922.525) * (-925.218) (-926.265) (-923.326) [-922.830] -- 0:00:55
      83000 -- (-928.845) [-924.888] (-926.572) (-923.054) * (-924.705) [-923.292] (-923.922) (-923.231) -- 0:00:55
      83500 -- (-929.491) [-924.139] (-922.297) (-927.970) * [-926.002] (-925.144) (-924.235) (-926.790) -- 0:00:54
      84000 -- (-924.510) [-928.555] (-922.854) (-930.139) * (-922.668) [-925.169] (-923.090) (-924.518) -- 0:00:54
      84500 -- (-922.974) [-924.479] (-925.639) (-925.873) * (-922.491) (-923.988) [-924.342] (-924.002) -- 0:00:54
      85000 -- (-923.247) (-926.948) [-924.064] (-925.906) * [-927.721] (-926.442) (-926.284) (-925.269) -- 0:00:53

      Average standard deviation of split frequencies: 0.020830

      85500 -- (-922.716) (-923.430) [-922.560] (-923.963) * (-922.290) [-925.726] (-923.795) (-925.163) -- 0:00:53
      86000 -- (-922.868) [-924.166] (-928.193) (-924.915) * (-923.554) (-922.653) [-924.055] (-922.781) -- 0:00:53
      86500 -- [-924.708] (-923.120) (-922.734) (-928.226) * (-926.244) [-922.389] (-923.139) (-926.523) -- 0:00:52
      87000 -- [-923.055] (-922.485) (-924.228) (-925.040) * [-923.529] (-922.985) (-924.267) (-925.881) -- 0:00:52
      87500 -- [-925.458] (-924.541) (-925.889) (-926.685) * (-923.570) (-924.586) (-929.422) [-923.860] -- 0:00:52
      88000 -- (-925.791) (-924.023) (-926.121) [-924.357] * (-923.558) [-923.251] (-927.255) (-923.763) -- 0:00:51
      88500 -- (-923.791) (-927.248) (-924.226) [-924.521] * (-923.408) (-924.744) [-922.421] (-923.536) -- 0:00:51
      89000 -- (-923.116) [-925.593] (-922.289) (-924.142) * (-924.182) [-926.518] (-923.711) (-923.363) -- 0:00:51
      89500 -- (-923.623) (-927.083) (-926.288) [-924.203] * (-922.836) [-925.144] (-930.291) (-926.131) -- 0:00:50
      90000 -- [-924.341] (-926.186) (-924.493) (-925.212) * (-922.407) [-923.256] (-927.726) (-923.452) -- 0:00:50

      Average standard deviation of split frequencies: 0.022357

      90500 -- (-923.252) (-924.525) (-924.795) [-922.421] * (-924.694) (-924.236) (-927.131) [-925.974] -- 0:00:50
      91000 -- [-927.870] (-924.332) (-923.925) (-924.579) * (-925.104) (-926.719) (-924.201) [-924.677] -- 0:00:49
      91500 -- [-925.300] (-925.623) (-924.564) (-928.296) * [-924.344] (-923.701) (-924.462) (-921.799) -- 0:00:49
      92000 -- (-924.681) [-928.474] (-925.891) (-924.045) * (-924.232) (-922.822) (-924.732) [-924.090] -- 0:00:49
      92500 -- (-923.824) (-928.724) [-925.709] (-928.396) * (-926.057) [-924.387] (-928.788) (-924.689) -- 0:00:49
      93000 -- (-923.677) [-928.250] (-927.531) (-927.285) * (-926.851) (-922.967) [-924.278] (-924.045) -- 0:00:48
      93500 -- [-922.795] (-928.222) (-923.343) (-924.232) * [-922.348] (-924.102) (-923.076) (-922.287) -- 0:00:48
      94000 -- (-922.125) [-925.295] (-925.331) (-929.202) * (-924.918) (-928.935) (-924.989) [-921.959] -- 0:00:48
      94500 -- [-927.284] (-923.576) (-924.669) (-924.383) * [-925.488] (-924.305) (-923.190) (-922.509) -- 0:00:47
      95000 -- (-926.847) (-923.625) [-924.327] (-922.578) * (-922.591) [-923.013] (-924.024) (-922.239) -- 0:00:47

      Average standard deviation of split frequencies: 0.023570

      95500 -- (-928.146) (-923.775) (-927.277) [-922.401] * (-923.114) [-923.739] (-922.708) (-922.239) -- 0:00:47
      96000 -- (-925.041) [-926.020] (-923.383) (-923.077) * (-926.580) [-921.773] (-923.337) (-922.307) -- 0:00:56
      96500 -- (-924.281) (-925.171) (-924.482) [-925.896] * [-925.603] (-925.641) (-925.969) (-922.669) -- 0:00:56
      97000 -- [-926.203] (-924.923) (-923.827) (-923.723) * (-923.045) (-925.732) [-923.024] (-926.276) -- 0:00:55
      97500 -- (-922.012) (-924.125) (-928.453) [-923.749] * [-922.166] (-923.180) (-923.786) (-928.086) -- 0:00:55
      98000 -- (-921.859) (-927.443) (-924.528) [-924.826] * [-923.697] (-922.527) (-924.756) (-922.777) -- 0:00:55
      98500 -- (-922.133) (-923.832) [-925.354] (-926.767) * (-922.631) (-924.184) [-924.839] (-925.236) -- 0:00:54
      99000 -- (-923.829) [-922.332] (-923.382) (-929.174) * (-926.610) (-925.767) [-923.787] (-924.243) -- 0:00:54
      99500 -- (-924.201) [-924.900] (-924.011) (-927.768) * (-927.857) (-923.178) (-926.083) [-923.067] -- 0:00:54
      100000 -- [-923.554] (-922.516) (-924.983) (-923.472) * (-932.207) (-924.717) [-921.758] (-926.692) -- 0:00:54

      Average standard deviation of split frequencies: 0.023168

      100500 -- (-926.850) (-922.794) (-923.738) [-924.107] * (-924.410) [-924.411] (-922.090) (-926.766) -- 0:00:53
      101000 -- (-922.548) [-923.748] (-924.527) (-922.758) * (-923.247) [-922.891] (-924.589) (-922.620) -- 0:00:53
      101500 -- (-923.972) [-923.741] (-923.284) (-922.133) * [-922.978] (-923.133) (-924.038) (-922.988) -- 0:00:53
      102000 -- (-925.722) (-925.120) [-922.848] (-924.205) * [-924.413] (-922.837) (-923.948) (-923.197) -- 0:00:52
      102500 -- (-927.054) [-928.640] (-923.049) (-924.280) * (-925.697) (-922.825) (-922.693) [-922.864] -- 0:00:52
      103000 -- (-927.512) [-923.467] (-922.495) (-923.196) * (-924.788) (-922.737) (-923.014) [-924.111] -- 0:00:52
      103500 -- [-926.681] (-925.538) (-923.658) (-925.943) * (-924.416) (-928.108) [-923.191] (-926.528) -- 0:00:51
      104000 -- (-922.823) (-925.924) (-924.075) [-923.961] * (-923.008) (-923.056) (-923.438) [-923.549] -- 0:00:51
      104500 -- (-924.428) (-926.067) [-925.487] (-924.221) * (-923.643) (-926.578) (-924.456) [-921.877] -- 0:00:51
      105000 -- (-925.134) (-928.486) [-927.126] (-923.985) * (-926.151) [-922.747] (-926.513) (-923.780) -- 0:00:51

      Average standard deviation of split frequencies: 0.023406

      105500 -- (-928.866) (-928.483) (-924.201) [-923.257] * [-925.578] (-922.557) (-927.618) (-922.628) -- 0:00:50
      106000 -- (-926.002) (-928.994) (-929.158) [-926.115] * (-922.911) (-926.425) (-927.082) [-923.873] -- 0:00:50
      106500 -- [-923.704] (-928.388) (-924.059) (-928.421) * (-923.438) (-927.190) [-926.808] (-923.036) -- 0:00:50
      107000 -- (-924.148) [-923.323] (-925.014) (-933.660) * [-923.382] (-923.191) (-925.015) (-923.124) -- 0:00:50
      107500 -- [-923.029] (-924.034) (-923.711) (-930.272) * (-925.656) (-925.955) (-923.998) [-925.441] -- 0:00:49
      108000 -- (-923.310) [-923.055] (-925.206) (-923.315) * [-927.808] (-925.407) (-925.220) (-926.127) -- 0:00:49
      108500 -- (-922.987) (-922.434) (-929.983) [-922.467] * (-926.442) (-924.791) [-924.896] (-925.603) -- 0:00:49
      109000 -- [-922.741] (-922.778) (-925.065) (-923.308) * (-924.307) (-927.859) (-925.088) [-922.310] -- 0:00:49
      109500 -- (-923.989) (-922.211) (-924.802) [-922.075] * [-923.689] (-929.309) (-924.110) (-922.937) -- 0:00:56
      110000 -- (-932.234) [-922.385] (-924.135) (-926.352) * (-922.140) [-927.595] (-925.732) (-922.547) -- 0:00:56

      Average standard deviation of split frequencies: 0.024213

      110500 -- (-927.040) (-925.473) [-922.445] (-925.485) * (-923.920) (-925.573) (-926.230) [-924.272] -- 0:00:56
      111000 -- [-929.508] (-925.102) (-924.827) (-926.061) * (-923.631) (-924.426) (-927.786) [-922.298] -- 0:00:56
      111500 -- (-925.945) [-922.983] (-925.291) (-931.211) * (-922.141) (-924.869) [-922.592] (-923.441) -- 0:00:55
      112000 -- [-923.435] (-924.595) (-928.369) (-923.528) * (-922.005) (-924.499) [-924.654] (-923.270) -- 0:00:55
      112500 -- (-922.975) (-924.101) (-924.312) [-922.089] * [-922.296] (-924.916) (-927.446) (-923.164) -- 0:00:55
      113000 -- (-921.879) [-927.366] (-922.890) (-923.298) * [-923.187] (-923.533) (-925.399) (-925.258) -- 0:00:54
      113500 -- (-924.404) [-924.967] (-922.375) (-926.664) * (-923.281) (-925.762) [-922.333] (-922.835) -- 0:00:54
      114000 -- (-925.188) (-923.528) (-922.564) [-924.102] * (-928.378) (-926.909) [-922.421] (-922.684) -- 0:00:54
      114500 -- (-922.781) [-921.996] (-923.733) (-927.355) * [-926.346] (-925.648) (-925.735) (-926.153) -- 0:00:54
      115000 -- [-926.685] (-926.684) (-924.412) (-924.817) * (-924.453) (-922.787) (-924.842) [-923.683] -- 0:00:53

      Average standard deviation of split frequencies: 0.022803

      115500 -- (-929.365) (-922.514) (-928.388) [-925.263] * [-925.422] (-924.337) (-928.292) (-933.614) -- 0:00:53
      116000 -- (-924.812) (-923.092) (-925.977) [-924.082] * [-925.073] (-926.823) (-923.610) (-922.533) -- 0:00:53
      116500 -- [-922.999] (-923.580) (-923.379) (-922.589) * (-926.359) [-924.643] (-924.170) (-923.418) -- 0:00:53
      117000 -- (-923.537) [-923.406] (-924.140) (-922.962) * (-924.837) [-922.871] (-921.882) (-925.239) -- 0:00:52
      117500 -- (-925.755) [-922.239] (-923.006) (-922.300) * (-924.441) (-924.847) (-922.772) [-922.731] -- 0:00:52
      118000 -- [-925.581] (-924.306) (-925.248) (-923.079) * (-922.032) (-925.270) [-924.932] (-922.832) -- 0:00:52
      118500 -- [-922.312] (-923.873) (-924.774) (-922.107) * (-922.874) (-925.656) [-922.171] (-923.534) -- 0:00:52
      119000 -- (-923.318) (-924.056) [-922.777] (-925.136) * (-924.353) (-925.750) (-922.290) [-924.254] -- 0:00:51
      119500 -- (-924.028) (-924.278) [-923.271] (-923.230) * (-924.544) (-923.310) (-924.146) [-923.964] -- 0:00:51
      120000 -- (-922.993) [-923.940] (-922.520) (-922.875) * (-923.850) (-923.233) (-929.097) [-922.697] -- 0:00:51

      Average standard deviation of split frequencies: 0.023874

      120500 -- (-921.971) (-924.330) (-924.336) [-924.898] * (-925.716) (-924.215) (-923.805) [-922.740] -- 0:00:51
      121000 -- (-922.115) (-924.374) [-924.055] (-922.675) * (-927.214) (-923.936) [-923.390] (-928.599) -- 0:00:50
      121500 -- (-925.729) [-926.722] (-925.177) (-922.604) * (-926.703) (-924.792) [-922.954] (-924.782) -- 0:00:50
      122000 -- (-926.361) (-925.471) (-921.984) [-923.545] * (-923.513) [-924.349] (-924.337) (-924.326) -- 0:00:50
      122500 -- (-927.625) (-922.866) [-922.210] (-922.631) * (-923.781) (-924.861) (-925.227) [-923.190] -- 0:00:57
      123000 -- (-923.676) [-922.609] (-925.161) (-923.401) * (-931.006) (-924.703) [-923.985] (-925.651) -- 0:00:57
      123500 -- [-924.646] (-923.851) (-924.242) (-926.687) * (-927.541) (-923.214) [-924.864] (-924.391) -- 0:00:56
      124000 -- (-927.280) (-922.247) [-923.842] (-925.220) * (-924.810) (-929.329) [-923.957] (-926.732) -- 0:00:56
      124500 -- (-922.761) (-923.119) [-922.872] (-926.099) * (-924.328) (-922.096) (-923.912) [-925.154] -- 0:00:56
      125000 -- (-922.955) (-923.747) (-927.165) [-924.365] * (-926.589) (-923.408) [-922.766] (-923.930) -- 0:00:56

      Average standard deviation of split frequencies: 0.024506

      125500 -- [-923.708] (-923.023) (-922.108) (-922.007) * [-928.091] (-923.452) (-922.638) (-924.524) -- 0:00:55
      126000 -- (-923.527) [-923.617] (-925.641) (-923.952) * (-926.384) (-923.466) [-923.194] (-924.578) -- 0:00:55
      126500 -- (-922.676) (-921.735) [-923.970] (-922.357) * (-924.473) (-923.923) [-924.181] (-923.215) -- 0:00:55
      127000 -- (-926.917) [-922.572] (-925.723) (-922.436) * (-924.780) [-923.732] (-924.327) (-922.676) -- 0:00:54
      127500 -- (-922.944) [-925.927] (-924.691) (-922.801) * (-926.716) (-924.464) (-923.704) [-924.864] -- 0:00:54
      128000 -- (-924.097) [-925.917] (-926.321) (-923.376) * [-924.000] (-922.258) (-923.605) (-926.362) -- 0:00:54
      128500 -- [-922.865] (-922.672) (-925.047) (-922.655) * (-922.836) (-924.296) (-923.424) [-924.173] -- 0:00:54
      129000 -- (-924.018) (-923.943) [-923.600] (-923.963) * (-923.526) (-924.730) [-922.557] (-926.086) -- 0:00:54
      129500 -- [-922.512] (-929.203) (-923.716) (-924.788) * [-924.847] (-922.833) (-922.979) (-923.939) -- 0:00:53
      130000 -- (-925.551) [-926.100] (-924.508) (-924.090) * (-923.083) (-923.276) [-923.668] (-925.183) -- 0:00:53

      Average standard deviation of split frequencies: 0.021285

      130500 -- (-926.505) (-924.729) (-925.997) [-924.015] * (-926.960) (-923.529) [-923.682] (-926.006) -- 0:00:53
      131000 -- (-926.238) (-927.781) (-923.642) [-922.630] * (-930.626) [-924.894] (-923.817) (-924.564) -- 0:00:53
      131500 -- (-926.687) (-923.361) (-924.531) [-922.356] * (-925.547) (-924.815) (-922.992) [-926.425] -- 0:00:52
      132000 -- [-923.018] (-924.183) (-925.746) (-923.369) * [-922.350] (-923.437) (-924.520) (-925.145) -- 0:00:52
      132500 -- (-922.961) (-924.311) (-924.039) [-922.356] * (-923.796) (-923.724) [-922.672] (-921.968) -- 0:00:52
      133000 -- (-923.898) (-925.212) (-923.229) [-922.361] * (-924.407) (-923.607) [-922.851] (-923.393) -- 0:00:52
      133500 -- (-928.426) [-923.480] (-924.377) (-927.036) * (-924.783) [-923.179] (-925.235) (-924.792) -- 0:00:51
      134000 -- [-924.835] (-923.521) (-925.186) (-922.665) * [-924.014] (-929.409) (-924.985) (-922.389) -- 0:00:51
      134500 -- (-924.609) (-922.432) [-924.088] (-923.779) * [-927.295] (-924.261) (-924.784) (-923.262) -- 0:00:51
      135000 -- (-924.440) (-926.520) [-925.575] (-923.323) * (-927.187) (-922.043) (-925.497) [-927.857] -- 0:00:57

      Average standard deviation of split frequencies: 0.023716

      135500 -- (-925.069) (-924.841) (-925.595) [-922.477] * (-923.214) (-923.729) (-922.645) [-922.058] -- 0:00:57
      136000 -- (-925.868) (-925.266) [-923.967] (-923.252) * (-924.089) [-923.714] (-922.648) (-922.270) -- 0:00:57
      136500 -- (-923.031) [-923.914] (-925.033) (-923.198) * [-924.132] (-922.553) (-926.610) (-924.913) -- 0:00:56
      137000 -- (-922.831) [-925.031] (-924.809) (-927.959) * (-927.471) (-923.452) (-923.785) [-923.027] -- 0:00:56
      137500 -- (-924.053) [-923.561] (-923.207) (-924.254) * (-932.126) (-922.261) (-923.563) [-925.357] -- 0:00:56
      138000 -- (-924.755) (-924.888) (-922.469) [-933.390] * (-924.112) (-924.017) [-924.661] (-926.001) -- 0:00:56
      138500 -- (-923.278) (-926.216) (-923.790) [-922.665] * [-922.715] (-924.961) (-922.640) (-924.185) -- 0:00:55
      139000 -- (-923.278) (-926.008) [-922.763] (-924.956) * [-922.708] (-924.298) (-924.160) (-925.625) -- 0:00:55
      139500 -- (-922.869) (-927.428) (-922.779) [-929.030] * (-923.035) (-923.883) (-923.581) [-922.794] -- 0:00:55
      140000 -- (-928.361) [-927.206] (-923.167) (-924.076) * (-922.248) (-921.863) [-924.520] (-930.050) -- 0:00:55

      Average standard deviation of split frequencies: 0.023988

      140500 -- (-928.421) [-928.841] (-923.487) (-922.272) * (-924.225) (-922.651) [-922.883] (-927.683) -- 0:00:55
      141000 -- [-924.222] (-931.586) (-922.837) (-923.199) * (-931.994) [-924.590] (-921.892) (-928.044) -- 0:00:54
      141500 -- [-923.240] (-925.906) (-922.992) (-923.779) * (-926.300) [-923.011] (-923.635) (-925.346) -- 0:00:54
      142000 -- [-923.262] (-923.767) (-923.801) (-923.833) * (-925.003) (-923.544) (-922.855) [-924.652] -- 0:00:54
      142500 -- (-932.542) (-923.415) (-923.003) [-924.163] * (-924.320) (-926.286) [-923.501] (-923.494) -- 0:00:54
      143000 -- (-928.326) [-923.948] (-926.484) (-923.413) * (-924.274) [-925.945] (-924.148) (-924.164) -- 0:00:53
      143500 -- (-926.537) (-924.010) (-924.156) [-924.695] * [-923.269] (-923.675) (-924.118) (-924.261) -- 0:00:53
      144000 -- (-924.314) (-924.148) [-925.451] (-924.508) * (-922.948) (-925.674) (-924.353) [-921.915] -- 0:00:53
      144500 -- [-922.378] (-924.232) (-925.131) (-923.638) * (-923.634) [-924.548] (-924.201) (-922.841) -- 0:00:53
      145000 -- (-924.339) (-923.961) (-926.145) [-925.365] * (-925.471) (-923.045) [-923.148] (-925.604) -- 0:00:53

      Average standard deviation of split frequencies: 0.023281

      145500 -- (-924.615) [-924.661] (-924.175) (-924.533) * (-924.917) (-924.787) [-922.812] (-924.267) -- 0:00:52
      146000 -- (-924.889) (-923.970) (-924.033) [-924.061] * [-924.351] (-927.517) (-924.180) (-922.239) -- 0:00:52
      146500 -- (-923.817) (-927.060) [-924.514] (-923.416) * (-922.808) [-926.252] (-925.620) (-923.081) -- 0:00:52
      147000 -- (-923.553) [-926.117] (-925.961) (-922.862) * (-923.773) [-924.000] (-924.116) (-923.758) -- 0:00:52
      147500 -- [-922.445] (-922.800) (-922.878) (-922.840) * (-923.972) [-924.765] (-923.381) (-924.899) -- 0:00:57
      148000 -- (-922.443) (-922.289) [-924.469] (-923.216) * (-922.977) (-928.179) [-927.857] (-927.499) -- 0:00:57
      148500 -- [-923.016] (-928.783) (-926.494) (-922.521) * (-923.405) (-922.419) [-923.958] (-922.435) -- 0:00:57
      149000 -- [-925.558] (-925.910) (-924.556) (-925.254) * (-922.141) [-922.415] (-923.820) (-926.098) -- 0:00:57
      149500 -- [-924.532] (-928.180) (-923.472) (-924.779) * (-922.037) (-926.518) (-925.752) [-927.900] -- 0:00:56
      150000 -- (-924.091) [-926.633] (-925.832) (-925.989) * (-924.524) [-926.846] (-923.537) (-928.667) -- 0:00:56

      Average standard deviation of split frequencies: 0.021737

      150500 -- (-923.854) (-926.819) [-925.588] (-924.282) * (-922.742) (-925.908) [-922.537] (-925.412) -- 0:00:56
      151000 -- (-922.502) [-926.181] (-925.795) (-926.680) * (-926.648) (-923.928) [-922.903] (-922.967) -- 0:00:56
      151500 -- [-925.978] (-928.393) (-924.906) (-925.602) * (-926.531) [-926.797] (-926.614) (-926.160) -- 0:00:56
      152000 -- (-926.294) (-925.993) [-931.083] (-923.583) * (-926.624) [-923.225] (-923.454) (-923.050) -- 0:00:55
      152500 -- [-922.672] (-922.358) (-929.867) (-924.821) * (-922.598) (-929.192) (-925.094) [-923.239] -- 0:00:55
      153000 -- (-923.513) (-925.725) [-931.617] (-923.864) * [-924.324] (-927.436) (-926.569) (-923.735) -- 0:00:55
      153500 -- (-925.872) [-924.379] (-931.756) (-923.869) * (-925.681) [-926.776] (-927.049) (-925.498) -- 0:00:55
      154000 -- [-924.532] (-922.948) (-926.943) (-924.103) * (-926.474) (-924.142) (-922.431) [-924.666] -- 0:00:54
      154500 -- (-925.657) (-922.011) [-925.218] (-924.229) * (-926.371) [-924.083] (-924.253) (-923.156) -- 0:00:54
      155000 -- (-924.951) (-923.933) [-925.271] (-924.533) * (-924.124) [-926.409] (-923.907) (-926.743) -- 0:00:54

      Average standard deviation of split frequencies: 0.021630

      155500 -- [-924.782] (-923.198) (-924.680) (-924.136) * (-922.806) (-922.638) [-925.839] (-926.086) -- 0:00:54
      156000 -- (-923.830) [-922.355] (-929.188) (-923.715) * (-923.454) (-921.989) (-925.082) [-924.553] -- 0:00:54
      156500 -- (-925.173) (-924.293) [-925.398] (-923.535) * (-923.693) [-922.543] (-923.860) (-924.273) -- 0:00:53
      157000 -- [-925.026] (-921.757) (-925.037) (-923.584) * (-923.833) (-924.440) [-922.618] (-923.901) -- 0:00:53
      157500 -- (-923.958) (-922.330) (-925.283) [-923.120] * (-922.867) [-926.566] (-929.170) (-922.945) -- 0:00:53
      158000 -- (-922.755) [-922.415] (-923.347) (-923.012) * (-922.929) [-922.346] (-927.826) (-922.858) -- 0:00:53
      158500 -- [-922.434] (-926.464) (-924.172) (-923.422) * (-922.482) [-922.905] (-922.688) (-923.964) -- 0:00:53
      159000 -- [-922.112] (-924.230) (-922.393) (-925.168) * [-924.382] (-922.973) (-923.744) (-924.215) -- 0:00:52
      159500 -- (-923.286) (-923.983) [-924.294] (-925.474) * (-925.986) (-923.102) (-923.447) [-923.576] -- 0:00:52
      160000 -- (-925.713) (-923.347) (-923.733) [-923.501] * (-924.826) (-922.215) [-925.213] (-925.490) -- 0:00:57

      Average standard deviation of split frequencies: 0.019723

      160500 -- [-922.093] (-925.963) (-922.445) (-925.452) * (-924.795) [-924.093] (-927.392) (-922.889) -- 0:00:57
      161000 -- [-926.365] (-928.688) (-924.947) (-923.744) * (-930.295) [-925.852] (-923.523) (-922.414) -- 0:00:57
      161500 -- (-924.190) (-924.371) [-928.778] (-924.824) * (-929.032) (-926.214) [-924.279] (-926.505) -- 0:00:57
      162000 -- [-923.800] (-923.190) (-923.660) (-927.327) * (-924.047) (-925.163) [-923.478] (-923.532) -- 0:00:56
      162500 -- [-923.640] (-928.033) (-922.915) (-924.807) * (-924.101) (-924.353) (-922.608) [-923.288] -- 0:00:56
      163000 -- (-923.751) [-923.617] (-923.899) (-925.318) * (-925.446) (-923.850) (-924.777) [-923.169] -- 0:00:56
      163500 -- (-923.977) [-924.364] (-922.839) (-925.450) * (-926.233) [-922.850] (-926.056) (-922.746) -- 0:00:56
      164000 -- (-924.024) [-926.432] (-923.661) (-923.324) * (-922.113) (-922.759) (-923.231) [-924.147] -- 0:00:56
      164500 -- (-922.300) (-927.177) (-922.901) [-922.064] * (-922.092) [-922.667] (-925.453) (-926.537) -- 0:00:55
      165000 -- [-922.674] (-925.890) (-924.976) (-923.306) * [-922.714] (-924.159) (-923.878) (-930.254) -- 0:00:55

      Average standard deviation of split frequencies: 0.019721

      165500 -- (-922.746) (-924.254) [-924.105] (-924.603) * [-923.509] (-930.757) (-924.246) (-925.446) -- 0:00:55
      166000 -- (-922.471) (-924.233) [-926.972] (-924.056) * (-923.651) [-923.300] (-923.925) (-928.443) -- 0:00:55
      166500 -- [-922.068] (-924.545) (-928.652) (-927.033) * (-922.333) (-922.959) (-924.703) [-925.690] -- 0:00:55
      167000 -- (-922.971) [-923.655] (-924.890) (-925.749) * (-922.718) (-923.337) [-927.241] (-925.765) -- 0:00:54
      167500 -- [-923.746] (-926.418) (-923.897) (-924.874) * [-923.012] (-923.550) (-922.484) (-922.732) -- 0:00:54
      168000 -- (-922.904) (-927.191) [-924.230] (-923.296) * [-923.808] (-923.735) (-922.394) (-923.561) -- 0:00:54
      168500 -- [-922.594] (-923.077) (-924.964) (-923.659) * (-924.245) (-924.587) (-929.343) [-922.243] -- 0:00:54
      169000 -- (-923.066) (-923.210) [-924.676] (-924.260) * (-924.853) [-924.790] (-927.362) (-922.122) -- 0:00:54
      169500 -- (-928.369) (-922.733) (-927.177) [-922.486] * [-923.519] (-923.549) (-925.753) (-924.035) -- 0:00:53
      170000 -- (-924.534) [-924.632] (-925.704) (-925.323) * (-923.291) (-927.268) [-922.660] (-923.523) -- 0:00:53

      Average standard deviation of split frequencies: 0.017494

      170500 -- (-924.701) (-923.080) (-925.210) [-923.675] * (-922.641) [-923.414] (-923.856) (-926.529) -- 0:00:53
      171000 -- (-923.414) [-927.335] (-927.754) (-924.219) * [-923.894] (-928.022) (-923.130) (-926.140) -- 0:00:53
      171500 -- (-923.451) (-926.295) (-925.004) [-924.040] * [-923.907] (-925.072) (-923.396) (-923.448) -- 0:00:53
      172000 -- (-923.798) (-922.420) [-924.322] (-923.647) * [-925.067] (-923.825) (-923.815) (-924.510) -- 0:00:52
      172500 -- (-923.532) [-923.262] (-924.817) (-924.005) * (-924.150) (-924.072) (-925.663) [-925.752] -- 0:00:57
      173000 -- (-923.107) (-924.142) [-924.363] (-923.750) * [-923.467] (-928.586) (-927.314) (-922.820) -- 0:00:57
      173500 -- [-923.143] (-924.387) (-924.566) (-922.254) * (-925.030) [-927.063] (-923.467) (-923.929) -- 0:00:57
      174000 -- (-922.902) (-924.309) (-926.662) [-922.613] * (-923.896) (-926.838) (-923.696) [-923.676] -- 0:00:56
      174500 -- (-922.959) [-922.932] (-924.666) (-923.266) * [-922.799] (-923.155) (-923.933) (-926.174) -- 0:00:56
      175000 -- (-925.658) (-925.025) (-925.579) [-925.104] * [-924.960] (-924.161) (-924.200) (-926.206) -- 0:00:56

      Average standard deviation of split frequencies: 0.016205

      175500 -- (-922.592) (-925.023) [-923.750] (-924.602) * (-922.719) [-923.394] (-923.653) (-927.245) -- 0:00:56
      176000 -- [-925.676] (-924.686) (-923.140) (-925.881) * (-924.464) (-923.320) [-925.881] (-926.139) -- 0:00:56
      176500 -- [-922.120] (-926.697) (-925.227) (-927.996) * (-928.569) (-923.082) [-923.110] (-925.961) -- 0:00:55
      177000 -- (-924.370) (-922.989) (-925.188) [-924.923] * (-925.574) (-924.339) (-925.441) [-924.983] -- 0:00:55
      177500 -- (-929.277) (-923.986) (-929.517) [-924.147] * (-924.665) (-923.396) (-925.981) [-923.554] -- 0:00:55
      178000 -- (-925.870) (-923.168) (-922.779) [-923.960] * [-924.028] (-923.330) (-925.400) (-922.456) -- 0:00:55
      178500 -- (-923.643) [-923.466] (-925.037) (-927.847) * (-924.494) [-925.861] (-925.030) (-925.970) -- 0:00:55
      179000 -- (-925.676) (-921.850) (-923.067) [-927.074] * (-922.426) (-922.570) [-924.744] (-926.970) -- 0:00:55
      179500 -- [-927.763] (-923.405) (-923.759) (-927.836) * (-922.284) (-922.680) [-926.781] (-924.097) -- 0:00:54
      180000 -- [-925.412] (-924.234) (-927.493) (-924.196) * (-927.256) (-923.080) (-926.209) [-925.468] -- 0:00:54

      Average standard deviation of split frequencies: 0.016569

      180500 -- [-923.319] (-924.163) (-926.851) (-922.101) * (-925.157) (-927.030) [-929.776] (-927.002) -- 0:00:54
      181000 -- (-922.618) [-923.474] (-925.668) (-922.345) * [-927.979] (-922.976) (-930.857) (-927.999) -- 0:00:54
      181500 -- [-923.585] (-924.175) (-924.250) (-922.529) * (-923.031) [-924.857] (-927.621) (-929.726) -- 0:00:54
      182000 -- [-922.422] (-925.262) (-926.946) (-923.234) * (-924.206) (-924.117) (-926.982) [-923.527] -- 0:00:53
      182500 -- (-922.422) [-922.707] (-922.457) (-922.428) * (-924.569) (-924.870) (-922.782) [-922.400] -- 0:00:53
      183000 -- (-924.568) [-922.178] (-924.760) (-923.083) * (-923.257) (-922.330) (-923.021) [-922.469] -- 0:00:53
      183500 -- [-922.141] (-924.200) (-928.914) (-924.598) * (-923.471) [-923.822] (-926.598) (-923.237) -- 0:00:53
      184000 -- (-925.545) [-924.562] (-924.056) (-923.931) * (-923.018) (-923.968) (-928.827) [-926.286] -- 0:00:53
      184500 -- (-928.020) (-924.238) (-922.549) [-922.733] * [-923.421] (-922.836) (-933.614) (-929.406) -- 0:00:53
      185000 -- [-924.590] (-924.457) (-924.963) (-923.690) * (-923.386) (-922.469) [-922.842] (-926.767) -- 0:00:57

      Average standard deviation of split frequencies: 0.016601

      185500 -- (-926.326) (-925.148) [-926.477] (-924.809) * (-923.268) (-923.551) [-922.875] (-925.767) -- 0:00:57
      186000 -- [-923.580] (-922.558) (-925.921) (-922.946) * (-928.842) (-923.428) (-926.661) [-926.342] -- 0:00:56
      186500 -- (-924.025) (-922.080) [-924.304] (-922.742) * (-923.684) [-922.816] (-923.313) (-925.037) -- 0:00:56
      187000 -- (-925.330) [-922.850] (-922.186) (-924.050) * (-925.899) (-922.791) (-922.878) [-922.307] -- 0:00:56
      187500 -- [-924.356] (-926.159) (-923.407) (-924.382) * (-924.354) (-923.292) (-929.621) [-924.550] -- 0:00:56
      188000 -- (-923.658) (-923.770) [-922.541] (-925.493) * (-924.540) [-924.554] (-924.325) (-926.026) -- 0:00:56
      188500 -- (-924.049) (-924.454) [-922.953] (-926.112) * [-923.719] (-930.243) (-922.757) (-922.287) -- 0:00:55
      189000 -- (-927.576) [-922.264] (-928.020) (-924.513) * (-927.535) (-924.918) [-922.837] (-924.515) -- 0:00:55
      189500 -- (-926.653) (-924.157) [-928.125] (-925.960) * (-925.634) (-923.135) [-922.839] (-922.372) -- 0:00:55
      190000 -- (-923.845) [-924.491] (-927.750) (-925.249) * (-928.060) [-923.183] (-923.178) (-925.840) -- 0:00:55

      Average standard deviation of split frequencies: 0.014958

      190500 -- (-925.165) (-926.727) (-926.699) [-923.903] * [-924.266] (-924.007) (-922.476) (-923.164) -- 0:00:55
      191000 -- (-925.011) [-927.104] (-927.571) (-923.085) * [-924.394] (-924.677) (-924.856) (-924.231) -- 0:00:55
      191500 -- (-922.162) [-926.999] (-923.644) (-922.867) * (-924.664) (-924.077) [-924.838] (-925.776) -- 0:00:54
      192000 -- (-925.497) [-924.841] (-926.100) (-923.254) * [-923.421] (-923.518) (-924.996) (-926.171) -- 0:00:54
      192500 -- (-922.272) (-923.335) (-928.981) [-924.166] * (-923.441) (-925.772) (-926.370) [-922.538] -- 0:00:54
      193000 -- (-922.096) [-924.392] (-923.963) (-924.941) * (-925.845) (-928.690) [-930.349] (-922.416) -- 0:00:54
      193500 -- (-926.266) (-924.058) (-926.081) [-923.206] * (-923.190) (-926.192) (-924.801) [-923.856] -- 0:00:54
      194000 -- (-923.480) (-927.858) (-923.451) [-924.319] * (-922.681) (-926.106) [-925.652] (-923.532) -- 0:00:54
      194500 -- (-922.394) (-926.920) [-922.873] (-923.319) * (-923.581) [-925.062] (-925.908) (-922.892) -- 0:00:53
      195000 -- (-927.412) [-923.211] (-922.966) (-923.494) * [-924.474] (-927.785) (-925.403) (-922.810) -- 0:00:53

      Average standard deviation of split frequencies: 0.014178

      195500 -- (-929.131) (-926.798) [-923.495] (-923.548) * (-924.146) (-925.582) (-924.405) [-924.342] -- 0:00:53
      196000 -- (-922.649) (-924.792) [-922.264] (-922.929) * (-924.699) (-925.329) (-924.226) [-924.935] -- 0:00:53
      196500 -- (-923.141) [-924.769] (-923.253) (-922.321) * [-924.850] (-924.998) (-925.258) (-924.445) -- 0:00:53
      197000 -- (-922.689) (-922.939) [-924.930] (-927.947) * [-925.445] (-925.224) (-923.187) (-926.319) -- 0:00:57
      197500 -- (-925.652) [-924.782] (-927.976) (-924.594) * [-924.894] (-925.338) (-925.187) (-924.494) -- 0:00:56
      198000 -- [-925.927] (-926.108) (-926.822) (-924.922) * (-926.456) (-924.093) [-924.613] (-923.241) -- 0:00:56
      198500 -- (-923.233) [-924.624] (-927.658) (-924.329) * (-924.623) (-925.065) [-923.885] (-925.312) -- 0:00:56
      199000 -- (-922.585) (-922.918) [-923.535] (-923.782) * (-924.911) (-925.959) (-924.939) [-923.435] -- 0:00:56
      199500 -- (-925.685) (-923.192) [-922.685] (-924.742) * (-923.421) (-923.335) (-931.668) [-921.929] -- 0:00:56
      200000 -- (-928.015) (-923.429) [-925.067] (-926.202) * (-924.127) (-922.476) [-924.609] (-927.878) -- 0:00:55

      Average standard deviation of split frequencies: 0.014356

      200500 -- (-929.494) [-924.326] (-923.043) (-926.803) * (-925.383) [-923.238] (-923.913) (-922.536) -- 0:00:55
      201000 -- [-924.903] (-924.117) (-925.359) (-925.583) * (-923.513) (-924.615) (-924.853) [-922.231] -- 0:00:55
      201500 -- (-927.680) [-925.806] (-925.778) (-925.697) * (-925.110) (-925.605) [-927.231] (-923.435) -- 0:00:55
      202000 -- (-924.342) [-922.904] (-924.308) (-924.879) * (-922.844) [-925.728] (-928.714) (-922.711) -- 0:00:55
      202500 -- (-923.406) [-922.994] (-927.403) (-925.421) * (-926.450) (-925.186) (-924.486) [-923.701] -- 0:00:55
      203000 -- (-922.623) (-922.232) [-925.794] (-924.164) * (-924.132) (-928.103) (-925.628) [-922.672] -- 0:00:54
      203500 -- [-923.033] (-923.787) (-922.995) (-924.490) * (-924.152) [-924.101] (-929.393) (-924.940) -- 0:00:54
      204000 -- (-924.264) [-924.321] (-926.557) (-927.792) * (-925.950) [-922.977] (-929.783) (-923.811) -- 0:00:54
      204500 -- (-924.780) [-926.375] (-931.184) (-924.550) * (-925.047) [-922.326] (-925.058) (-922.183) -- 0:00:54
      205000 -- (-924.482) (-925.400) (-928.226) [-924.442] * (-925.766) [-923.348] (-923.633) (-926.271) -- 0:00:54

      Average standard deviation of split frequencies: 0.014620

      205500 -- (-922.387) (-925.642) (-923.364) [-923.099] * [-923.860] (-922.761) (-925.956) (-924.312) -- 0:00:54
      206000 -- (-923.386) (-923.706) [-923.405] (-931.558) * (-925.027) (-922.959) [-928.341] (-924.122) -- 0:00:53
      206500 -- (-927.110) (-923.024) [-923.568] (-926.283) * (-923.656) (-924.508) (-922.925) [-927.184] -- 0:00:53
      207000 -- (-923.967) (-922.360) (-922.760) [-923.244] * (-922.961) [-924.130] (-928.738) (-927.649) -- 0:00:53
      207500 -- (-924.678) (-925.711) (-922.192) [-925.880] * (-924.041) (-926.385) [-927.674] (-923.498) -- 0:00:53
      208000 -- (-925.501) [-922.907] (-922.574) (-927.810) * (-921.950) (-923.709) [-923.658] (-924.937) -- 0:00:53
      208500 -- (-923.654) (-927.777) (-928.689) [-926.092] * (-923.704) [-922.549] (-926.629) (-927.175) -- 0:00:53
      209000 -- [-923.425] (-923.491) (-924.251) (-926.593) * [-925.014] (-922.183) (-921.695) (-922.996) -- 0:00:52
      209500 -- [-923.449] (-924.232) (-926.967) (-926.891) * (-925.253) [-922.570] (-922.717) (-922.693) -- 0:00:52
      210000 -- (-926.186) [-926.772] (-926.021) (-925.374) * (-924.730) [-924.521] (-923.739) (-923.225) -- 0:00:56

      Average standard deviation of split frequencies: 0.014048

      210500 -- (-931.603) (-928.752) (-924.779) [-927.355] * (-923.543) [-926.878] (-925.035) (-922.839) -- 0:00:56
      211000 -- (-923.738) (-924.613) (-930.086) [-926.495] * (-925.300) (-922.540) (-924.416) [-923.707] -- 0:00:56
      211500 -- (-924.340) (-928.050) [-922.698] (-926.493) * (-923.919) [-922.059] (-925.927) (-923.009) -- 0:00:55
      212000 -- [-923.038] (-924.323) (-923.640) (-927.576) * (-922.617) (-922.059) (-925.565) [-922.727] -- 0:00:55
      212500 -- [-923.735] (-929.605) (-924.990) (-924.113) * (-924.568) [-924.756] (-927.920) (-926.900) -- 0:00:55
      213000 -- (-928.835) (-925.253) (-923.041) [-924.254] * (-921.880) [-925.650] (-925.922) (-926.439) -- 0:00:55
      213500 -- (-923.636) (-922.951) (-924.593) [-922.665] * (-922.303) [-923.946] (-924.395) (-923.706) -- 0:00:55
      214000 -- [-923.683] (-923.164) (-923.201) (-925.154) * (-922.810) (-925.145) [-922.820] (-925.695) -- 0:00:55
      214500 -- (-924.330) (-923.122) [-926.576] (-926.853) * [-922.810] (-925.887) (-927.521) (-926.702) -- 0:00:54
      215000 -- [-922.276] (-923.344) (-924.850) (-925.227) * (-922.259) [-924.092] (-924.025) (-923.903) -- 0:00:54

      Average standard deviation of split frequencies: 0.013439

      215500 -- (-926.179) (-929.406) [-925.244] (-923.322) * [-924.029] (-922.535) (-925.120) (-922.688) -- 0:00:54
      216000 -- [-923.311] (-924.354) (-925.984) (-923.914) * (-922.911) (-927.030) [-924.195] (-922.812) -- 0:00:54
      216500 -- (-925.601) (-931.330) (-924.592) [-924.966] * (-925.020) (-923.639) (-924.255) [-923.328] -- 0:00:54
      217000 -- (-926.803) (-925.114) (-924.322) [-923.069] * [-923.439] (-925.212) (-922.607) (-924.517) -- 0:00:54
      217500 -- (-923.594) (-924.740) [-922.673] (-922.857) * (-927.563) (-925.252) (-922.034) [-923.840] -- 0:00:53
      218000 -- [-922.254] (-928.023) (-922.861) (-922.906) * (-927.982) [-924.107] (-923.370) (-924.192) -- 0:00:53
      218500 -- (-923.282) [-923.199] (-924.302) (-922.552) * (-922.440) [-924.333] (-925.458) (-930.028) -- 0:00:53
      219000 -- (-921.753) (-922.790) [-924.875] (-923.337) * (-924.296) (-924.218) [-925.553] (-926.701) -- 0:00:53
      219500 -- (-923.136) [-923.615] (-926.997) (-921.889) * (-923.935) [-924.213] (-925.534) (-923.507) -- 0:00:53
      220000 -- (-926.382) [-925.102] (-924.523) (-922.952) * (-923.297) [-922.625] (-923.218) (-924.202) -- 0:00:53

      Average standard deviation of split frequencies: 0.012462

      220500 -- (-924.125) [-924.288] (-924.041) (-922.603) * (-927.135) [-926.750] (-925.990) (-922.724) -- 0:00:53
      221000 -- (-924.348) (-924.122) [-922.430] (-924.175) * (-926.316) [-925.335] (-925.002) (-926.261) -- 0:00:52
      221500 -- [-926.101] (-924.534) (-924.440) (-922.646) * [-925.527] (-923.778) (-924.048) (-925.700) -- 0:00:52
      222000 -- [-923.231] (-923.504) (-922.763) (-922.535) * [-923.681] (-925.161) (-924.743) (-925.264) -- 0:00:52
      222500 -- (-923.232) [-922.363] (-927.629) (-924.508) * (-926.645) [-922.998] (-924.400) (-923.212) -- 0:00:52
      223000 -- [-928.872] (-925.227) (-927.989) (-926.407) * (-923.362) [-922.140] (-924.304) (-922.495) -- 0:00:52
      223500 -- (-922.558) (-923.445) [-923.349] (-926.357) * (-925.148) (-925.716) [-924.511] (-923.786) -- 0:00:52
      224000 -- (-924.676) [-921.890] (-924.890) (-923.846) * (-930.375) (-927.922) [-924.434] (-924.847) -- 0:00:51
      224500 -- [-924.340] (-923.273) (-925.471) (-923.381) * (-924.768) (-931.386) (-923.811) [-924.027] -- 0:00:51
      225000 -- (-925.144) [-921.877] (-925.306) (-923.044) * [-923.508] (-924.061) (-925.268) (-927.062) -- 0:00:51

      Average standard deviation of split frequencies: 0.012619

      225500 -- [-923.024] (-925.076) (-923.138) (-924.353) * (-922.617) (-922.248) (-923.968) [-923.312] -- 0:00:51
      226000 -- (-922.145) (-927.349) (-922.504) [-923.745] * [-923.537] (-922.295) (-928.510) (-923.994) -- 0:00:54
      226500 -- (-927.336) (-923.958) [-924.998] (-923.621) * [-925.472] (-922.626) (-924.340) (-925.538) -- 0:00:54
      227000 -- (-923.454) (-924.261) (-923.555) [-922.091] * (-922.452) (-925.166) [-923.586] (-923.887) -- 0:00:54
      227500 -- (-924.035) (-923.771) [-921.991] (-923.002) * (-923.814) (-925.454) (-929.718) [-924.117] -- 0:00:54
      228000 -- (-923.505) (-925.098) (-922.622) [-922.282] * [-924.242] (-925.720) (-924.251) (-923.584) -- 0:00:54
      228500 -- (-925.717) [-923.583] (-922.938) (-924.552) * (-922.551) (-924.361) (-925.220) [-924.314] -- 0:00:54
      229000 -- (-923.371) (-923.749) [-922.690] (-926.562) * [-923.194] (-931.315) (-925.100) (-923.310) -- 0:00:53
      229500 -- (-925.352) (-922.955) [-922.973] (-925.116) * (-922.666) (-928.336) [-923.905] (-927.185) -- 0:00:53
      230000 -- (-925.195) [-923.898] (-925.530) (-924.814) * (-922.000) (-931.095) (-923.789) [-924.040] -- 0:00:53

      Average standard deviation of split frequencies: 0.013182

      230500 -- (-924.084) (-926.163) (-922.048) [-924.679] * (-922.447) (-931.254) [-927.627] (-925.210) -- 0:00:53
      231000 -- (-924.629) (-924.121) (-924.599) [-922.822] * [-922.156] (-924.616) (-924.776) (-924.922) -- 0:00:53
      231500 -- (-923.083) (-923.187) [-924.151] (-924.785) * (-922.080) (-925.118) [-926.237] (-922.012) -- 0:00:53
      232000 -- [-922.580] (-922.700) (-925.552) (-925.204) * (-925.401) (-924.929) [-927.654] (-925.126) -- 0:00:52
      232500 -- [-925.454] (-924.328) (-922.783) (-923.749) * (-924.456) (-927.496) [-925.783] (-926.188) -- 0:00:52
      233000 -- [-923.114] (-923.574) (-923.691) (-923.736) * [-921.775] (-922.873) (-923.113) (-923.883) -- 0:00:52
      233500 -- (-922.343) [-923.376] (-924.899) (-924.356) * (-922.751) (-924.611) [-923.931] (-923.352) -- 0:00:52
      234000 -- [-927.394] (-923.946) (-924.120) (-924.768) * [-923.217] (-923.784) (-923.428) (-925.364) -- 0:00:52
      234500 -- (-926.409) [-923.948] (-923.411) (-926.503) * (-922.517) (-925.883) [-922.199] (-925.451) -- 0:00:52
      235000 -- (-925.127) (-928.839) (-924.804) [-926.659] * [-922.108] (-927.595) (-922.686) (-926.864) -- 0:00:52

      Average standard deviation of split frequencies: 0.012616

      235500 -- (-925.427) (-927.752) [-926.966] (-922.823) * (-922.908) [-923.345] (-922.860) (-927.221) -- 0:00:51
      236000 -- (-922.763) (-923.557) (-924.771) [-923.545] * (-923.038) (-922.215) (-922.117) [-922.493] -- 0:00:51
      236500 -- [-922.729] (-926.233) (-924.370) (-925.091) * (-925.567) (-926.309) [-924.440] (-924.314) -- 0:00:51
      237000 -- (-926.440) [-925.428] (-926.538) (-926.674) * [-922.685] (-923.346) (-929.934) (-924.950) -- 0:00:51
      237500 -- (-925.222) (-924.412) (-922.876) [-925.877] * (-926.806) (-922.666) (-924.100) [-925.350] -- 0:00:51
      238000 -- [-923.223] (-923.596) (-926.210) (-922.758) * (-927.171) (-923.422) [-924.260] (-925.601) -- 0:00:51
      238500 -- (-925.999) [-926.435] (-923.479) (-923.824) * (-924.370) (-925.495) (-924.148) [-926.999] -- 0:00:51
      239000 -- (-922.334) [-924.483] (-923.033) (-925.397) * (-922.645) [-923.847] (-925.825) (-922.816) -- 0:00:50
      239500 -- (-922.474) (-923.982) [-921.983] (-924.548) * (-925.540) (-923.296) (-925.511) [-924.883] -- 0:00:50
      240000 -- (-923.464) (-924.141) [-925.672] (-924.940) * (-927.118) [-924.781] (-923.599) (-921.860) -- 0:00:50

      Average standard deviation of split frequencies: 0.011208

      240500 -- (-923.641) (-924.904) (-926.078) [-922.740] * [-925.123] (-923.363) (-925.549) (-922.784) -- 0:00:50
      241000 -- (-923.668) (-922.627) [-925.844] (-924.806) * (-922.085) (-922.418) [-925.263] (-922.460) -- 0:00:50
      241500 -- [-922.385] (-923.944) (-926.150) (-923.652) * (-922.199) [-926.546] (-924.731) (-922.918) -- 0:00:50
      242000 -- (-924.340) (-922.590) [-925.043] (-924.277) * (-926.648) (-923.729) (-925.267) [-923.436] -- 0:00:50
      242500 -- (-925.463) [-924.687] (-924.583) (-923.846) * (-925.281) (-925.210) (-924.743) [-922.573] -- 0:00:49
      243000 -- (-922.824) (-923.420) [-923.805] (-925.522) * (-926.145) [-923.706] (-928.326) (-922.706) -- 0:00:52
      243500 -- (-927.263) (-923.553) (-923.836) [-923.027] * (-924.032) [-924.880] (-923.115) (-923.833) -- 0:00:52
      244000 -- [-922.270] (-922.719) (-924.499) (-924.512) * (-924.249) (-922.907) (-922.350) [-923.396] -- 0:00:52
      244500 -- (-925.368) [-925.250] (-926.418) (-926.730) * (-923.242) (-923.180) (-926.045) [-925.496] -- 0:00:52
      245000 -- (-924.852) (-925.523) (-924.806) [-931.384] * [-923.230] (-925.268) (-923.403) (-925.535) -- 0:00:52

      Average standard deviation of split frequencies: 0.010114

      245500 -- (-924.634) [-924.228] (-923.375) (-922.571) * (-922.928) [-926.115] (-922.873) (-924.266) -- 0:00:52
      246000 -- [-922.810] (-922.488) (-924.247) (-924.098) * (-924.003) (-925.141) (-923.156) [-922.284] -- 0:00:52
      246500 -- (-923.807) (-923.623) [-927.203] (-924.756) * (-922.543) (-926.184) (-924.842) [-925.217] -- 0:00:51
      247000 -- [-924.227] (-922.712) (-927.957) (-930.016) * [-923.976] (-928.019) (-923.596) (-922.556) -- 0:00:51
      247500 -- (-925.157) [-922.888] (-925.699) (-926.516) * (-923.864) [-924.771] (-925.991) (-924.177) -- 0:00:51
      248000 -- (-923.227) (-922.539) [-925.940] (-925.996) * (-926.292) (-922.481) (-924.964) [-922.013] -- 0:00:51
      248500 -- (-922.918) [-921.968] (-927.431) (-927.288) * (-927.246) (-923.462) (-922.440) [-922.325] -- 0:00:51
      249000 -- (-923.795) (-921.991) [-922.290] (-923.659) * (-924.670) (-923.593) (-922.749) [-922.389] -- 0:00:51
      249500 -- (-922.722) (-923.518) (-924.219) [-923.151] * [-922.696] (-923.431) (-922.609) (-922.241) -- 0:00:51
      250000 -- (-922.895) [-923.259] (-922.468) (-925.093) * (-924.715) (-925.027) [-928.312] (-925.753) -- 0:00:51

      Average standard deviation of split frequencies: 0.011179

      250500 -- [-923.599] (-922.639) (-923.082) (-926.439) * (-923.650) (-924.548) [-924.393] (-923.401) -- 0:00:50
      251000 -- (-923.398) (-924.914) (-925.795) [-927.479] * (-924.265) (-925.742) [-923.268] (-922.075) -- 0:00:50
      251500 -- (-923.978) [-924.484] (-923.191) (-925.773) * (-925.823) (-924.355) (-923.264) [-922.039] -- 0:00:50
      252000 -- (-924.319) [-923.295] (-922.390) (-926.055) * [-922.643] (-926.602) (-923.437) (-922.856) -- 0:00:50
      252500 -- (-924.679) (-922.298) [-923.788] (-925.186) * [-924.303] (-922.171) (-922.616) (-923.664) -- 0:00:50
      253000 -- (-925.299) [-925.885] (-923.770) (-923.620) * (-923.003) (-926.820) [-924.059] (-923.786) -- 0:00:50
      253500 -- (-922.374) (-924.882) [-924.522] (-923.077) * (-922.167) [-924.194] (-924.087) (-923.403) -- 0:00:50
      254000 -- [-922.878] (-924.730) (-925.574) (-923.449) * (-922.676) (-922.763) [-923.557] (-924.249) -- 0:00:49
      254500 -- (-923.233) [-924.827] (-923.345) (-923.290) * (-922.676) [-922.841] (-923.399) (-923.875) -- 0:00:49
      255000 -- (-924.092) (-925.125) [-923.578] (-926.152) * (-925.128) (-923.977) (-923.035) [-924.545] -- 0:00:49

      Average standard deviation of split frequencies: 0.010844

      255500 -- [-924.443] (-924.330) (-923.492) (-927.246) * (-923.396) (-924.387) (-925.962) [-923.017] -- 0:00:49
      256000 -- (-923.142) (-925.192) [-923.978] (-926.975) * [-924.270] (-924.064) (-925.721) (-922.798) -- 0:00:49
      256500 -- (-925.052) [-922.859] (-925.688) (-925.727) * (-924.250) (-923.651) (-927.970) [-922.161] -- 0:00:49
      257000 -- (-923.094) (-923.542) (-923.352) [-928.060] * [-922.272] (-925.774) (-927.202) (-922.986) -- 0:00:49
      257500 -- [-925.227] (-923.791) (-923.509) (-923.453) * (-922.936) [-925.017] (-923.045) (-924.559) -- 0:00:49
      258000 -- (-926.874) (-923.919) [-924.386] (-922.905) * (-923.121) [-925.184] (-923.054) (-923.355) -- 0:00:48
      258500 -- [-926.088] (-923.977) (-923.773) (-922.977) * (-922.830) (-922.851) [-923.684] (-922.871) -- 0:00:48
      259000 -- (-927.607) [-924.562] (-922.690) (-923.715) * (-922.294) [-924.939] (-922.747) (-925.010) -- 0:00:48
      259500 -- [-924.729] (-923.876) (-926.185) (-922.807) * (-928.984) (-922.288) [-923.819] (-926.200) -- 0:00:51
      260000 -- (-925.719) [-924.404] (-926.557) (-923.245) * (-924.522) [-922.942] (-924.178) (-928.548) -- 0:00:51

      Average standard deviation of split frequencies: 0.010951

      260500 -- (-923.350) (-924.536) [-927.198] (-925.412) * (-926.646) [-922.954] (-925.982) (-926.657) -- 0:00:51
      261000 -- (-924.762) (-924.536) [-924.466] (-924.429) * (-924.546) (-922.834) (-924.409) [-925.100] -- 0:00:50
      261500 -- (-924.032) [-923.405] (-925.927) (-925.735) * (-924.500) [-923.563] (-922.786) (-923.415) -- 0:00:50
      262000 -- (-922.673) (-926.077) [-923.440] (-922.879) * (-925.544) (-922.483) [-923.598] (-925.584) -- 0:00:50
      262500 -- (-925.278) [-922.470] (-922.006) (-923.704) * [-928.540] (-927.079) (-923.449) (-927.960) -- 0:00:50
      263000 -- [-924.427] (-923.210) (-922.872) (-925.305) * (-927.015) (-923.914) (-922.869) [-923.237] -- 0:00:50
      263500 -- [-922.100] (-924.020) (-923.128) (-927.560) * (-924.112) (-925.699) [-923.054] (-922.424) -- 0:00:50
      264000 -- [-922.415] (-925.460) (-924.199) (-923.424) * [-922.275] (-924.570) (-923.573) (-924.624) -- 0:00:50
      264500 -- [-926.041] (-924.897) (-924.938) (-927.127) * [-923.316] (-926.658) (-924.151) (-923.799) -- 0:00:50
      265000 -- (-922.758) (-923.824) (-922.551) [-928.985] * (-928.586) (-930.022) [-925.556] (-925.680) -- 0:00:49

      Average standard deviation of split frequencies: 0.010929

      265500 -- [-923.674] (-925.058) (-922.507) (-922.807) * [-924.129] (-922.995) (-922.708) (-929.939) -- 0:00:49
      266000 -- (-922.411) [-925.277] (-923.988) (-923.536) * [-926.532] (-923.087) (-924.543) (-926.189) -- 0:00:49
      266500 -- (-925.417) (-922.475) [-924.452] (-923.755) * (-927.644) (-922.971) [-925.681] (-923.365) -- 0:00:49
      267000 -- (-922.282) (-923.080) (-931.556) [-923.626] * (-926.191) [-922.799] (-924.254) (-925.095) -- 0:00:49
      267500 -- (-923.261) [-923.502] (-926.085) (-926.471) * (-924.107) (-922.483) (-926.666) [-925.830] -- 0:00:49
      268000 -- (-928.329) (-927.357) [-925.040] (-923.410) * [-922.278] (-922.504) (-924.534) (-925.533) -- 0:00:49
      268500 -- (-923.383) (-924.746) (-924.084) [-924.206] * (-922.466) [-922.504] (-922.851) (-925.194) -- 0:00:49
      269000 -- (-922.132) [-924.765] (-926.313) (-923.982) * (-926.144) (-925.589) [-924.326] (-928.872) -- 0:00:48
      269500 -- (-922.877) [-928.293] (-929.370) (-925.729) * (-923.765) [-923.591] (-924.090) (-925.007) -- 0:00:48
      270000 -- [-924.079] (-925.276) (-932.466) (-924.578) * (-924.192) (-923.832) [-923.540] (-924.260) -- 0:00:48

      Average standard deviation of split frequencies: 0.011417

      270500 -- (-923.385) (-924.125) [-926.306] (-924.782) * (-926.640) [-923.797] (-923.745) (-928.878) -- 0:00:48
      271000 -- (-924.532) (-924.590) [-924.052] (-923.318) * (-923.583) [-922.858] (-926.600) (-923.956) -- 0:00:48
      271500 -- (-923.112) (-923.646) (-931.335) [-924.776] * (-923.359) (-922.863) [-924.997] (-924.028) -- 0:00:48
      272000 -- (-923.460) (-926.512) (-924.583) [-924.147] * (-924.751) [-923.197] (-924.791) (-924.525) -- 0:00:48
      272500 -- (-924.444) [-930.752] (-924.392) (-924.807) * [-923.912] (-923.576) (-923.885) (-923.031) -- 0:00:48
      273000 -- (-925.637) (-924.043) [-924.159] (-925.050) * (-928.298) [-922.870] (-923.590) (-924.373) -- 0:00:47
      273500 -- (-927.541) (-922.997) [-924.389] (-922.938) * (-922.778) (-923.789) [-923.264] (-924.318) -- 0:00:47
      274000 -- [-923.571] (-922.983) (-923.911) (-923.198) * (-924.979) [-924.595] (-924.020) (-924.054) -- 0:00:47
      274500 -- [-922.908] (-923.325) (-927.578) (-922.459) * (-924.045) (-926.097) (-925.494) [-924.333] -- 0:00:47
      275000 -- [-922.923] (-924.410) (-924.832) (-928.410) * (-922.178) (-923.342) (-922.887) [-923.239] -- 0:00:50

      Average standard deviation of split frequencies: 0.010851

      275500 -- (-925.673) [-924.088] (-925.083) (-923.308) * [-922.161] (-923.379) (-923.296) (-923.793) -- 0:00:49
      276000 -- [-923.703] (-927.004) (-924.443) (-924.244) * (-924.676) [-924.849] (-923.902) (-925.512) -- 0:00:49
      276500 -- (-927.294) (-927.275) (-923.242) [-922.861] * (-923.864) [-922.352] (-921.806) (-924.722) -- 0:00:49
      277000 -- (-923.960) (-926.676) (-922.385) [-923.049] * (-923.948) [-922.860] (-928.896) (-924.444) -- 0:00:49
      277500 -- [-923.799] (-925.131) (-923.460) (-923.199) * (-926.507) (-922.870) (-923.674) [-923.991] -- 0:00:49
      278000 -- [-922.924] (-923.915) (-925.778) (-926.512) * (-927.988) [-925.432] (-923.664) (-923.417) -- 0:00:49
      278500 -- (-924.835) (-923.857) [-922.960] (-926.028) * (-923.749) [-924.897] (-925.422) (-923.862) -- 0:00:49
      279000 -- (-923.627) (-924.082) [-922.960] (-924.018) * (-923.153) [-924.875] (-924.409) (-924.694) -- 0:00:49
      279500 -- (-923.489) [-924.811] (-928.683) (-925.249) * (-922.943) (-924.201) [-923.308] (-924.078) -- 0:00:48
      280000 -- [-924.794] (-922.684) (-925.102) (-922.936) * (-924.528) [-923.375] (-922.587) (-923.015) -- 0:00:48

      Average standard deviation of split frequencies: 0.011461

      280500 -- (-923.020) (-925.055) [-924.869] (-925.614) * (-922.999) (-924.596) (-923.934) [-924.477] -- 0:00:48
      281000 -- [-925.783] (-923.303) (-922.395) (-924.234) * (-927.281) [-923.161] (-925.551) (-922.382) -- 0:00:48
      281500 -- (-922.842) (-922.970) (-923.729) [-924.207] * (-924.930) (-922.220) [-926.690] (-922.678) -- 0:00:48
      282000 -- (-926.447) [-924.023] (-925.860) (-923.213) * (-927.115) (-922.582) (-923.559) [-923.678] -- 0:00:48
      282500 -- [-923.837] (-924.932) (-928.189) (-923.583) * (-933.082) [-926.318] (-924.059) (-926.117) -- 0:00:48
      283000 -- [-922.396] (-926.331) (-924.091) (-924.967) * (-922.420) [-923.748] (-924.107) (-926.347) -- 0:00:48
      283500 -- (-923.404) (-924.477) (-923.178) [-926.921] * (-922.829) (-923.693) [-924.265] (-925.518) -- 0:00:48
      284000 -- (-924.025) (-923.388) [-924.427] (-922.973) * (-924.964) (-924.162) (-924.428) [-925.263] -- 0:00:47
      284500 -- (-924.959) [-922.683] (-924.439) (-923.548) * (-923.996) [-923.701] (-924.191) (-922.995) -- 0:00:47
      285000 -- (-923.530) (-923.757) [-923.117] (-926.574) * (-922.669) (-923.808) [-924.261] (-923.605) -- 0:00:47

      Average standard deviation of split frequencies: 0.011441

      285500 -- (-923.530) (-926.678) (-923.677) [-928.123] * (-922.519) (-924.821) (-926.176) [-926.366] -- 0:00:47
      286000 -- (-925.928) (-924.465) [-923.318] (-927.711) * (-924.675) (-923.985) [-923.943] (-925.645) -- 0:00:47
      286500 -- [-926.161] (-926.723) (-926.755) (-924.118) * (-924.155) [-922.251] (-925.757) (-924.342) -- 0:00:47
      287000 -- (-924.876) (-923.501) [-924.741] (-924.300) * (-924.142) [-926.034] (-925.273) (-923.336) -- 0:00:47
      287500 -- (-924.363) (-931.273) [-922.642] (-926.062) * (-923.725) [-924.297] (-922.606) (-923.024) -- 0:00:47
      288000 -- [-924.212] (-930.104) (-921.896) (-927.760) * (-922.577) [-922.806] (-924.770) (-925.191) -- 0:00:46
      288500 -- (-922.913) [-924.772] (-921.896) (-922.365) * (-923.940) [-923.581] (-922.079) (-925.914) -- 0:00:46
      289000 -- (-923.231) (-923.303) (-922.234) [-923.036] * (-924.555) (-924.124) (-922.541) [-923.669] -- 0:00:46
      289500 -- (-922.743) (-922.525) [-922.830] (-922.951) * [-925.174] (-924.393) (-923.651) (-923.605) -- 0:00:46
      290000 -- (-923.909) (-921.930) [-924.203] (-927.667) * (-929.460) [-926.410] (-924.274) (-924.759) -- 0:00:46

      Average standard deviation of split frequencies: 0.011353

      290500 -- (-922.662) (-921.967) (-926.349) [-923.686] * (-926.373) (-926.472) [-921.984] (-922.885) -- 0:00:48
      291000 -- (-923.757) (-923.292) (-924.020) [-924.786] * (-922.773) [-923.364] (-924.876) (-923.650) -- 0:00:48
      291500 -- [-923.654] (-923.559) (-927.811) (-926.514) * [-924.129] (-923.478) (-923.353) (-925.577) -- 0:00:48
      292000 -- [-925.476] (-923.213) (-922.877) (-924.830) * [-923.968] (-927.641) (-926.979) (-924.457) -- 0:00:48
      292500 -- [-924.948] (-926.258) (-925.690) (-924.880) * (-925.140) (-930.851) [-925.536] (-925.081) -- 0:00:48
      293000 -- (-927.063) (-923.940) [-925.369] (-926.345) * [-923.435] (-926.617) (-921.964) (-922.393) -- 0:00:48
      293500 -- (-924.822) [-925.330] (-923.323) (-931.443) * (-925.355) (-924.555) (-922.302) [-929.321] -- 0:00:48
      294000 -- (-923.514) [-924.289] (-922.159) (-925.572) * (-923.045) (-924.343) [-922.825] (-932.271) -- 0:00:48
      294500 -- (-922.412) (-923.240) [-928.113] (-925.044) * (-923.010) (-923.955) [-923.640] (-924.852) -- 0:00:47
      295000 -- [-922.235] (-922.772) (-928.899) (-924.226) * (-923.453) [-923.344] (-922.647) (-925.283) -- 0:00:47

      Average standard deviation of split frequencies: 0.010961

      295500 -- (-923.858) (-923.394) (-923.832) [-923.624] * (-923.146) (-924.926) (-924.055) [-924.324] -- 0:00:47
      296000 -- [-922.630] (-922.836) (-924.425) (-923.403) * [-923.284] (-922.844) (-924.100) (-928.119) -- 0:00:47
      296500 -- (-929.302) (-924.034) [-923.215] (-926.128) * [-921.905] (-923.961) (-922.909) (-928.539) -- 0:00:47
      297000 -- (-927.246) (-923.783) (-925.310) [-923.195] * (-922.604) (-924.117) [-922.602] (-923.417) -- 0:00:47
      297500 -- (-923.239) (-925.377) [-925.216] (-922.872) * (-921.786) (-922.371) (-925.894) [-923.321] -- 0:00:47
      298000 -- (-927.797) [-922.467] (-922.248) (-923.711) * [-926.704] (-924.254) (-923.711) (-923.309) -- 0:00:47
      298500 -- (-926.322) [-922.467] (-925.401) (-924.768) * [-927.488] (-927.238) (-926.293) (-926.142) -- 0:00:47
      299000 -- (-922.492) (-926.084) (-923.132) [-924.872] * [-924.895] (-922.143) (-923.851) (-924.962) -- 0:00:46
      299500 -- (-923.579) [-924.944] (-923.132) (-924.977) * [-923.290] (-931.268) (-924.160) (-928.119) -- 0:00:46
      300000 -- (-922.909) [-922.295] (-923.172) (-925.245) * [-925.813] (-929.430) (-926.645) (-923.098) -- 0:00:46

      Average standard deviation of split frequencies: 0.010883

      300500 -- (-928.826) (-923.265) (-930.742) [-924.531] * (-925.338) [-922.848] (-924.424) (-925.467) -- 0:00:46
      301000 -- (-927.723) [-923.669] (-923.112) (-925.075) * (-924.631) (-921.814) (-924.454) [-922.435] -- 0:00:46
      301500 -- (-926.088) (-923.324) [-924.437] (-922.861) * [-923.858] (-923.515) (-924.702) (-924.276) -- 0:00:46
      302000 -- (-923.177) (-923.321) [-924.531] (-922.388) * (-923.501) (-926.591) (-924.926) [-923.453] -- 0:00:46
      302500 -- (-925.227) (-922.517) [-926.250] (-923.169) * (-923.224) [-924.014] (-924.399) (-925.734) -- 0:00:46
      303000 -- (-927.361) (-926.716) [-924.796] (-924.320) * [-923.018] (-923.478) (-924.509) (-927.871) -- 0:00:46
      303500 -- (-923.958) (-923.625) (-923.054) [-923.370] * (-923.533) (-923.760) [-923.497] (-924.952) -- 0:00:45
      304000 -- (-925.794) [-924.229] (-923.576) (-923.057) * (-923.062) [-922.144] (-924.435) (-926.292) -- 0:00:45
      304500 -- (-922.909) (-928.165) (-926.243) [-923.160] * (-924.923) (-922.241) [-924.692] (-926.209) -- 0:00:45
      305000 -- (-922.783) [-924.242] (-924.893) (-924.191) * [-924.765] (-922.649) (-925.848) (-923.293) -- 0:00:45

      Average standard deviation of split frequencies: 0.010512

      305500 -- (-923.792) [-922.519] (-924.803) (-925.658) * (-922.791) [-922.385] (-926.989) (-924.221) -- 0:00:45
      306000 -- (-922.627) (-923.725) [-922.836] (-927.309) * [-922.871] (-921.874) (-924.184) (-926.410) -- 0:00:45
      306500 -- [-923.514] (-923.802) (-922.809) (-925.368) * [-922.641] (-921.711) (-924.189) (-928.315) -- 0:00:45
      307000 -- [-925.061] (-923.489) (-925.001) (-927.079) * (-922.156) (-925.628) (-922.662) [-925.738] -- 0:00:47
      307500 -- (-925.777) (-925.444) (-925.155) [-928.125] * (-922.924) (-932.149) (-923.446) [-922.904] -- 0:00:47
      308000 -- (-926.459) [-924.416] (-923.888) (-923.323) * (-922.463) (-930.459) (-923.553) [-926.539] -- 0:00:47
      308500 -- (-926.219) [-923.874] (-929.709) (-924.217) * (-923.525) (-925.510) (-922.838) [-922.979] -- 0:00:47
      309000 -- (-923.818) [-922.186] (-924.553) (-924.299) * (-925.553) [-921.833] (-923.317) (-924.092) -- 0:00:46
      309500 -- (-924.935) [-922.518] (-924.290) (-926.841) * [-924.616] (-924.416) (-925.599) (-925.219) -- 0:00:46
      310000 -- (-923.765) (-923.714) (-923.235) [-927.341] * (-923.481) (-926.652) [-925.354] (-924.075) -- 0:00:46

      Average standard deviation of split frequencies: 0.010800

      310500 -- (-930.785) (-922.069) (-923.090) [-925.414] * (-924.227) (-925.318) [-925.906] (-921.990) -- 0:00:46
      311000 -- (-930.493) [-928.475] (-927.168) (-925.745) * [-924.811] (-923.384) (-922.442) (-922.610) -- 0:00:46
      311500 -- (-929.699) (-924.758) (-925.221) [-922.944] * (-923.999) (-925.136) [-922.551] (-923.038) -- 0:00:46
      312000 -- (-923.774) (-923.809) (-928.308) [-925.897] * (-924.249) (-922.611) (-925.260) [-922.435] -- 0:00:46
      312500 -- (-924.075) (-922.702) (-924.729) [-922.937] * (-923.796) (-924.465) (-921.921) [-922.839] -- 0:00:46
      313000 -- (-923.753) (-926.708) [-925.309] (-924.822) * [-923.220] (-922.546) (-922.094) (-924.057) -- 0:00:46
      313500 -- (-923.381) (-923.895) [-925.210] (-926.652) * (-924.767) (-922.543) (-931.579) [-925.639] -- 0:00:45
      314000 -- (-924.686) (-924.231) (-923.226) [-927.350] * (-922.768) (-925.473) [-922.465] (-924.108) -- 0:00:45
      314500 -- (-923.235) (-924.360) [-924.993] (-930.801) * [-923.551] (-921.835) (-926.995) (-929.579) -- 0:00:45
      315000 -- (-925.507) (-922.341) [-923.693] (-923.812) * (-922.648) (-921.672) (-923.821) [-927.614] -- 0:00:45

      Average standard deviation of split frequencies: 0.011145

      315500 -- (-925.079) [-923.670] (-923.361) (-927.886) * [-922.331] (-923.153) (-923.555) (-923.336) -- 0:00:45
      316000 -- (-922.339) [-922.686] (-922.905) (-924.231) * (-924.849) [-922.061] (-922.505) (-923.662) -- 0:00:45
      316500 -- (-923.342) (-923.375) [-923.486] (-924.835) * (-929.173) (-924.509) (-922.267) [-924.986] -- 0:00:45
      317000 -- (-923.717) (-923.804) [-922.964] (-927.996) * (-924.732) (-924.233) [-925.915] (-924.844) -- 0:00:45
      317500 -- (-923.625) [-923.461] (-923.974) (-925.553) * (-923.768) [-923.420] (-924.945) (-923.635) -- 0:00:45
      318000 -- (-924.584) (-925.471) [-926.851] (-924.343) * (-924.040) (-923.842) [-924.117] (-927.915) -- 0:00:45
      318500 -- (-924.230) (-926.331) (-926.834) [-928.868] * (-923.825) [-924.464] (-923.709) (-928.235) -- 0:00:44
      319000 -- (-924.133) (-923.932) (-923.587) [-925.277] * (-923.456) (-926.451) [-922.282] (-924.713) -- 0:00:44
      319500 -- (-927.400) (-923.747) [-924.539] (-923.366) * (-923.162) [-924.778] (-922.854) (-922.506) -- 0:00:44
      320000 -- (-926.667) (-925.727) (-924.594) [-923.868] * (-928.444) (-923.182) (-922.115) [-924.580] -- 0:00:44

      Average standard deviation of split frequencies: 0.011242

      320500 -- (-923.837) (-923.647) [-922.999] (-924.198) * (-926.428) (-923.770) (-924.064) [-926.171] -- 0:00:44
      321000 -- (-923.471) (-922.050) [-922.153] (-923.534) * (-923.953) (-924.434) (-925.559) [-923.958] -- 0:00:44
      321500 -- (-923.810) (-923.238) [-922.310] (-925.092) * [-933.421] (-925.602) (-923.596) (-924.093) -- 0:00:44
      322000 -- (-923.537) (-926.032) [-924.987] (-925.214) * (-930.453) [-924.314] (-927.192) (-926.506) -- 0:00:44
      322500 -- (-923.712) [-923.903] (-924.160) (-923.869) * (-923.393) (-925.339) [-925.480] (-923.435) -- 0:00:44
      323000 -- (-925.157) (-923.721) (-922.738) [-924.403] * (-921.965) (-923.363) (-924.659) [-922.700] -- 0:00:44
      323500 -- (-925.272) (-925.075) (-923.492) [-923.961] * [-922.582] (-923.003) (-926.710) (-922.943) -- 0:00:43
      324000 -- (-926.172) (-925.871) [-923.055] (-925.375) * (-922.667) (-924.732) (-925.450) [-922.668] -- 0:00:45
      324500 -- (-924.886) (-925.158) (-926.946) [-927.500] * (-924.488) (-927.977) [-927.992] (-924.054) -- 0:00:45
      325000 -- [-926.690] (-927.370) (-928.156) (-926.856) * (-923.472) [-926.769] (-927.273) (-923.483) -- 0:00:45

      Average standard deviation of split frequencies: 0.011006

      325500 -- (-922.702) [-923.049] (-925.002) (-924.685) * [-923.293] (-924.000) (-922.621) (-924.419) -- 0:00:45
      326000 -- (-922.563) (-923.101) [-925.954] (-928.175) * (-926.005) (-925.204) [-925.087] (-923.900) -- 0:00:45
      326500 -- [-922.988] (-923.019) (-923.224) (-924.997) * (-924.882) (-926.622) [-923.224] (-923.371) -- 0:00:45
      327000 -- (-923.393) (-924.295) [-923.379] (-923.284) * (-923.190) (-925.094) (-925.942) [-926.304] -- 0:00:45
      327500 -- [-923.312] (-925.547) (-924.040) (-925.798) * (-924.374) [-925.485] (-928.238) (-922.444) -- 0:00:45
      328000 -- [-924.320] (-925.021) (-927.229) (-924.154) * (-922.272) (-923.650) [-923.867] (-922.477) -- 0:00:45
      328500 -- (-925.360) [-922.427] (-928.502) (-922.780) * [-921.831] (-924.955) (-925.276) (-922.500) -- 0:00:44
      329000 -- [-924.888] (-922.612) (-925.518) (-922.537) * (-922.450) [-924.801] (-923.145) (-922.839) -- 0:00:44
      329500 -- (-925.696) (-921.878) [-924.417] (-922.201) * (-923.715) (-923.000) (-923.219) [-923.424] -- 0:00:44
      330000 -- (-922.853) (-922.735) [-926.452] (-923.375) * (-922.622) [-923.528] (-922.006) (-924.388) -- 0:00:44

      Average standard deviation of split frequencies: 0.010613

      330500 -- [-925.147] (-925.198) (-925.116) (-922.594) * [-922.578] (-924.107) (-925.844) (-924.527) -- 0:00:44
      331000 -- (-924.879) (-924.064) [-922.572] (-923.856) * [-922.816] (-925.495) (-925.390) (-924.031) -- 0:00:44
      331500 -- (-924.079) [-925.057] (-922.694) (-925.433) * (-926.605) (-923.765) (-923.867) [-926.512] -- 0:00:44
      332000 -- (-923.058) (-923.424) [-923.683] (-926.095) * (-922.063) (-925.573) [-924.366] (-925.043) -- 0:00:44
      332500 -- (-925.810) [-924.375] (-923.714) (-924.699) * (-924.237) [-928.537] (-925.038) (-926.406) -- 0:00:44
      333000 -- (-925.704) (-923.029) [-925.590] (-925.621) * (-924.688) [-928.096] (-925.889) (-922.375) -- 0:00:44
      333500 -- (-923.005) [-922.599] (-928.791) (-923.673) * (-922.432) (-925.424) (-927.570) [-922.905] -- 0:00:43
      334000 -- (-926.183) (-924.384) (-925.725) [-922.738] * [-921.961] (-929.809) (-927.086) (-926.987) -- 0:00:43
      334500 -- (-924.532) (-923.348) (-922.561) [-922.922] * (-922.966) (-923.469) (-925.556) [-925.563] -- 0:00:43
      335000 -- (-926.887) (-926.062) [-923.090] (-922.700) * (-924.985) [-924.103] (-926.751) (-923.682) -- 0:00:43

      Average standard deviation of split frequencies: 0.009747

      335500 -- [-922.963] (-924.012) (-923.971) (-923.413) * (-928.016) (-925.161) (-925.612) [-923.675] -- 0:00:43
      336000 -- (-924.481) (-923.820) (-923.079) [-924.649] * (-922.271) (-926.659) (-922.852) [-924.077] -- 0:00:43
      336500 -- [-923.924] (-925.921) (-923.676) (-925.781) * [-923.494] (-928.992) (-924.144) (-924.177) -- 0:00:43
      337000 -- [-923.637] (-923.209) (-923.441) (-924.733) * [-922.530] (-924.040) (-925.528) (-926.563) -- 0:00:43
      337500 -- [-925.436] (-927.404) (-924.368) (-924.914) * (-925.335) [-923.165] (-922.801) (-924.660) -- 0:00:43
      338000 -- (-926.905) (-928.340) [-925.892] (-922.713) * (-923.965) (-924.409) [-925.313] (-922.451) -- 0:00:43
      338500 -- (-923.276) (-922.925) (-923.316) [-923.497] * (-923.434) [-924.243] (-923.077) (-924.115) -- 0:00:42
      339000 -- [-924.825] (-922.702) (-922.612) (-924.492) * [-925.204] (-924.035) (-924.132) (-927.145) -- 0:00:42
      339500 -- (-925.138) (-922.999) (-922.606) [-923.530] * (-927.458) (-924.604) (-925.301) [-925.826] -- 0:00:42
      340000 -- (-923.293) [-924.068] (-922.726) (-928.016) * [-923.532] (-924.304) (-926.579) (-923.900) -- 0:00:42

      Average standard deviation of split frequencies: 0.009840

      340500 -- [-923.734] (-923.403) (-923.801) (-928.466) * (-930.062) [-924.349] (-923.641) (-922.712) -- 0:00:44
      341000 -- (-922.801) [-922.209] (-925.739) (-928.217) * (-930.060) [-923.412] (-923.256) (-923.232) -- 0:00:44
      341500 -- (-922.910) (-921.931) [-923.067] (-922.450) * (-923.534) [-925.161] (-922.356) (-922.647) -- 0:00:44
      342000 -- [-923.151] (-921.999) (-925.682) (-922.823) * (-925.382) (-924.762) [-924.887] (-923.958) -- 0:00:44
      342500 -- (-926.719) (-923.008) (-924.603) [-922.725] * [-925.418] (-926.483) (-922.195) (-924.636) -- 0:00:44
      343000 -- [-923.783] (-923.039) (-925.856) (-923.744) * (-923.206) [-925.782] (-925.036) (-925.175) -- 0:00:44
      343500 -- [-923.231] (-922.461) (-925.223) (-925.002) * (-924.675) (-923.751) [-926.984] (-929.356) -- 0:00:43
      344000 -- [-922.841] (-922.376) (-927.579) (-925.616) * (-922.081) [-923.169] (-923.437) (-929.145) -- 0:00:43
      344500 -- (-924.816) (-927.255) [-922.690] (-928.493) * (-924.684) (-926.073) [-925.225] (-925.110) -- 0:00:43
      345000 -- (-922.451) (-923.670) (-924.022) [-924.758] * [-924.218] (-923.992) (-923.897) (-928.163) -- 0:00:43

      Average standard deviation of split frequencies: 0.009688

      345500 -- [-923.148] (-926.021) (-926.556) (-923.384) * (-925.322) [-924.339] (-926.457) (-922.331) -- 0:00:43
      346000 -- (-927.524) [-925.761] (-927.965) (-924.411) * (-924.415) [-924.809] (-925.015) (-926.264) -- 0:00:43
      346500 -- (-924.720) (-922.895) [-922.123] (-923.852) * (-925.215) [-922.333] (-923.737) (-926.169) -- 0:00:43
      347000 -- [-922.702] (-923.383) (-927.468) (-921.934) * [-923.123] (-922.826) (-922.280) (-926.784) -- 0:00:43
      347500 -- (-924.286) [-925.854] (-926.225) (-925.175) * [-923.373] (-923.205) (-926.659) (-922.311) -- 0:00:43
      348000 -- (-925.981) (-924.708) [-923.543] (-924.140) * (-923.743) (-923.121) (-924.084) [-923.004] -- 0:00:43
      348500 -- (-923.982) (-926.289) [-922.930] (-927.325) * (-926.338) (-925.004) (-922.415) [-923.444] -- 0:00:42
      349000 -- (-923.240) (-926.010) [-922.843] (-922.998) * (-923.016) (-926.259) (-924.575) [-923.331] -- 0:00:42
      349500 -- (-923.816) (-927.195) [-923.506] (-923.669) * (-926.629) (-925.292) (-925.010) [-924.242] -- 0:00:42
      350000 -- (-928.870) (-923.320) [-926.009] (-923.944) * [-926.431] (-922.545) (-924.442) (-923.501) -- 0:00:42

      Average standard deviation of split frequencies: 0.009858

      350500 -- (-926.021) (-922.193) (-925.472) [-922.285] * (-930.395) (-923.133) [-924.442] (-924.601) -- 0:00:42
      351000 -- (-924.156) (-922.991) (-924.183) [-926.785] * (-930.941) [-922.541] (-929.906) (-923.545) -- 0:00:42
      351500 -- [-925.128] (-922.212) (-924.466) (-924.799) * (-926.315) (-924.631) [-923.416] (-922.412) -- 0:00:42
      352000 -- (-924.243) (-934.057) [-923.692] (-924.991) * (-923.016) (-925.322) [-923.190] (-922.601) -- 0:00:42
      352500 -- (-922.498) (-925.079) (-921.875) [-924.452] * (-922.515) (-924.669) (-926.303) [-924.971] -- 0:00:42
      353000 -- (-922.417) (-926.024) (-923.403) [-925.621] * (-922.586) (-924.807) (-923.992) [-923.313] -- 0:00:42
      353500 -- (-922.014) (-922.945) (-921.792) [-924.390] * (-922.912) (-924.450) [-922.794] (-926.079) -- 0:00:42
      354000 -- (-922.767) (-926.101) (-922.763) [-926.853] * [-923.103] (-926.795) (-922.781) (-923.845) -- 0:00:41
      354500 -- (-924.684) (-924.719) [-923.024] (-922.054) * (-923.923) (-926.163) [-926.756] (-924.090) -- 0:00:41
      355000 -- (-925.943) (-927.292) [-922.986] (-924.128) * (-922.863) (-927.914) (-925.271) [-926.061] -- 0:00:41

      Average standard deviation of split frequencies: 0.009343

      355500 -- (-925.822) (-923.145) [-923.669] (-925.101) * (-922.945) (-927.413) [-924.492] (-926.993) -- 0:00:41
      356000 -- (-922.514) [-927.621] (-925.839) (-926.504) * (-923.450) (-923.080) [-923.353] (-924.935) -- 0:00:41
      356500 -- (-923.918) [-926.721] (-922.721) (-922.155) * (-923.663) (-923.953) [-922.740] (-923.397) -- 0:00:41
      357000 -- [-922.505] (-926.023) (-926.516) (-922.878) * (-923.845) [-924.068] (-923.620) (-923.655) -- 0:00:43
      357500 -- [-922.520] (-926.771) (-926.706) (-923.991) * (-926.522) (-922.945) [-925.327] (-925.520) -- 0:00:43
      358000 -- (-922.018) [-926.242] (-927.039) (-922.928) * (-925.378) [-928.552] (-926.084) (-926.990) -- 0:00:43
      358500 -- (-922.460) (-925.614) [-925.742] (-923.976) * (-926.082) (-928.049) [-923.442] (-923.842) -- 0:00:42
      359000 -- (-926.392) [-923.914] (-924.151) (-922.558) * (-925.600) [-924.435] (-924.519) (-925.930) -- 0:00:42
      359500 -- (-923.777) (-925.727) (-926.233) [-924.286] * (-925.525) (-924.814) [-927.670] (-926.205) -- 0:00:42
      360000 -- (-923.697) [-928.601] (-922.834) (-927.748) * [-923.239] (-923.455) (-924.318) (-923.825) -- 0:00:42

      Average standard deviation of split frequencies: 0.009222

      360500 -- [-922.858] (-925.680) (-924.683) (-929.803) * [-922.652] (-925.782) (-922.562) (-925.483) -- 0:00:42
      361000 -- (-924.649) (-923.138) [-924.541] (-924.931) * [-923.864] (-925.801) (-922.745) (-924.854) -- 0:00:42
      361500 -- [-924.041] (-922.792) (-922.883) (-925.816) * (-923.316) [-922.562] (-923.019) (-923.910) -- 0:00:42
      362000 -- (-922.341) [-922.676] (-923.721) (-923.775) * [-924.233] (-923.531) (-922.976) (-923.251) -- 0:00:42
      362500 -- (-923.798) (-922.520) (-926.159) [-926.224] * (-925.312) (-923.373) [-926.539] (-922.866) -- 0:00:42
      363000 -- (-926.043) [-921.822] (-923.533) (-926.764) * (-923.310) [-925.917] (-923.499) (-922.842) -- 0:00:42
      363500 -- [-924.973] (-924.019) (-923.212) (-925.314) * [-924.984] (-923.844) (-925.160) (-922.599) -- 0:00:42
      364000 -- (-924.360) [-930.346] (-923.705) (-925.774) * (-922.523) (-924.654) [-926.295] (-924.981) -- 0:00:41
      364500 -- (-923.227) [-926.214] (-930.158) (-924.875) * (-924.086) [-926.830] (-924.543) (-927.207) -- 0:00:41
      365000 -- [-925.031] (-930.823) (-926.300) (-930.212) * (-924.778) (-925.133) [-924.068] (-922.948) -- 0:00:41

      Average standard deviation of split frequencies: 0.009660

      365500 -- (-924.716) (-923.320) [-923.841] (-930.861) * [-924.549] (-925.993) (-924.021) (-923.181) -- 0:00:41
      366000 -- (-924.112) [-923.620] (-922.712) (-922.876) * (-922.167) (-926.781) (-925.095) [-922.759] -- 0:00:41
      366500 -- (-923.062) (-925.303) [-922.936] (-923.777) * (-923.318) (-924.462) [-922.093] (-923.745) -- 0:00:41
      367000 -- (-932.714) (-923.044) (-923.660) [-923.563] * (-926.361) (-926.438) [-923.962] (-922.389) -- 0:00:41
      367500 -- (-925.874) (-923.033) [-924.466] (-927.404) * (-926.550) (-924.869) [-927.537] (-924.021) -- 0:00:41
      368000 -- (-923.314) (-922.505) [-925.128] (-922.595) * (-923.423) [-922.753] (-929.214) (-926.857) -- 0:00:41
      368500 -- [-924.231] (-927.579) (-923.124) (-925.043) * (-922.436) (-922.509) (-923.475) [-924.908] -- 0:00:41
      369000 -- (-923.971) [-926.120] (-923.054) (-923.090) * (-923.305) (-924.120) (-923.180) [-924.968] -- 0:00:41
      369500 -- (-923.659) (-925.377) [-923.108] (-928.088) * (-923.435) [-925.127] (-924.565) (-923.943) -- 0:00:40
      370000 -- (-923.781) (-929.764) [-922.848] (-927.919) * (-922.345) [-925.151] (-928.609) (-922.310) -- 0:00:40

      Average standard deviation of split frequencies: 0.010457

      370500 -- (-925.394) [-923.444] (-923.090) (-924.139) * (-923.770) (-924.845) [-927.436] (-923.518) -- 0:00:40
      371000 -- (-930.314) (-924.693) (-922.691) [-927.071] * (-925.827) (-924.620) (-930.832) [-924.367] -- 0:00:40
      371500 -- (-926.362) [-925.648] (-923.436) (-925.882) * (-923.678) (-928.997) [-924.274] (-923.285) -- 0:00:40
      372000 -- (-922.439) (-930.255) [-922.601] (-922.789) * (-925.521) (-932.760) (-922.351) [-923.908] -- 0:00:40
      372500 -- (-922.303) [-923.638] (-923.941) (-924.001) * (-925.590) (-924.913) [-924.672] (-923.276) -- 0:00:40
      373000 -- (-922.320) (-924.310) [-925.036] (-923.840) * (-926.163) (-926.074) (-928.267) [-923.331] -- 0:00:40
      373500 -- (-924.474) [-927.389] (-925.129) (-924.847) * (-923.229) (-926.555) (-927.292) [-923.732] -- 0:00:41
      374000 -- [-921.862] (-926.343) (-925.450) (-922.240) * (-924.364) [-923.081] (-922.519) (-925.379) -- 0:00:41
      374500 -- (-921.996) [-930.944] (-930.828) (-922.309) * (-922.544) [-922.593] (-924.849) (-924.633) -- 0:00:41
      375000 -- (-923.863) (-924.859) (-922.952) [-922.886] * [-925.653] (-923.493) (-925.397) (-923.443) -- 0:00:41

      Average standard deviation of split frequencies: 0.010100

      375500 -- (-923.403) (-926.603) (-925.205) [-924.802] * (-922.706) (-923.554) (-925.107) [-922.926] -- 0:00:41
      376000 -- [-922.816] (-924.655) (-926.150) (-924.952) * [-923.517] (-928.462) (-925.514) (-922.713) -- 0:00:41
      376500 -- [-921.979] (-925.973) (-926.161) (-924.348) * [-924.492] (-932.780) (-924.355) (-922.035) -- 0:00:41
      377000 -- (-922.232) (-925.450) (-922.998) [-933.635] * (-924.581) (-929.942) [-923.715] (-927.101) -- 0:00:41
      377500 -- (-923.453) (-925.674) (-923.512) [-922.882] * (-925.844) (-926.158) (-922.512) [-924.833] -- 0:00:41
      378000 -- (-923.311) (-925.940) (-922.576) [-924.548] * (-924.044) (-922.627) [-925.384] (-922.763) -- 0:00:41
      378500 -- (-933.166) (-924.828) (-923.369) [-927.100] * (-923.618) [-923.518] (-922.511) (-931.124) -- 0:00:41
      379000 -- [-923.620] (-923.832) (-924.102) (-924.316) * [-923.339] (-922.850) (-928.811) (-923.256) -- 0:00:40
      379500 -- (-923.910) (-924.261) [-923.839] (-923.777) * (-924.709) (-922.654) [-922.705] (-926.974) -- 0:00:40
      380000 -- [-926.382] (-922.695) (-925.591) (-925.116) * (-923.091) (-923.122) [-925.045] (-923.291) -- 0:00:40

      Average standard deviation of split frequencies: 0.011489

      380500 -- (-930.391) (-922.967) (-922.769) [-923.158] * (-922.623) (-926.806) [-924.509] (-923.468) -- 0:00:40
      381000 -- (-925.839) [-923.545] (-925.933) (-923.047) * (-925.027) (-924.228) [-923.016] (-926.409) -- 0:00:40
      381500 -- (-923.208) (-924.962) (-927.669) [-921.746] * (-924.125) (-926.007) [-923.703] (-924.229) -- 0:00:40
      382000 -- (-925.889) [-923.731] (-925.525) (-923.933) * [-924.146] (-924.271) (-926.204) (-922.788) -- 0:00:40
      382500 -- (-925.296) (-925.618) (-923.239) [-924.478] * (-923.450) (-923.826) [-925.098] (-924.195) -- 0:00:40
      383000 -- (-926.350) [-923.843] (-923.662) (-923.374) * (-923.333) [-923.761] (-922.634) (-922.050) -- 0:00:40
      383500 -- (-922.334) (-926.147) (-926.928) [-923.666] * (-923.391) (-924.740) [-925.826] (-922.517) -- 0:00:40
      384000 -- (-922.245) (-925.508) [-923.935] (-925.084) * (-925.048) (-924.364) [-923.878] (-923.363) -- 0:00:40
      384500 -- [-926.449] (-923.319) (-925.015) (-933.362) * (-930.516) [-922.705] (-923.848) (-923.683) -- 0:00:40
      385000 -- (-924.570) (-923.508) [-923.949] (-924.952) * (-924.591) [-927.912] (-925.317) (-923.768) -- 0:00:39

      Average standard deviation of split frequencies: 0.010720

      385500 -- (-922.148) (-926.053) [-923.978] (-926.696) * (-922.771) (-925.827) (-925.901) [-922.449] -- 0:00:39
      386000 -- (-923.732) [-924.051] (-923.712) (-923.039) * (-924.528) (-924.605) [-922.549] (-922.461) -- 0:00:39
      386500 -- (-924.663) [-924.945] (-925.881) (-924.264) * [-925.065] (-922.363) (-923.519) (-922.759) -- 0:00:39
      387000 -- [-927.224] (-928.731) (-923.811) (-923.748) * [-923.704] (-922.288) (-924.848) (-923.920) -- 0:00:39
      387500 -- [-929.363] (-924.065) (-927.033) (-925.234) * (-923.800) (-923.697) (-923.698) [-922.963] -- 0:00:39
      388000 -- (-924.382) [-923.651] (-924.324) (-924.682) * [-925.724] (-923.700) (-927.352) (-922.566) -- 0:00:39
      388500 -- [-922.404] (-922.793) (-926.033) (-923.125) * (-925.037) (-925.419) (-923.741) [-923.280] -- 0:00:39
      389000 -- [-924.974] (-923.708) (-925.880) (-925.257) * (-925.168) (-928.377) [-922.186] (-925.482) -- 0:00:39
      389500 -- [-925.938] (-923.621) (-924.860) (-925.680) * (-926.476) (-923.090) [-922.905] (-932.763) -- 0:00:39
      390000 -- (-926.751) (-922.684) (-922.994) [-924.821] * (-923.901) (-924.105) [-924.809] (-928.692) -- 0:00:39

      Average standard deviation of split frequencies: 0.010525

      390500 -- (-924.513) (-922.578) (-923.816) [-922.677] * (-924.205) (-922.731) [-921.951] (-926.543) -- 0:00:40
      391000 -- [-926.552] (-926.684) (-925.342) (-923.198) * [-925.879] (-924.407) (-926.250) (-926.900) -- 0:00:40
      391500 -- [-924.228] (-928.451) (-926.251) (-926.478) * (-922.277) (-927.809) (-924.821) [-923.700] -- 0:00:40
      392000 -- (-925.915) (-925.269) (-927.237) [-923.103] * (-923.538) (-927.882) [-926.210] (-924.043) -- 0:00:40
      392500 -- (-928.819) (-928.875) [-923.864] (-924.061) * (-924.345) (-925.431) [-922.534] (-925.143) -- 0:00:40
      393000 -- (-923.261) (-924.981) [-924.512] (-924.035) * (-923.507) [-924.602] (-922.418) (-925.563) -- 0:00:40
      393500 -- (-922.811) (-923.338) (-923.666) [-922.997] * (-926.880) (-927.637) [-924.370] (-924.609) -- 0:00:40
      394000 -- [-927.889] (-922.841) (-927.241) (-927.993) * [-922.652] (-926.088) (-923.886) (-925.532) -- 0:00:39
      394500 -- (-925.207) (-924.816) (-924.067) [-926.176] * [-923.851] (-925.620) (-926.672) (-925.579) -- 0:00:39
      395000 -- (-932.058) (-922.982) (-924.692) [-925.257] * (-924.574) (-923.840) (-923.945) [-923.182] -- 0:00:39

      Average standard deviation of split frequencies: 0.010912

      395500 -- [-926.049] (-923.053) (-925.316) (-923.468) * (-922.203) [-922.993] (-924.551) (-927.389) -- 0:00:39
      396000 -- (-924.326) (-923.080) [-922.788] (-923.922) * (-923.096) (-922.768) (-922.348) [-925.786] -- 0:00:39
      396500 -- (-925.446) (-923.071) (-924.344) [-923.639] * (-923.629) (-922.908) [-922.168] (-925.903) -- 0:00:39
      397000 -- (-923.581) (-925.428) (-923.031) [-922.068] * (-922.959) (-923.715) [-924.569] (-924.328) -- 0:00:39
      397500 -- (-923.566) (-925.043) [-927.136] (-927.881) * (-925.374) [-923.619] (-922.838) (-925.233) -- 0:00:39
      398000 -- (-926.624) (-922.754) [-927.180] (-922.268) * (-927.348) [-926.299] (-923.594) (-925.887) -- 0:00:39
      398500 -- (-925.873) [-922.247] (-923.461) (-924.975) * [-924.024] (-923.943) (-924.213) (-924.858) -- 0:00:39
      399000 -- (-923.136) [-924.802] (-924.711) (-924.565) * (-923.030) (-926.959) [-927.075] (-925.553) -- 0:00:39
      399500 -- (-924.596) [-924.736] (-923.045) (-926.737) * (-923.038) [-922.160] (-925.140) (-924.962) -- 0:00:39
      400000 -- [-922.663] (-923.031) (-924.411) (-924.374) * [-926.645] (-924.330) (-925.491) (-922.121) -- 0:00:39

      Average standard deviation of split frequencies: 0.010458

      400500 -- (-924.343) [-926.208] (-924.542) (-927.227) * (-927.053) (-923.341) [-923.300] (-925.927) -- 0:00:38
      401000 -- (-924.154) (-922.821) (-924.012) [-926.050] * (-927.269) (-926.913) [-927.236] (-924.510) -- 0:00:38
      401500 -- [-922.486] (-922.814) (-925.446) (-928.163) * (-924.834) [-923.359] (-926.020) (-926.498) -- 0:00:38
      402000 -- (-922.669) (-925.138) (-922.754) [-924.801] * (-922.371) (-923.823) [-927.595] (-923.528) -- 0:00:38
      402500 -- (-926.538) (-924.747) [-922.125] (-923.960) * (-922.960) [-922.460] (-925.492) (-924.465) -- 0:00:38
      403000 -- (-928.709) (-928.503) [-925.463] (-923.600) * (-923.388) (-925.625) [-922.481] (-927.795) -- 0:00:38
      403500 -- (-925.402) [-924.932] (-923.317) (-924.628) * [-923.030] (-924.992) (-924.143) (-924.243) -- 0:00:38
      404000 -- (-923.359) [-923.023] (-924.654) (-926.818) * (-925.351) [-923.644] (-922.638) (-926.643) -- 0:00:38
      404500 -- (-924.141) [-922.817] (-924.530) (-931.470) * (-924.985) (-926.911) (-927.142) [-925.985] -- 0:00:38
      405000 -- (-926.378) [-924.506] (-923.831) (-924.059) * (-923.989) [-923.300] (-924.645) (-924.549) -- 0:00:38

      Average standard deviation of split frequencies: 0.010385

      405500 -- (-925.454) (-926.389) [-921.971] (-923.176) * (-922.742) (-923.120) (-923.699) [-923.105] -- 0:00:38
      406000 -- (-925.344) (-926.136) (-922.388) [-923.680] * (-924.572) (-922.941) [-925.087] (-922.670) -- 0:00:38
      406500 -- [-926.874] (-925.586) (-922.537) (-925.405) * (-926.716) [-922.636] (-924.164) (-925.267) -- 0:00:39
      407000 -- (-928.941) (-928.052) (-922.490) [-924.232] * (-927.941) [-923.633] (-924.835) (-922.966) -- 0:00:39
      407500 -- (-923.866) [-924.796] (-922.194) (-923.988) * (-923.882) [-926.005] (-928.630) (-924.249) -- 0:00:39
      408000 -- (-924.495) [-923.210] (-921.993) (-925.940) * (-922.392) [-923.976] (-925.191) (-928.659) -- 0:00:39
      408500 -- [-926.431] (-924.040) (-923.920) (-925.367) * (-922.628) [-924.474] (-926.445) (-927.205) -- 0:00:39
      409000 -- (-924.049) (-923.996) (-929.453) [-927.233] * (-927.127) [-924.399] (-923.789) (-924.599) -- 0:00:39
      409500 -- (-924.163) (-923.369) (-923.373) [-926.939] * (-923.651) (-928.522) [-924.166] (-923.835) -- 0:00:38
      410000 -- (-922.496) [-923.249] (-923.159) (-926.043) * (-924.444) (-923.860) [-926.743] (-926.076) -- 0:00:38

      Average standard deviation of split frequencies: 0.010140

      410500 -- (-922.221) (-925.707) [-926.099] (-925.339) * (-924.515) [-924.740] (-922.983) (-928.326) -- 0:00:38
      411000 -- (-924.133) (-927.774) [-932.232] (-923.868) * (-925.542) (-923.921) (-925.361) [-925.250] -- 0:00:38
      411500 -- (-925.916) [-924.161] (-927.125) (-924.245) * (-925.042) (-924.613) (-927.011) [-924.662] -- 0:00:38
      412000 -- (-926.240) (-923.449) (-922.419) [-924.437] * (-927.049) [-923.542] (-922.757) (-924.293) -- 0:00:38
      412500 -- (-922.753) (-927.951) [-923.466] (-926.223) * (-927.603) [-923.580] (-926.922) (-924.484) -- 0:00:38
      413000 -- (-923.878) [-922.245] (-924.568) (-929.445) * (-924.994) (-923.144) [-924.555] (-922.502) -- 0:00:38
      413500 -- (-923.907) (-923.260) (-923.309) [-923.315] * [-924.329] (-923.225) (-923.342) (-924.166) -- 0:00:38
      414000 -- [-924.002] (-923.455) (-925.695) (-924.531) * (-923.808) (-923.567) (-925.055) [-922.980] -- 0:00:38
      414500 -- (-923.217) (-922.833) (-925.787) [-924.448] * [-923.363] (-925.445) (-923.917) (-923.345) -- 0:00:38
      415000 -- (-922.846) (-923.163) [-923.276] (-927.430) * (-924.591) [-924.223] (-923.123) (-924.107) -- 0:00:38

      Average standard deviation of split frequencies: 0.009695

      415500 -- (-923.707) [-923.365] (-924.130) (-924.270) * (-922.273) (-924.888) (-924.332) [-923.771] -- 0:00:37
      416000 -- [-923.291] (-925.789) (-926.835) (-924.908) * (-924.894) [-925.327] (-931.849) (-923.858) -- 0:00:37
      416500 -- [-922.668] (-923.904) (-923.274) (-923.679) * (-922.561) (-928.754) (-923.860) [-924.773] -- 0:00:37
      417000 -- (-923.235) [-923.295] (-923.639) (-925.368) * (-923.048) (-924.657) (-923.354) [-922.941] -- 0:00:37
      417500 -- [-922.982] (-922.267) (-928.206) (-923.222) * (-926.388) (-928.965) [-924.273] (-922.769) -- 0:00:37
      418000 -- (-927.850) (-924.239) (-923.498) [-924.552] * (-925.427) (-922.415) (-928.230) [-922.245] -- 0:00:37
      418500 -- [-922.408] (-922.827) (-927.615) (-928.722) * (-924.947) [-923.942] (-925.747) (-922.662) -- 0:00:37
      419000 -- [-922.495] (-922.157) (-924.110) (-925.498) * (-928.945) (-924.410) (-924.791) [-926.095] -- 0:00:37
      419500 -- [-923.367] (-925.332) (-923.842) (-923.951) * (-927.545) (-925.136) [-924.436] (-927.298) -- 0:00:37
      420000 -- (-923.462) (-922.219) (-924.379) [-923.420] * (-923.380) (-923.082) (-924.218) [-922.486] -- 0:00:37

      Average standard deviation of split frequencies: 0.009774

      420500 -- (-922.492) (-923.087) (-928.944) [-925.300] * [-922.988] (-923.563) (-928.617) (-924.729) -- 0:00:37
      421000 -- (-922.784) [-924.495] (-925.797) (-923.741) * [-924.510] (-922.137) (-924.731) (-922.526) -- 0:00:37
      421500 -- (-922.028) (-923.472) (-928.024) [-925.777] * (-926.310) (-922.447) (-924.736) [-925.233] -- 0:00:37
      422000 -- [-921.812] (-925.233) (-928.048) (-925.412) * (-924.865) (-925.533) (-924.732) [-923.590] -- 0:00:36
      422500 -- [-921.865] (-926.919) (-923.042) (-928.175) * (-926.536) (-928.167) [-927.608] (-928.413) -- 0:00:36
      423000 -- [-921.812] (-928.270) (-924.721) (-923.203) * [-928.282] (-925.985) (-926.789) (-923.405) -- 0:00:38
      423500 -- (-925.454) (-927.230) (-923.913) [-928.210] * (-922.833) [-927.332] (-923.594) (-926.898) -- 0:00:38
      424000 -- (-927.989) (-922.891) [-923.467] (-923.385) * (-927.012) (-929.210) (-922.308) [-923.488] -- 0:00:38
      424500 -- (-926.818) (-925.724) [-922.656] (-926.480) * (-922.871) [-924.652] (-923.427) (-924.510) -- 0:00:37
      425000 -- [-924.606] (-924.837) (-923.056) (-924.244) * (-924.635) (-922.587) (-924.359) [-923.641] -- 0:00:37

      Average standard deviation of split frequencies: 0.010205

      425500 -- (-922.312) (-924.215) [-923.121] (-924.049) * (-922.367) (-926.314) (-922.490) [-925.516] -- 0:00:37
      426000 -- (-926.123) (-923.998) (-923.956) [-922.601] * [-922.325] (-924.764) (-922.209) (-924.137) -- 0:00:37
      426500 -- [-925.458] (-925.762) (-924.788) (-924.251) * (-923.613) (-928.884) [-922.595] (-923.328) -- 0:00:37
      427000 -- [-924.024] (-921.809) (-927.094) (-924.421) * (-925.462) [-922.335] (-922.629) (-923.243) -- 0:00:37
      427500 -- (-923.067) [-923.000] (-925.762) (-927.468) * [-925.624] (-924.934) (-926.314) (-922.102) -- 0:00:37
      428000 -- (-925.202) (-922.711) (-929.365) [-925.450] * [-923.770] (-924.759) (-927.813) (-923.106) -- 0:00:37
      428500 -- (-927.004) (-924.439) [-924.862] (-923.708) * [-926.864] (-923.447) (-925.641) (-929.971) -- 0:00:37
      429000 -- (-928.368) (-923.862) (-924.822) [-922.307] * (-923.990) (-928.661) [-922.375] (-924.153) -- 0:00:37
      429500 -- [-922.389] (-922.009) (-922.189) (-922.351) * [-924.456] (-925.667) (-923.058) (-923.578) -- 0:00:37
      430000 -- (-923.657) [-922.934] (-922.592) (-923.898) * (-925.298) [-923.388] (-923.618) (-923.818) -- 0:00:37

      Average standard deviation of split frequencies: 0.010216

      430500 -- [-924.568] (-923.320) (-923.199) (-925.749) * [-933.948] (-924.834) (-923.196) (-925.124) -- 0:00:37
      431000 -- [-923.961] (-923.758) (-926.977) (-925.513) * (-929.202) (-922.788) (-925.902) [-926.258] -- 0:00:36
      431500 -- [-923.242] (-924.357) (-923.416) (-925.353) * (-927.292) (-924.048) [-924.676] (-927.274) -- 0:00:36
      432000 -- (-923.733) (-929.224) (-923.076) [-924.008] * (-927.283) (-923.247) (-922.430) [-924.963] -- 0:00:36
      432500 -- (-922.795) [-924.721] (-922.919) (-922.051) * (-924.278) (-923.714) (-923.484) [-923.996] -- 0:00:36
      433000 -- (-923.702) (-924.786) [-925.853] (-927.727) * (-924.541) [-924.647] (-924.065) (-926.099) -- 0:00:36
      433500 -- (-924.181) (-925.550) [-924.274] (-932.060) * (-925.933) (-926.328) (-924.334) [-926.213] -- 0:00:36
      434000 -- (-924.540) [-925.015] (-927.042) (-932.473) * (-925.920) [-926.131] (-923.570) (-926.399) -- 0:00:36
      434500 -- (-922.814) (-923.718) [-927.530] (-927.429) * [-925.827] (-924.243) (-925.373) (-923.342) -- 0:00:36
      435000 -- [-922.116] (-924.649) (-926.079) (-927.514) * [-923.117] (-923.206) (-925.761) (-925.395) -- 0:00:36

      Average standard deviation of split frequencies: 0.010572

      435500 -- (-923.185) (-923.295) (-925.677) [-923.768] * (-923.785) (-923.237) (-925.309) [-922.684] -- 0:00:36
      436000 -- (-923.269) (-923.367) (-926.536) [-924.457] * (-925.472) (-923.042) [-923.394] (-922.744) -- 0:00:36
      436500 -- [-923.739] (-928.442) (-925.612) (-930.275) * (-925.128) [-926.329] (-923.951) (-924.466) -- 0:00:36
      437000 -- [-924.823] (-924.325) (-923.016) (-933.081) * (-924.879) [-924.391] (-923.710) (-922.167) -- 0:00:36
      437500 -- [-924.124] (-926.211) (-923.427) (-923.918) * [-924.382] (-923.298) (-924.479) (-922.299) -- 0:00:36
      438000 -- (-925.272) (-923.947) (-924.556) [-927.599] * (-923.338) (-923.146) (-924.583) [-922.189] -- 0:00:35
      438500 -- [-923.014] (-922.661) (-925.640) (-928.504) * (-922.336) [-926.811] (-924.182) (-925.515) -- 0:00:35
      439000 -- (-922.876) (-922.443) [-925.107] (-929.194) * [-922.680] (-924.821) (-925.536) (-923.468) -- 0:00:35
      439500 -- (-924.819) [-922.573] (-926.548) (-923.896) * (-923.436) [-926.812] (-924.743) (-921.695) -- 0:00:36
      440000 -- (-922.956) (-922.522) (-929.526) [-923.181] * (-924.088) [-927.586] (-927.838) (-923.232) -- 0:00:36

      Average standard deviation of split frequencies: 0.010282

      440500 -- [-925.912] (-923.877) (-923.553) (-926.351) * [-923.603] (-924.204) (-927.837) (-923.716) -- 0:00:36
      441000 -- (-922.489) (-928.300) [-923.175] (-926.533) * (-923.628) [-922.375] (-922.670) (-927.231) -- 0:00:36
      441500 -- (-923.048) [-922.254] (-922.588) (-925.912) * (-927.387) (-923.110) (-923.794) [-923.397] -- 0:00:36
      442000 -- (-924.048) (-923.520) (-923.317) [-925.408] * (-924.850) (-925.272) [-924.412] (-923.478) -- 0:00:36
      442500 -- (-926.375) (-923.622) [-923.245] (-926.959) * (-925.625) (-926.222) (-923.742) [-923.353] -- 0:00:36
      443000 -- (-924.231) [-922.557] (-926.112) (-926.605) * (-922.549) [-926.224] (-923.254) (-923.259) -- 0:00:36
      443500 -- (-932.785) (-923.697) (-924.023) [-924.278] * [-924.337] (-922.850) (-923.106) (-923.659) -- 0:00:36
      444000 -- (-922.851) (-924.528) (-924.221) [-922.724] * (-924.104) (-929.865) [-923.360] (-924.715) -- 0:00:36
      444500 -- (-922.768) (-924.767) (-923.271) [-924.130] * (-923.845) [-923.897] (-923.431) (-924.453) -- 0:00:36
      445000 -- (-924.245) [-924.296] (-926.026) (-926.585) * (-922.872) [-923.112] (-922.782) (-927.584) -- 0:00:36

      Average standard deviation of split frequencies: 0.009454

      445500 -- (-924.628) [-923.932] (-923.715) (-924.041) * [-922.156] (-923.390) (-923.757) (-926.575) -- 0:00:36
      446000 -- (-925.575) [-924.099] (-922.401) (-923.829) * [-924.199] (-923.973) (-924.195) (-924.548) -- 0:00:36
      446500 -- (-923.965) (-923.666) (-924.642) [-925.944] * (-923.403) [-925.368] (-924.825) (-926.841) -- 0:00:35
      447000 -- [-922.996] (-926.796) (-924.192) (-924.900) * (-924.750) [-922.295] (-922.594) (-924.360) -- 0:00:35
      447500 -- [-924.091] (-925.929) (-925.958) (-928.073) * (-922.272) (-923.748) (-924.097) [-924.568] -- 0:00:35
      448000 -- [-923.287] (-921.947) (-923.128) (-923.369) * (-922.240) (-929.468) (-923.381) [-922.041] -- 0:00:35
      448500 -- (-924.299) [-921.973] (-925.569) (-923.413) * [-923.955] (-923.309) (-923.120) (-923.588) -- 0:00:35
      449000 -- (-923.685) (-925.368) [-927.048] (-924.087) * (-923.108) (-928.216) (-923.490) [-922.794] -- 0:00:35
      449500 -- (-926.030) (-927.465) (-923.708) [-922.640] * (-927.551) (-927.681) (-923.475) [-922.761] -- 0:00:35
      450000 -- (-924.940) (-929.915) [-923.763] (-922.710) * (-924.558) [-925.300] (-926.234) (-922.284) -- 0:00:35

      Average standard deviation of split frequencies: 0.010829

      450500 -- (-928.528) [-924.577] (-924.169) (-923.089) * (-928.570) [-923.771] (-925.331) (-922.190) -- 0:00:35
      451000 -- (-925.495) [-923.149] (-923.993) (-922.186) * (-924.451) (-924.312) [-924.122] (-923.366) -- 0:00:35
      451500 -- (-922.343) (-924.965) [-923.869] (-922.657) * [-923.231] (-925.004) (-926.378) (-924.729) -- 0:00:35
      452000 -- (-927.217) (-922.417) (-924.604) [-924.860] * (-924.429) (-923.468) [-925.311] (-924.455) -- 0:00:35
      452500 -- (-925.170) (-924.410) [-924.642] (-924.961) * [-925.615] (-922.034) (-934.446) (-928.600) -- 0:00:35
      453000 -- (-923.304) (-922.842) (-923.577) [-924.090] * [-923.872] (-924.276) (-922.909) (-924.361) -- 0:00:35
      453500 -- (-928.019) [-922.024] (-924.610) (-923.003) * (-924.419) (-922.828) (-924.178) [-924.193] -- 0:00:34
      454000 -- [-924.421] (-925.067) (-923.340) (-925.733) * [-924.076] (-923.886) (-925.412) (-923.509) -- 0:00:34
      454500 -- (-924.894) (-924.617) (-922.659) [-923.892] * (-925.475) [-925.567] (-925.645) (-922.743) -- 0:00:34
      455000 -- (-923.324) (-926.499) (-931.466) [-922.567] * (-923.238) (-922.207) (-922.246) [-922.809] -- 0:00:34

      Average standard deviation of split frequencies: 0.010763

      455500 -- (-922.326) (-927.417) [-925.158] (-925.795) * (-927.769) [-922.211] (-922.374) (-923.557) -- 0:00:34
      456000 -- (-923.048) (-924.488) [-924.743] (-924.162) * (-923.871) [-922.354] (-923.753) (-926.711) -- 0:00:35
      456500 -- (-925.417) (-923.466) [-924.340] (-925.345) * (-924.677) (-924.116) [-922.349] (-923.633) -- 0:00:35
      457000 -- [-923.667] (-926.404) (-926.887) (-927.725) * (-924.614) [-927.036] (-923.627) (-924.710) -- 0:00:35
      457500 -- (-927.699) [-923.764] (-922.986) (-928.505) * (-926.346) (-925.268) [-925.959] (-926.685) -- 0:00:35
      458000 -- (-926.022) (-924.458) [-922.569] (-922.454) * (-925.703) (-923.237) (-922.064) [-924.137] -- 0:00:35
      458500 -- (-925.398) [-924.035] (-926.924) (-922.539) * (-923.147) (-923.849) [-923.934] (-928.249) -- 0:00:35
      459000 -- [-926.483] (-923.087) (-924.507) (-934.201) * (-926.429) (-924.717) [-925.009] (-923.241) -- 0:00:35
      459500 -- [-925.354] (-922.404) (-925.669) (-923.015) * (-925.272) [-926.707] (-924.433) (-923.486) -- 0:00:35
      460000 -- [-926.851] (-923.554) (-925.387) (-922.189) * (-926.791) (-929.924) [-922.851] (-922.560) -- 0:00:35

      Average standard deviation of split frequencies: 0.009571

      460500 -- [-923.668] (-928.995) (-923.710) (-922.995) * (-928.795) (-927.060) (-923.107) [-922.677] -- 0:00:35
      461000 -- (-924.187) [-923.862] (-924.063) (-923.379) * (-925.475) (-930.407) (-924.865) [-922.591] -- 0:00:35
      461500 -- (-933.361) (-921.985) [-923.381] (-923.273) * (-925.822) (-923.764) [-923.225] (-925.659) -- 0:00:35
      462000 -- (-923.391) (-922.505) [-923.184] (-922.789) * (-924.187) (-924.236) (-922.867) [-923.092] -- 0:00:34
      462500 -- [-923.544] (-925.069) (-924.770) (-922.851) * (-924.341) [-926.031] (-922.052) (-922.564) -- 0:00:34
      463000 -- (-929.282) (-927.192) [-925.804] (-922.877) * (-922.852) (-926.691) (-924.490) [-927.854] -- 0:00:34
      463500 -- (-922.814) [-925.586] (-924.741) (-923.092) * [-922.180] (-925.645) (-924.763) (-923.199) -- 0:00:34
      464000 -- (-925.638) (-923.461) (-922.234) [-923.175] * (-923.260) (-927.718) (-922.603) [-922.288] -- 0:00:34
      464500 -- [-924.966] (-922.512) (-926.154) (-925.367) * (-924.371) (-928.325) (-923.668) [-924.219] -- 0:00:34
      465000 -- (-925.678) [-923.983] (-922.678) (-924.229) * (-925.447) (-926.335) (-924.011) [-921.979] -- 0:00:34

      Average standard deviation of split frequencies: 0.008926

      465500 -- (-922.394) (-927.606) (-925.899) [-924.066] * (-925.596) [-926.742] (-922.923) (-924.022) -- 0:00:34
      466000 -- (-923.918) (-925.300) (-922.946) [-921.959] * (-924.976) [-924.935] (-923.827) (-923.339) -- 0:00:34
      466500 -- [-925.046] (-925.986) (-923.448) (-923.702) * (-928.646) (-921.983) [-924.718] (-922.472) -- 0:00:34
      467000 -- [-922.751] (-924.480) (-923.740) (-923.111) * [-926.120] (-925.175) (-923.035) (-923.229) -- 0:00:34
      467500 -- (-925.321) (-925.667) (-926.166) [-923.645] * (-924.443) (-922.464) [-922.754] (-922.796) -- 0:00:34
      468000 -- (-925.003) [-924.422] (-926.859) (-922.508) * (-928.124) (-923.588) (-921.913) [-923.214] -- 0:00:34
      468500 -- (-927.290) (-929.277) [-923.005] (-923.468) * (-928.845) (-928.755) (-921.772) [-922.744] -- 0:00:34
      469000 -- (-925.337) (-927.186) (-924.214) [-923.475] * [-923.717] (-925.375) (-922.495) (-923.759) -- 0:00:33
      469500 -- (-924.229) [-925.003] (-923.020) (-925.013) * (-924.768) (-925.794) (-922.196) [-924.638] -- 0:00:33
      470000 -- (-924.574) (-922.912) [-922.160] (-923.442) * (-925.388) (-925.880) [-923.023] (-925.337) -- 0:00:33

      Average standard deviation of split frequencies: 0.009191

      470500 -- [-922.753] (-926.845) (-926.879) (-926.173) * [-925.985] (-924.203) (-924.382) (-922.980) -- 0:00:33
      471000 -- (-924.795) [-923.317] (-923.489) (-926.774) * (-924.548) [-925.778] (-927.897) (-924.263) -- 0:00:33
      471500 -- (-927.701) (-923.110) (-924.200) [-930.225] * (-922.738) (-923.724) (-924.078) [-922.435] -- 0:00:33
      472000 -- (-926.961) (-924.504) [-925.747] (-925.785) * (-923.137) [-924.396] (-922.442) (-923.496) -- 0:00:33
      472500 -- (-928.022) [-924.477] (-925.437) (-924.600) * (-922.155) [-924.694] (-924.486) (-924.882) -- 0:00:34
      473000 -- (-921.943) [-923.895] (-923.694) (-925.942) * (-922.569) (-923.272) (-923.835) [-926.651] -- 0:00:34
      473500 -- (-923.675) [-924.171] (-923.746) (-923.136) * (-924.792) [-922.670] (-922.447) (-923.747) -- 0:00:34
      474000 -- [-923.567] (-922.810) (-925.968) (-927.372) * (-924.005) (-923.497) [-923.737] (-931.735) -- 0:00:34
      474500 -- (-927.593) (-924.413) (-923.389) [-924.333] * [-922.714] (-928.335) (-922.087) (-923.990) -- 0:00:34
      475000 -- (-928.445) [-925.305] (-923.410) (-924.817) * [-922.506] (-923.359) (-922.288) (-923.325) -- 0:00:34

      Average standard deviation of split frequencies: 0.009463

      475500 -- (-927.366) (-926.641) (-924.383) [-922.499] * (-922.419) (-923.277) [-922.700] (-922.173) -- 0:00:34
      476000 -- [-925.533] (-922.991) (-925.370) (-926.068) * (-923.450) (-926.774) [-922.854] (-922.418) -- 0:00:34
      476500 -- (-924.580) (-925.615) [-924.692] (-927.198) * (-924.004) (-928.440) (-925.211) [-924.447] -- 0:00:34
      477000 -- (-928.016) [-924.880] (-922.286) (-925.308) * (-924.279) [-927.011] (-929.520) (-922.732) -- 0:00:33
      477500 -- (-923.089) (-924.897) (-924.202) [-927.633] * (-923.502) (-926.714) (-925.009) [-924.274] -- 0:00:33
      478000 -- [-922.382] (-923.788) (-924.383) (-922.593) * (-922.588) [-922.659] (-926.363) (-922.431) -- 0:00:33
      478500 -- (-922.808) (-923.537) [-926.948] (-925.306) * (-922.568) [-923.426] (-922.668) (-922.267) -- 0:00:33
      479000 -- (-925.600) (-924.144) (-925.390) [-923.848] * (-924.961) [-923.880] (-922.895) (-923.696) -- 0:00:33
      479500 -- (-924.714) (-924.742) [-924.046] (-923.252) * (-924.708) (-925.821) (-923.686) [-922.414] -- 0:00:33
      480000 -- (-923.475) [-924.918] (-923.312) (-923.589) * (-923.034) [-925.318] (-925.097) (-922.061) -- 0:00:33

      Average standard deviation of split frequencies: 0.009692

      480500 -- (-925.809) (-925.056) (-923.719) [-926.828] * [-923.184] (-924.535) (-922.298) (-923.351) -- 0:00:33
      481000 -- (-922.234) [-925.437] (-926.750) (-924.182) * (-922.733) [-923.164] (-922.712) (-923.119) -- 0:00:33
      481500 -- [-922.160] (-925.318) (-923.232) (-923.449) * (-922.374) (-922.418) [-922.257] (-923.702) -- 0:00:33
      482000 -- (-923.341) (-925.085) (-924.510) [-922.590] * [-926.339] (-924.761) (-926.559) (-923.179) -- 0:00:33
      482500 -- (-924.152) [-926.145] (-924.277) (-925.045) * (-924.009) [-923.012] (-924.273) (-924.532) -- 0:00:33
      483000 -- (-922.470) [-925.775] (-924.412) (-924.095) * (-923.697) (-922.901) (-923.822) [-923.572] -- 0:00:33
      483500 -- (-927.333) [-922.632] (-924.069) (-923.921) * (-923.531) [-924.610] (-926.132) (-924.416) -- 0:00:33
      484000 -- (-924.076) (-925.549) (-929.359) [-922.538] * (-923.089) (-923.450) [-922.482] (-928.371) -- 0:00:33
      484500 -- (-923.697) (-925.709) [-924.185] (-922.667) * (-923.606) (-925.293) [-923.555] (-925.805) -- 0:00:32
      485000 -- (-922.477) (-925.325) [-926.514] (-927.022) * (-926.120) [-925.077] (-922.987) (-925.745) -- 0:00:32

      Average standard deviation of split frequencies: 0.009322

      485500 -- (-923.839) [-923.600] (-927.296) (-922.012) * (-923.912) (-924.480) (-922.953) [-924.143] -- 0:00:32
      486000 -- (-928.110) (-928.199) (-926.006) [-924.965] * (-923.595) (-923.723) [-922.677] (-924.561) -- 0:00:32
      486500 -- (-925.024) [-926.408] (-922.199) (-930.745) * (-925.588) (-922.529) [-924.601] (-923.131) -- 0:00:32
      487000 -- (-922.292) (-923.827) (-924.854) [-923.367] * (-923.781) [-925.004] (-924.236) (-924.664) -- 0:00:32
      487500 -- (-924.212) [-926.927] (-924.245) (-923.030) * [-923.204] (-922.501) (-924.422) (-926.252) -- 0:00:32
      488000 -- (-923.059) (-924.319) [-923.489] (-923.763) * [-923.657] (-927.206) (-924.028) (-928.680) -- 0:00:32
      488500 -- (-922.529) (-922.547) [-922.776] (-925.102) * (-922.108) (-923.182) (-924.526) [-924.641] -- 0:00:32
      489000 -- (-923.277) [-922.595] (-925.129) (-925.798) * (-923.002) (-926.589) (-922.531) [-922.375] -- 0:00:33
      489500 -- (-923.448) (-924.536) [-922.734] (-923.516) * [-922.928] (-927.249) (-922.700) (-923.321) -- 0:00:33
      490000 -- (-924.998) [-924.307] (-923.162) (-926.428) * [-922.655] (-924.119) (-923.510) (-924.823) -- 0:00:33

      Average standard deviation of split frequencies: 0.009890

      490500 -- [-925.201] (-922.844) (-924.324) (-922.778) * [-922.932] (-928.586) (-923.573) (-922.628) -- 0:00:33
      491000 -- [-923.577] (-924.395) (-924.374) (-922.537) * [-925.478] (-923.693) (-925.016) (-922.828) -- 0:00:33
      491500 -- (-922.170) (-922.213) [-922.846] (-922.882) * (-925.342) (-923.347) (-924.588) [-924.611] -- 0:00:33
      492000 -- (-923.098) (-924.626) (-923.406) [-927.372] * (-924.255) (-922.390) [-927.623] (-927.216) -- 0:00:33
      492500 -- [-922.122] (-924.049) (-924.893) (-930.665) * (-927.634) [-924.803] (-923.885) (-924.280) -- 0:00:32
      493000 -- (-924.954) (-922.155) [-923.958] (-924.467) * (-928.417) [-924.122] (-924.475) (-926.280) -- 0:00:32
      493500 -- (-922.611) (-923.497) (-923.509) [-925.405] * [-927.633] (-926.375) (-924.349) (-924.646) -- 0:00:32
      494000 -- (-923.783) (-927.144) (-926.243) [-923.220] * [-922.741] (-929.321) (-929.020) (-922.702) -- 0:00:32
      494500 -- [-924.154] (-926.814) (-922.506) (-923.879) * (-926.798) [-925.556] (-923.313) (-922.668) -- 0:00:32
      495000 -- [-924.407] (-926.289) (-924.301) (-927.443) * (-924.103) (-924.680) [-922.673] (-921.974) -- 0:00:32

      Average standard deviation of split frequencies: 0.009336

      495500 -- (-926.441) [-924.109] (-929.880) (-923.631) * (-926.609) (-924.808) (-921.964) [-924.128] -- 0:00:32
      496000 -- [-923.315] (-923.323) (-925.380) (-922.410) * [-928.344] (-922.641) (-922.894) (-921.981) -- 0:00:32
      496500 -- (-923.035) [-924.053] (-925.441) (-922.486) * (-927.053) [-923.225] (-923.513) (-922.159) -- 0:00:32
      497000 -- (-924.231) (-929.410) (-923.318) [-923.021] * (-924.994) (-924.070) (-926.340) [-923.613] -- 0:00:32
      497500 -- (-925.327) [-924.484] (-923.349) (-922.926) * (-924.863) (-924.647) (-922.881) [-922.190] -- 0:00:32
      498000 -- [-925.038] (-925.325) (-922.660) (-923.014) * [-922.815] (-925.554) (-927.228) (-923.730) -- 0:00:32
      498500 -- (-923.672) [-923.406] (-922.971) (-921.811) * [-924.827] (-923.438) (-926.278) (-928.616) -- 0:00:32
      499000 -- (-929.654) (-922.548) (-923.204) [-922.306] * (-925.114) (-924.723) [-925.049] (-922.464) -- 0:00:32
      499500 -- (-923.236) (-923.061) (-927.263) [-924.534] * (-926.841) [-922.905] (-924.631) (-923.494) -- 0:00:32
      500000 -- [-921.677] (-922.568) (-926.701) (-922.414) * (-926.706) [-923.675] (-927.542) (-925.940) -- 0:00:32

      Average standard deviation of split frequencies: 0.009526

      500500 -- [-921.977] (-922.895) (-926.760) (-922.654) * [-925.547] (-923.830) (-925.867) (-924.124) -- 0:00:31
      501000 -- [-923.364] (-923.404) (-922.203) (-922.965) * (-926.950) (-922.233) (-925.826) [-922.564] -- 0:00:31
      501500 -- [-922.610] (-924.778) (-923.395) (-924.347) * (-924.195) [-922.569] (-924.117) (-923.359) -- 0:00:31
      502000 -- (-924.387) (-924.942) [-924.110] (-925.423) * (-923.309) [-923.377] (-922.838) (-924.000) -- 0:00:31
      502500 -- (-925.719) (-925.371) [-925.622] (-931.025) * (-925.170) (-924.993) [-922.330] (-926.113) -- 0:00:31
      503000 -- [-924.883] (-922.746) (-922.564) (-924.119) * (-925.628) [-926.993] (-922.889) (-923.054) -- 0:00:31
      503500 -- (-925.783) (-922.868) [-922.364] (-923.292) * (-927.101) (-924.384) (-925.827) [-922.172] -- 0:00:31
      504000 -- (-925.769) (-922.834) [-924.532] (-922.611) * [-924.315] (-930.540) (-926.197) (-922.159) -- 0:00:31
      504500 -- (-923.017) (-925.257) (-927.727) [-923.143] * (-924.155) (-928.524) [-925.084] (-922.322) -- 0:00:31
      505000 -- [-922.992] (-924.388) (-924.507) (-923.862) * (-927.272) [-925.889] (-923.226) (-926.187) -- 0:00:31

      Average standard deviation of split frequencies: 0.009523

      505500 -- (-924.555) (-925.659) [-922.746] (-924.146) * (-927.683) (-929.180) [-926.074] (-923.933) -- 0:00:31
      506000 -- [-922.622] (-923.522) (-922.735) (-925.873) * [-923.603] (-926.060) (-924.462) (-922.969) -- 0:00:32
      506500 -- (-922.466) [-921.979] (-922.031) (-923.935) * (-928.707) (-924.045) (-924.492) [-922.122] -- 0:00:32
      507000 -- (-925.953) (-922.253) [-924.908] (-922.725) * (-925.659) (-926.112) [-922.470] (-927.972) -- 0:00:32
      507500 -- (-924.623) (-922.313) (-922.912) [-927.091] * (-924.802) (-922.963) (-924.577) [-922.482] -- 0:00:32
      508000 -- (-927.156) [-923.250] (-922.934) (-923.440) * (-923.832) [-923.974] (-927.740) (-923.528) -- 0:00:31
      508500 -- (-924.614) (-926.373) [-926.228] (-925.313) * [-926.153] (-922.404) (-924.372) (-926.885) -- 0:00:31
      509000 -- [-923.332] (-923.667) (-923.574) (-924.635) * (-922.057) (-924.931) (-922.449) [-926.309] -- 0:00:31
      509500 -- (-924.594) (-922.974) [-925.302] (-923.503) * (-924.306) (-925.315) [-926.426] (-923.622) -- 0:00:31
      510000 -- (-922.413) (-923.148) (-928.094) [-922.673] * [-925.635] (-923.098) (-926.501) (-922.261) -- 0:00:31

      Average standard deviation of split frequencies: 0.009231

      510500 -- (-925.154) [-922.967] (-924.240) (-923.245) * (-928.280) (-926.149) [-925.193] (-923.604) -- 0:00:31
      511000 -- (-924.033) (-923.784) (-924.617) [-924.780] * (-926.740) [-922.860] (-925.678) (-923.819) -- 0:00:31
      511500 -- [-923.040] (-922.578) (-923.891) (-923.059) * (-926.645) (-925.102) [-923.324] (-935.423) -- 0:00:31
      512000 -- (-925.323) (-926.110) (-923.853) [-924.082] * (-927.043) (-923.477) [-924.670] (-926.184) -- 0:00:31
      512500 -- (-924.677) [-923.664] (-924.315) (-923.313) * (-922.750) (-924.352) [-923.102] (-925.978) -- 0:00:31
      513000 -- [-924.609] (-932.999) (-924.424) (-924.084) * (-929.735) (-925.054) (-923.205) [-925.944] -- 0:00:31
      513500 -- (-923.077) [-925.738] (-924.827) (-922.597) * (-923.822) (-926.469) [-922.528] (-929.757) -- 0:00:31
      514000 -- (-925.265) (-924.165) (-924.194) [-922.704] * [-926.257] (-924.920) (-924.058) (-926.104) -- 0:00:31
      514500 -- (-923.525) (-922.664) [-923.115] (-925.747) * (-925.125) (-922.775) (-922.237) [-922.413] -- 0:00:31
      515000 -- (-923.837) [-924.710] (-922.615) (-926.387) * [-926.133] (-923.911) (-924.303) (-922.862) -- 0:00:31

      Average standard deviation of split frequencies: 0.008933

      515500 -- [-922.513] (-925.407) (-922.686) (-923.980) * [-923.046] (-926.944) (-925.176) (-923.891) -- 0:00:31
      516000 -- [-922.548] (-924.110) (-923.943) (-923.511) * (-924.583) (-924.453) (-922.328) [-923.540] -- 0:00:30
      516500 -- (-922.538) (-923.574) (-922.616) [-922.816] * [-925.387] (-924.942) (-923.817) (-923.160) -- 0:00:30
      517000 -- (-924.391) (-923.677) (-924.274) [-924.088] * [-922.682] (-923.275) (-926.989) (-924.253) -- 0:00:30
      517500 -- (-925.833) (-926.047) [-922.231] (-924.231) * [-924.739] (-922.189) (-923.379) (-922.790) -- 0:00:30
      518000 -- (-922.492) (-924.920) (-923.464) [-924.358] * (-926.163) (-923.732) [-923.074] (-923.649) -- 0:00:30
      518500 -- [-922.709] (-924.118) (-924.185) (-924.683) * [-924.002] (-922.348) (-922.676) (-922.337) -- 0:00:30
      519000 -- [-923.290] (-923.598) (-924.706) (-925.064) * (-926.390) (-923.120) [-923.079] (-924.149) -- 0:00:30
      519500 -- (-925.475) (-927.138) [-925.132] (-923.455) * (-929.325) (-923.472) (-925.048) [-922.187] -- 0:00:30
      520000 -- [-923.036] (-923.194) (-926.351) (-924.930) * (-926.879) (-923.250) (-923.436) [-925.390] -- 0:00:30

      Average standard deviation of split frequencies: 0.008894

      520500 -- (-923.147) (-923.223) (-925.224) [-923.199] * [-928.936] (-922.565) (-925.114) (-924.177) -- 0:00:30
      521000 -- (-923.039) (-924.820) (-925.314) [-923.245] * (-923.182) [-923.417] (-925.115) (-922.716) -- 0:00:30
      521500 -- (-921.824) (-927.604) [-922.682] (-924.102) * (-923.844) [-924.026] (-924.927) (-922.116) -- 0:00:30
      522000 -- (-925.167) (-924.846) [-922.180] (-924.442) * (-923.113) [-925.997] (-925.195) (-923.114) -- 0:00:30
      522500 -- (-924.783) (-924.575) (-923.015) [-922.708] * [-923.544] (-926.484) (-923.291) (-925.841) -- 0:00:31
      523000 -- (-925.000) (-924.527) [-924.287] (-922.058) * (-923.718) (-925.246) [-925.710] (-922.649) -- 0:00:31
      523500 -- (-923.211) (-923.413) (-923.572) [-922.024] * (-923.244) (-926.772) (-922.544) [-922.665] -- 0:00:30
      524000 -- (-924.333) (-922.960) (-922.352) [-923.042] * (-922.590) (-925.007) (-923.643) [-924.787] -- 0:00:30
      524500 -- (-924.869) (-923.050) [-926.824] (-921.993) * (-922.797) (-922.542) [-922.798] (-921.964) -- 0:00:30
      525000 -- (-923.742) [-928.064] (-926.659) (-924.745) * (-923.721) (-923.786) (-922.254) [-925.184] -- 0:00:30

      Average standard deviation of split frequencies: 0.008962

      525500 -- (-924.139) (-926.863) [-924.320] (-923.981) * [-922.642] (-923.361) (-923.199) (-928.698) -- 0:00:30
      526000 -- (-928.812) (-925.465) (-924.010) [-924.543] * (-923.869) (-921.974) (-924.844) [-922.699] -- 0:00:30
      526500 -- [-924.138] (-925.190) (-927.866) (-922.441) * (-925.048) [-923.508] (-924.294) (-922.699) -- 0:00:30
      527000 -- (-925.052) [-925.681] (-927.963) (-922.195) * (-923.772) (-923.347) [-922.004] (-923.440) -- 0:00:30
      527500 -- (-925.053) (-923.004) (-923.267) [-922.480] * (-923.943) [-926.567] (-927.437) (-923.406) -- 0:00:30
      528000 -- [-926.649] (-922.051) (-927.019) (-923.801) * (-925.380) (-922.931) [-925.852] (-923.082) -- 0:00:30
      528500 -- (-925.361) (-922.611) (-922.650) [-928.781] * (-923.428) (-924.410) (-925.422) [-924.538] -- 0:00:30
      529000 -- (-922.383) (-924.237) (-923.114) [-924.102] * (-923.164) (-924.347) (-924.284) [-929.942] -- 0:00:30
      529500 -- (-924.395) (-925.193) (-924.565) [-924.067] * (-924.788) (-924.067) (-925.326) [-923.740] -- 0:00:30
      530000 -- (-926.661) [-925.907] (-925.522) (-924.053) * (-926.069) (-925.926) (-930.106) [-923.819] -- 0:00:30

      Average standard deviation of split frequencies: 0.008988

      530500 -- (-923.410) (-923.574) [-927.898] (-925.511) * [-923.662] (-926.961) (-923.340) (-923.266) -- 0:00:30
      531000 -- [-922.944] (-924.177) (-922.788) (-925.862) * (-922.482) (-924.507) (-922.939) [-922.119] -- 0:00:30
      531500 -- [-922.774] (-926.381) (-925.266) (-925.733) * (-924.490) (-923.769) (-923.095) [-923.740] -- 0:00:29
      532000 -- (-924.709) (-925.216) [-923.012] (-925.893) * (-924.335) [-926.106] (-924.498) (-925.629) -- 0:00:29
      532500 -- [-925.474] (-922.347) (-922.878) (-924.208) * [-924.509] (-924.236) (-928.352) (-923.659) -- 0:00:29
      533000 -- (-924.390) [-923.164] (-924.073) (-926.735) * (-923.135) (-926.189) [-924.226] (-924.516) -- 0:00:29
      533500 -- (-923.428) (-922.774) (-923.352) [-923.033] * (-922.085) [-923.106] (-922.775) (-927.311) -- 0:00:29
      534000 -- (-923.588) [-925.534] (-924.761) (-923.369) * (-925.149) [-925.373] (-923.168) (-926.470) -- 0:00:29
      534500 -- (-928.161) (-923.745) [-922.978] (-922.897) * (-924.365) [-925.373] (-923.431) (-923.103) -- 0:00:29
      535000 -- [-931.398] (-925.132) (-922.484) (-925.843) * [-923.038] (-922.150) (-923.711) (-924.468) -- 0:00:29

      Average standard deviation of split frequencies: 0.008551

      535500 -- (-923.568) [-923.017] (-923.850) (-925.481) * (-925.787) [-927.302] (-924.995) (-929.910) -- 0:00:29
      536000 -- (-923.971) (-923.186) [-921.919] (-927.804) * (-922.515) (-924.056) (-925.366) [-923.573] -- 0:00:29
      536500 -- (-922.654) (-927.151) [-925.993] (-926.410) * (-923.098) [-924.313] (-923.491) (-926.729) -- 0:00:29
      537000 -- (-925.920) (-924.703) (-924.323) [-924.925] * (-924.912) [-923.569] (-923.625) (-923.164) -- 0:00:29
      537500 -- [-922.646] (-926.319) (-924.534) (-922.096) * [-930.219] (-928.769) (-923.827) (-926.068) -- 0:00:29
      538000 -- (-926.279) (-923.169) [-928.293] (-923.990) * [-923.332] (-924.679) (-924.316) (-926.934) -- 0:00:29
      538500 -- (-926.110) [-922.728] (-923.137) (-923.546) * (-924.696) (-923.363) [-923.518] (-922.740) -- 0:00:29
      539000 -- (-923.670) (-923.898) [-923.325] (-923.245) * (-926.641) (-923.821) (-924.872) [-922.594] -- 0:00:29
      539500 -- (-925.378) (-925.035) [-924.112] (-921.897) * (-922.944) (-924.231) (-924.419) [-924.763] -- 0:00:29
      540000 -- (-926.842) (-925.539) (-929.150) [-922.444] * (-927.919) (-926.755) [-922.243] (-924.482) -- 0:00:29

      Average standard deviation of split frequencies: 0.008913

      540500 -- [-925.684] (-926.119) (-925.422) (-924.575) * (-925.556) (-930.467) (-923.532) [-922.332] -- 0:00:29
      541000 -- (-926.607) (-928.064) (-925.585) [-922.461] * (-924.343) (-925.101) (-923.794) [-923.305] -- 0:00:29
      541500 -- (-929.637) (-924.419) (-924.371) [-925.142] * (-927.678) (-923.065) (-922.464) [-924.722] -- 0:00:29
      542000 -- (-928.552) (-925.223) (-928.051) [-924.145] * (-926.057) (-922.419) [-927.945] (-924.734) -- 0:00:29
      542500 -- (-922.642) (-924.461) (-925.253) [-924.418] * (-925.638) [-922.529] (-923.507) (-926.144) -- 0:00:29
      543000 -- (-923.036) (-922.014) [-925.263] (-929.532) * (-923.897) [-923.532] (-925.189) (-924.723) -- 0:00:29
      543500 -- (-924.451) (-926.931) [-922.457] (-922.823) * (-926.554) [-923.029] (-923.418) (-926.086) -- 0:00:29
      544000 -- (-926.762) [-925.389] (-923.088) (-923.117) * [-923.704] (-924.180) (-925.284) (-923.208) -- 0:00:29
      544500 -- (-927.232) (-923.172) (-926.490) [-922.010] * (-923.923) (-924.334) (-924.447) [-923.150] -- 0:00:29
      545000 -- (-923.976) (-922.943) [-925.874] (-923.464) * [-923.974] (-923.693) (-926.515) (-924.668) -- 0:00:29

      Average standard deviation of split frequencies: 0.009305

      545500 -- (-924.550) (-923.233) (-927.571) [-925.549] * (-926.649) (-922.985) (-927.182) [-927.961] -- 0:00:29
      546000 -- (-923.247) (-922.170) (-925.987) [-923.574] * (-923.042) (-925.777) (-924.492) [-924.655] -- 0:00:29
      546500 -- (-923.352) (-923.238) (-922.676) [-922.816] * (-925.760) [-922.555] (-924.325) (-923.772) -- 0:00:29
      547000 -- (-927.057) (-922.315) (-922.542) [-924.721] * (-923.936) [-930.238] (-924.528) (-924.145) -- 0:00:28
      547500 -- (-923.426) (-924.151) [-922.544] (-924.125) * (-923.288) (-924.708) (-923.322) [-922.717] -- 0:00:28
      548000 -- [-925.531] (-925.250) (-922.461) (-923.011) * (-922.862) (-924.697) (-924.092) [-923.196] -- 0:00:28
      548500 -- (-922.913) (-923.634) [-924.208] (-923.229) * (-925.222) [-923.568] (-923.749) (-924.920) -- 0:00:28
      549000 -- [-922.799] (-923.327) (-923.883) (-923.916) * (-925.788) [-923.435] (-925.603) (-923.588) -- 0:00:28
      549500 -- (-924.438) (-923.517) [-922.941] (-926.647) * [-922.222] (-924.304) (-925.829) (-923.872) -- 0:00:28
      550000 -- (-925.417) [-922.005] (-922.446) (-925.226) * (-922.513) (-923.202) [-923.020] (-926.277) -- 0:00:28

      Average standard deviation of split frequencies: 0.008661

      550500 -- (-923.963) [-922.333] (-924.022) (-927.093) * (-922.833) (-924.768) (-924.947) [-923.662] -- 0:00:28
      551000 -- (-924.379) (-923.292) [-925.737] (-923.078) * [-924.951] (-923.109) (-925.910) (-922.394) -- 0:00:28
      551500 -- (-924.290) (-923.200) [-924.170] (-923.409) * [-926.388] (-923.958) (-924.005) (-926.947) -- 0:00:28
      552000 -- [-926.048] (-925.887) (-927.125) (-922.813) * [-925.815] (-923.047) (-923.082) (-925.043) -- 0:00:28
      552500 -- [-925.076] (-929.978) (-922.834) (-924.097) * [-925.181] (-924.557) (-923.650) (-922.817) -- 0:00:28
      553000 -- (-925.756) [-924.065] (-924.513) (-929.223) * (-923.106) (-924.773) [-922.355] (-923.934) -- 0:00:28
      553500 -- (-923.155) (-924.925) (-923.691) [-921.923] * (-923.618) (-922.902) (-922.361) [-923.361] -- 0:00:28
      554000 -- (-925.303) (-931.305) [-923.783] (-923.591) * (-922.676) [-922.329] (-927.946) (-926.321) -- 0:00:28
      554500 -- (-924.846) [-925.028] (-925.667) (-924.073) * (-930.419) [-922.742] (-923.404) (-922.219) -- 0:00:28
      555000 -- (-928.067) (-924.356) (-925.973) [-925.771] * (-930.971) [-923.410] (-924.480) (-922.483) -- 0:00:28

      Average standard deviation of split frequencies: 0.008678

      555500 -- (-923.677) [-924.875] (-924.620) (-923.419) * (-923.878) (-924.620) (-926.349) [-922.316] -- 0:00:28
      556000 -- [-922.672] (-926.672) (-923.413) (-922.446) * [-925.078] (-923.904) (-926.508) (-922.168) -- 0:00:28
      556500 -- (-923.128) (-926.522) [-923.322] (-924.481) * (-922.653) [-926.297] (-926.380) (-923.346) -- 0:00:28
      557000 -- [-925.949] (-924.652) (-923.501) (-923.524) * (-922.823) (-922.196) (-924.165) [-923.457] -- 0:00:28
      557500 -- (-927.346) (-924.915) (-925.652) [-921.939] * (-922.935) (-922.462) (-922.815) [-923.111] -- 0:00:28
      558000 -- [-925.075] (-926.448) (-924.974) (-923.256) * [-925.666] (-924.966) (-922.986) (-925.130) -- 0:00:28
      558500 -- (-923.570) [-924.623] (-922.417) (-925.908) * (-924.004) (-924.038) [-923.228] (-923.182) -- 0:00:28
      559000 -- (-925.011) (-923.938) (-923.236) [-923.220] * (-924.857) (-925.904) (-927.144) [-925.007] -- 0:00:28
      559500 -- [-924.597] (-925.468) (-926.344) (-927.362) * (-925.084) (-927.172) [-926.865] (-927.223) -- 0:00:28
      560000 -- (-922.021) (-923.404) (-923.791) [-923.119] * (-925.390) [-928.337] (-925.016) (-922.746) -- 0:00:28

      Average standard deviation of split frequencies: 0.008754

      560500 -- (-924.446) (-925.684) (-922.773) [-923.882] * (-924.890) (-925.033) [-923.480] (-923.112) -- 0:00:28
      561000 -- (-922.868) (-924.684) (-924.766) [-924.756] * (-926.762) [-929.838] (-926.201) (-922.344) -- 0:00:28
      561500 -- (-924.071) (-923.394) [-924.493] (-926.073) * (-925.536) (-928.276) [-922.997] (-923.752) -- 0:00:28
      562000 -- (-924.955) (-923.433) [-923.296] (-924.049) * (-922.325) (-929.895) (-924.744) [-924.013] -- 0:00:28
      562500 -- [-924.460] (-931.853) (-928.294) (-922.036) * (-923.480) (-922.806) (-929.995) [-924.803] -- 0:00:28
      563000 -- (-928.055) (-926.063) (-925.949) [-922.854] * (-925.955) [-922.761] (-923.731) (-925.828) -- 0:00:27
      563500 -- (-924.078) (-925.260) [-929.580] (-926.208) * (-923.586) [-929.036] (-926.416) (-926.037) -- 0:00:27
      564000 -- (-922.418) [-924.387] (-922.580) (-922.282) * (-923.442) [-923.763] (-926.454) (-926.663) -- 0:00:27
      564500 -- (-924.035) (-923.848) (-927.696) [-922.803] * (-922.180) (-924.246) [-926.280] (-926.513) -- 0:00:27
      565000 -- (-925.136) [-922.594] (-923.205) (-923.130) * (-923.468) [-924.070] (-926.819) (-925.209) -- 0:00:27

      Average standard deviation of split frequencies: 0.008819

      565500 -- (-925.402) (-924.408) (-928.087) [-925.390] * (-922.668) (-924.263) [-924.055] (-924.902) -- 0:00:27
      566000 -- (-923.466) [-923.708] (-926.335) (-926.065) * (-922.576) [-923.381] (-925.410) (-924.366) -- 0:00:27
      566500 -- (-925.034) (-923.857) (-923.134) [-924.334] * (-922.937) [-922.304] (-923.787) (-923.472) -- 0:00:27
      567000 -- (-927.906) (-924.576) (-926.672) [-922.428] * [-923.828] (-923.028) (-922.575) (-926.972) -- 0:00:27
      567500 -- (-928.908) (-927.452) (-922.463) [-922.930] * (-924.376) [-922.383] (-922.560) (-923.321) -- 0:00:27
      568000 -- (-925.045) (-923.174) (-922.309) [-923.563] * (-929.517) (-922.465) [-924.772] (-924.900) -- 0:00:27
      568500 -- [-923.062] (-923.903) (-923.948) (-926.039) * (-930.449) (-927.506) (-923.575) [-922.347] -- 0:00:27
      569000 -- (-922.952) (-923.903) (-923.712) [-926.548] * [-923.331] (-923.752) (-922.329) (-923.118) -- 0:00:27
      569500 -- (-922.939) (-924.704) (-922.548) [-924.275] * (-922.066) [-922.161] (-922.802) (-923.020) -- 0:00:27
      570000 -- [-922.473] (-924.300) (-923.536) (-926.399) * (-923.099) (-923.623) [-924.275] (-924.466) -- 0:00:27

      Average standard deviation of split frequencies: 0.008261

      570500 -- (-924.285) (-922.753) (-923.969) [-923.240] * (-927.754) (-923.254) (-927.250) [-922.767] -- 0:00:27
      571000 -- (-924.027) (-923.548) [-923.200] (-927.138) * [-926.855] (-923.483) (-923.836) (-924.937) -- 0:00:27
      571500 -- (-925.121) [-923.452] (-925.716) (-924.832) * (-926.415) (-922.857) (-923.742) [-922.331] -- 0:00:26
      572000 -- (-927.848) (-924.150) [-921.946] (-929.105) * (-926.352) (-923.447) [-923.382] (-923.095) -- 0:00:27
      572500 -- (-923.857) (-924.983) (-926.386) [-925.027] * (-923.342) [-927.935] (-924.808) (-923.249) -- 0:00:27
      573000 -- [-922.738] (-923.505) (-923.158) (-927.893) * (-923.630) (-927.332) [-922.866] (-923.358) -- 0:00:27
      573500 -- (-925.373) [-922.535] (-924.103) (-922.793) * (-927.782) (-926.517) [-923.443] (-923.699) -- 0:00:27
      574000 -- (-923.509) (-923.561) (-923.433) [-922.129] * [-928.168] (-924.194) (-923.732) (-924.185) -- 0:00:27
      574500 -- [-922.673] (-924.032) (-922.109) (-922.906) * (-926.157) (-923.614) [-924.395] (-926.781) -- 0:00:27
      575000 -- [-922.671] (-923.984) (-922.576) (-922.207) * (-923.592) [-924.595] (-922.021) (-923.203) -- 0:00:27

      Average standard deviation of split frequencies: 0.008232

      575500 -- (-922.710) (-925.074) [-924.827] (-922.816) * (-925.767) (-923.487) [-921.989] (-925.165) -- 0:00:27
      576000 -- (-922.702) (-924.781) (-926.530) [-922.969] * (-927.141) (-926.550) [-923.451] (-922.689) -- 0:00:27
      576500 -- [-923.218] (-922.773) (-922.859) (-924.769) * (-926.628) (-921.799) [-923.251] (-922.382) -- 0:00:27
      577000 -- (-923.030) (-923.114) (-926.338) [-924.118] * (-924.929) (-922.830) [-923.625] (-927.852) -- 0:00:27
      577500 -- (-924.057) [-923.011] (-925.676) (-922.880) * (-927.340) [-923.059] (-925.322) (-924.112) -- 0:00:27
      578000 -- (-925.077) [-926.517] (-927.363) (-922.520) * (-923.342) (-922.813) (-923.424) [-922.857] -- 0:00:27
      578500 -- (-924.244) (-923.279) [-927.489] (-922.685) * (-926.644) (-924.203) [-922.585] (-923.106) -- 0:00:26
      579000 -- (-923.846) (-924.029) (-923.405) [-923.405] * [-924.554] (-923.600) (-922.542) (-927.778) -- 0:00:26
      579500 -- (-925.386) [-924.324] (-922.451) (-923.862) * (-923.947) [-924.115] (-922.328) (-924.079) -- 0:00:26
      580000 -- (-923.318) (-926.698) (-924.870) [-925.677] * (-924.042) (-925.835) (-925.944) [-923.445] -- 0:00:26

      Average standard deviation of split frequencies: 0.007020

      580500 -- (-928.933) (-926.719) [-924.736] (-926.052) * [-925.286] (-926.103) (-925.259) (-926.380) -- 0:00:26
      581000 -- [-926.912] (-923.495) (-930.792) (-925.596) * [-922.565] (-925.159) (-922.923) (-925.521) -- 0:00:26
      581500 -- (-925.776) (-922.587) [-928.006] (-925.136) * (-923.984) [-924.684] (-926.698) (-923.560) -- 0:00:26
      582000 -- (-932.457) (-922.972) [-926.921] (-925.867) * (-926.847) (-923.813) [-923.288] (-923.457) -- 0:00:26
      582500 -- (-924.098) [-923.298] (-931.063) (-922.455) * (-927.092) [-923.921] (-923.864) (-922.525) -- 0:00:26
      583000 -- (-922.737) (-924.304) (-923.199) [-925.257] * (-923.694) (-924.169) (-923.351) [-922.766] -- 0:00:26
      583500 -- (-924.893) (-924.513) [-925.251] (-924.793) * (-923.336) [-922.474] (-923.644) (-922.123) -- 0:00:26
      584000 -- (-924.919) [-923.276] (-927.506) (-926.653) * (-924.113) [-922.762] (-922.895) (-926.294) -- 0:00:26
      584500 -- (-926.112) [-923.730] (-925.111) (-924.102) * (-924.578) (-924.892) (-926.095) [-925.570] -- 0:00:26
      585000 -- [-923.745] (-923.649) (-925.670) (-922.953) * (-925.448) (-923.233) (-925.490) [-924.655] -- 0:00:26

      Average standard deviation of split frequencies: 0.006578

      585500 -- (-926.903) (-923.209) [-924.402] (-924.853) * (-927.815) (-924.572) (-923.352) [-925.285] -- 0:00:26
      586000 -- (-923.142) (-923.191) (-922.939) [-923.826] * [-922.883] (-924.275) (-924.306) (-926.447) -- 0:00:26
      586500 -- (-924.646) [-930.071] (-924.085) (-922.637) * (-924.543) (-925.004) (-923.509) [-925.833] -- 0:00:26
      587000 -- (-922.106) (-929.376) (-924.408) [-922.478] * (-925.531) [-923.106] (-922.819) (-927.211) -- 0:00:26
      587500 -- (-922.053) (-932.211) [-926.802] (-928.869) * (-924.397) [-923.034] (-923.659) (-923.343) -- 0:00:25
      588000 -- (-926.006) [-929.364] (-924.774) (-925.050) * [-922.633] (-924.624) (-923.294) (-927.425) -- 0:00:25
      588500 -- (-924.910) [-925.556] (-927.917) (-922.712) * [-923.233] (-923.403) (-926.646) (-926.675) -- 0:00:26
      589000 -- [-923.706] (-923.714) (-929.452) (-922.136) * (-922.486) (-922.436) (-922.656) [-924.483] -- 0:00:26
      589500 -- (-926.404) [-924.091] (-925.913) (-923.314) * (-923.035) [-925.827] (-925.156) (-923.548) -- 0:00:26
      590000 -- [-924.245] (-924.398) (-922.254) (-923.448) * (-922.461) (-926.299) [-922.954] (-923.621) -- 0:00:26

      Average standard deviation of split frequencies: 0.006619

      590500 -- (-923.290) (-926.126) (-923.472) [-924.663] * [-922.268] (-923.718) (-927.311) (-924.799) -- 0:00:26
      591000 -- [-924.538] (-927.143) (-926.960) (-928.623) * (-922.375) [-924.448] (-925.532) (-924.580) -- 0:00:26
      591500 -- (-925.958) [-925.341] (-922.755) (-926.252) * [-924.366] (-926.364) (-928.002) (-925.332) -- 0:00:26
      592000 -- (-924.532) (-929.814) (-925.344) [-924.299] * (-921.741) (-923.618) (-926.638) [-925.723] -- 0:00:26
      592500 -- (-928.609) (-928.937) [-927.452] (-924.256) * (-927.716) (-923.211) (-924.742) [-925.949] -- 0:00:26
      593000 -- (-923.086) [-923.723] (-922.917) (-924.602) * [-923.881] (-923.093) (-923.915) (-925.208) -- 0:00:26
      593500 -- (-924.260) (-927.720) (-924.375) [-923.373] * (-924.369) [-922.473] (-925.603) (-923.250) -- 0:00:26
      594000 -- [-923.236] (-925.989) (-924.681) (-923.676) * (-922.280) [-925.093] (-922.429) (-926.816) -- 0:00:25
      594500 -- (-926.648) (-923.978) [-922.686] (-923.532) * (-922.110) (-924.866) [-928.450] (-924.076) -- 0:00:25
      595000 -- (-926.615) [-922.571] (-924.675) (-923.655) * (-925.242) (-922.819) [-925.550] (-924.211) -- 0:00:25

      Average standard deviation of split frequencies: 0.006653

      595500 -- (-925.357) [-924.742] (-925.007) (-923.760) * (-923.467) (-928.702) (-922.756) [-924.433] -- 0:00:25
      596000 -- (-925.219) (-924.260) (-924.145) [-922.368] * (-923.188) (-924.437) [-925.261] (-922.980) -- 0:00:25
      596500 -- (-923.342) (-923.318) (-922.775) [-922.609] * [-922.342] (-923.571) (-924.275) (-923.464) -- 0:00:25
      597000 -- (-925.756) (-924.637) [-923.203] (-922.911) * [-922.458] (-924.202) (-922.625) (-929.763) -- 0:00:25
      597500 -- (-923.997) (-922.666) [-923.777] (-923.663) * (-922.606) [-923.053] (-924.964) (-925.344) -- 0:00:25
      598000 -- [-924.356] (-924.819) (-923.023) (-922.137) * (-924.093) (-922.207) [-927.108] (-923.714) -- 0:00:25
      598500 -- (-923.702) (-922.910) (-923.023) [-926.031] * [-922.447] (-922.385) (-924.509) (-924.191) -- 0:00:25
      599000 -- [-925.987] (-926.890) (-923.094) (-924.880) * (-922.465) [-922.114] (-923.164) (-923.952) -- 0:00:25
      599500 -- [-924.336] (-930.544) (-923.078) (-923.456) * [-922.043] (-922.339) (-924.655) (-923.626) -- 0:00:25
      600000 -- (-923.082) (-929.060) [-922.989] (-924.751) * (-922.530) (-922.264) [-928.678] (-922.362) -- 0:00:25

      Average standard deviation of split frequencies: 0.006602

      600500 -- (-923.828) [-923.380] (-925.380) (-930.647) * (-922.397) (-922.338) (-926.203) [-923.163] -- 0:00:25
      601000 -- (-922.750) (-923.802) (-924.704) [-922.966] * [-925.057] (-922.916) (-922.712) (-924.529) -- 0:00:25
      601500 -- (-922.860) (-922.938) (-923.360) [-923.539] * (-925.894) (-925.715) (-924.840) [-922.834] -- 0:00:25
      602000 -- (-924.659) (-926.330) (-924.552) [-926.311] * [-922.992] (-922.927) (-924.847) (-923.325) -- 0:00:25
      602500 -- (-924.788) [-923.288] (-925.599) (-924.004) * (-923.621) (-923.911) [-925.077] (-922.882) -- 0:00:25
      603000 -- (-930.216) (-922.112) (-924.882) [-924.669] * (-925.051) [-922.932] (-924.026) (-924.794) -- 0:00:25
      603500 -- (-927.924) (-923.055) (-924.105) [-924.946] * (-928.751) (-923.631) [-922.882] (-927.411) -- 0:00:24
      604000 -- (-932.624) (-924.673) [-923.684] (-925.501) * [-927.199] (-923.867) (-924.679) (-921.757) -- 0:00:24
      604500 -- (-930.020) [-922.496] (-928.278) (-923.876) * (-922.774) (-923.176) (-924.134) [-922.284] -- 0:00:24
      605000 -- (-928.302) (-923.119) [-926.681] (-922.988) * (-926.325) [-923.130] (-922.776) (-925.068) -- 0:00:25

      Average standard deviation of split frequencies: 0.006818

      605500 -- (-923.844) [-926.491] (-923.817) (-923.488) * (-923.487) (-922.901) (-923.075) [-923.315] -- 0:00:25
      606000 -- (-927.719) [-924.572] (-922.460) (-925.287) * (-930.409) (-923.254) (-924.533) [-922.573] -- 0:00:25
      606500 -- (-925.067) (-926.293) (-924.726) [-923.213] * (-925.170) (-925.380) [-924.126] (-922.621) -- 0:00:25
      607000 -- (-927.779) (-923.256) [-922.597] (-925.652) * (-925.072) [-922.597] (-923.200) (-923.952) -- 0:00:25
      607500 -- (-925.216) [-927.008] (-922.846) (-922.524) * (-925.106) (-927.560) (-922.787) [-923.914] -- 0:00:25
      608000 -- (-927.434) (-926.410) [-922.460] (-922.583) * (-923.204) (-926.919) (-922.260) [-923.130] -- 0:00:25
      608500 -- (-926.339) (-930.129) [-923.791] (-921.973) * (-924.393) [-923.494] (-927.044) (-924.442) -- 0:00:25
      609000 -- (-925.729) (-925.699) (-923.156) [-921.850] * (-927.333) [-923.398] (-926.357) (-925.877) -- 0:00:25
      609500 -- (-922.256) [-924.886] (-922.766) (-924.888) * (-930.276) [-923.621] (-927.470) (-926.612) -- 0:00:24
      610000 -- (-923.355) [-922.896] (-922.093) (-923.769) * (-926.484) [-922.580] (-924.407) (-928.847) -- 0:00:24

      Average standard deviation of split frequencies: 0.006990

      610500 -- [-924.180] (-930.063) (-922.221) (-921.940) * (-926.946) (-923.864) [-922.206] (-924.783) -- 0:00:24
      611000 -- [-922.774] (-929.369) (-924.304) (-923.762) * [-923.640] (-923.416) (-922.965) (-923.466) -- 0:00:24
      611500 -- (-923.650) (-924.199) [-928.725] (-924.965) * (-922.017) (-922.828) (-924.573) [-923.729] -- 0:00:24
      612000 -- (-923.328) (-922.823) (-928.558) [-926.737] * (-921.999) (-927.582) [-924.021] (-924.803) -- 0:00:24
      612500 -- (-925.637) [-923.910] (-922.863) (-922.815) * [-925.181] (-923.836) (-924.002) (-923.855) -- 0:00:24
      613000 -- (-921.882) (-923.025) (-924.836) [-924.464] * (-924.325) (-924.515) (-924.886) [-924.366] -- 0:00:24
      613500 -- (-921.882) [-922.587] (-922.681) (-922.046) * (-925.528) [-923.938] (-926.131) (-924.717) -- 0:00:24
      614000 -- (-923.477) [-932.035] (-923.894) (-924.353) * (-924.148) (-924.405) (-926.236) [-923.918] -- 0:00:24
      614500 -- (-923.929) [-922.315] (-923.951) (-922.547) * [-924.362] (-935.660) (-925.477) (-926.600) -- 0:00:24
      615000 -- (-925.605) (-922.254) [-922.920] (-924.034) * [-923.422] (-924.153) (-923.132) (-926.950) -- 0:00:24

      Average standard deviation of split frequencies: 0.007313

      615500 -- (-926.717) (-924.277) (-922.216) [-925.567] * [-923.182] (-922.917) (-923.098) (-930.941) -- 0:00:24
      616000 -- (-925.376) [-925.345] (-924.126) (-925.936) * [-923.220] (-925.352) (-923.449) (-925.762) -- 0:00:24
      616500 -- [-924.038] (-926.518) (-923.104) (-925.090) * (-924.165) (-927.547) (-925.361) [-925.524] -- 0:00:24
      617000 -- (-924.588) (-927.863) (-922.847) [-924.060] * (-926.160) [-928.736] (-925.043) (-923.288) -- 0:00:24
      617500 -- (-923.834) (-922.497) [-924.197] (-923.299) * (-924.890) (-923.897) [-925.508] (-927.922) -- 0:00:24
      618000 -- (-926.114) (-923.481) [-926.058] (-923.299) * (-923.492) (-924.661) [-925.225] (-929.117) -- 0:00:24
      618500 -- [-923.531] (-922.633) (-926.078) (-922.982) * [-924.986] (-923.492) (-925.001) (-924.683) -- 0:00:24
      619000 -- [-925.562] (-927.820) (-924.758) (-923.475) * (-926.468) [-922.736] (-922.252) (-925.407) -- 0:00:24
      619500 -- (-923.893) [-923.290] (-922.368) (-924.849) * (-923.650) (-926.011) [-929.287] (-924.048) -- 0:00:23
      620000 -- (-924.209) [-923.133] (-925.052) (-923.941) * (-926.895) [-923.445] (-924.079) (-925.976) -- 0:00:23

      Average standard deviation of split frequencies: 0.007469

      620500 -- (-924.960) [-922.181] (-923.365) (-922.603) * (-922.813) [-922.042] (-924.139) (-925.400) -- 0:00:23
      621000 -- (-924.092) [-924.823] (-924.709) (-924.703) * (-925.397) (-922.387) (-927.433) [-926.430] -- 0:00:23
      621500 -- (-922.907) (-925.397) [-924.717] (-927.219) * (-921.980) (-922.630) [-923.642] (-926.770) -- 0:00:23
      622000 -- [-922.644] (-924.812) (-932.217) (-926.562) * (-923.671) [-924.196] (-925.414) (-925.726) -- 0:00:24
      622500 -- [-923.719] (-925.202) (-924.795) (-924.904) * (-922.715) [-923.643] (-925.768) (-925.150) -- 0:00:24
      623000 -- [-924.034] (-924.731) (-923.921) (-925.859) * [-922.747] (-924.729) (-924.735) (-926.564) -- 0:00:24
      623500 -- (-922.796) (-924.779) (-922.413) [-925.446] * (-923.115) (-924.594) (-923.466) [-923.885] -- 0:00:24
      624000 -- [-925.786] (-925.466) (-924.322) (-922.238) * (-924.355) (-924.266) (-922.999) [-925.204] -- 0:00:24
      624500 -- (-924.045) (-922.894) (-926.667) [-922.153] * (-925.386) (-925.979) (-922.820) [-925.883] -- 0:00:24
      625000 -- [-922.030] (-924.317) (-923.158) (-922.329) * [-922.640] (-926.357) (-923.253) (-924.251) -- 0:00:24

      Average standard deviation of split frequencies: 0.007363

      625500 -- (-927.273) (-927.283) (-924.771) [-922.975] * (-924.418) [-922.692] (-922.115) (-923.435) -- 0:00:23
      626000 -- (-927.909) (-924.453) [-924.335] (-922.692) * (-928.667) (-923.388) [-923.159] (-922.156) -- 0:00:23
      626500 -- (-927.730) (-924.343) (-923.215) [-922.832] * [-925.542] (-922.807) (-924.085) (-922.734) -- 0:00:23
      627000 -- (-922.771) (-923.056) (-922.998) [-923.362] * (-924.985) [-923.792] (-923.647) (-924.011) -- 0:00:23
      627500 -- (-922.681) (-924.070) (-923.433) [-923.694] * (-928.916) [-922.631] (-927.613) (-922.393) -- 0:00:23
      628000 -- (-925.719) [-922.289] (-923.080) (-922.812) * [-922.276] (-925.991) (-922.485) (-922.582) -- 0:00:23
      628500 -- (-925.423) [-925.617] (-923.786) (-925.945) * (-922.314) [-924.586] (-924.041) (-923.153) -- 0:00:23
      629000 -- (-924.483) (-931.992) [-923.361] (-928.622) * (-925.686) (-925.877) [-922.872] (-921.917) -- 0:00:23
      629500 -- (-923.358) (-923.541) [-926.814] (-928.385) * (-921.938) (-924.195) [-924.272] (-921.917) -- 0:00:23
      630000 -- [-927.483] (-926.207) (-925.041) (-925.088) * [-923.076] (-923.006) (-924.579) (-922.621) -- 0:00:23

      Average standard deviation of split frequencies: 0.007255

      630500 -- [-924.790] (-924.780) (-923.187) (-930.550) * (-927.437) (-924.882) (-922.735) [-924.862] -- 0:00:23
      631000 -- [-922.727] (-922.501) (-922.556) (-924.790) * (-925.172) (-922.556) (-922.357) [-923.252] -- 0:00:23
      631500 -- (-922.558) (-922.704) (-924.833) [-924.655] * (-924.124) [-925.225] (-925.310) (-923.649) -- 0:00:23
      632000 -- (-926.591) [-923.527] (-924.579) (-927.229) * (-925.035) [-922.989] (-926.337) (-922.698) -- 0:00:23
      632500 -- (-924.635) (-924.095) [-925.222] (-925.535) * (-924.543) [-929.219] (-929.209) (-924.442) -- 0:00:23
      633000 -- (-922.937) (-925.375) (-924.696) [-924.216] * [-923.489] (-923.622) (-922.758) (-925.562) -- 0:00:23
      633500 -- (-922.350) (-922.951) [-922.370] (-923.165) * (-923.173) [-924.553] (-925.055) (-926.845) -- 0:00:23
      634000 -- (-925.081) [-923.473] (-923.344) (-923.089) * (-925.340) [-923.986] (-924.866) (-923.158) -- 0:00:23
      634500 -- (-929.339) (-927.409) [-924.618] (-925.356) * (-924.281) (-925.314) [-921.937] (-926.321) -- 0:00:23
      635000 -- [-925.707] (-924.256) (-925.759) (-925.356) * (-922.764) (-924.992) (-922.605) [-923.429] -- 0:00:22

      Average standard deviation of split frequencies: 0.007150

      635500 -- [-926.241] (-923.692) (-923.046) (-923.957) * (-922.516) (-923.856) [-924.089] (-922.304) -- 0:00:22
      636000 -- (-928.468) (-922.849) [-923.678] (-925.225) * (-924.939) (-922.387) [-923.271] (-924.961) -- 0:00:22
      636500 -- (-925.156) (-923.187) (-925.153) [-924.735] * [-923.167] (-922.835) (-925.536) (-922.674) -- 0:00:22
      637000 -- (-925.465) (-925.927) [-925.110] (-923.466) * [-924.876] (-924.066) (-925.916) (-923.739) -- 0:00:22
      637500 -- (-924.682) [-922.525] (-924.551) (-924.664) * (-922.127) (-924.184) (-922.650) [-927.763] -- 0:00:22
      638000 -- (-923.504) (-922.531) [-924.269] (-924.086) * (-921.898) (-928.484) (-927.053) [-921.976] -- 0:00:22
      638500 -- [-923.257] (-924.341) (-927.336) (-927.543) * (-922.953) (-923.390) (-922.848) [-924.887] -- 0:00:23
      639000 -- (-924.227) (-924.999) (-925.037) [-924.608] * [-922.718] (-923.923) (-922.887) (-923.840) -- 0:00:23
      639500 -- (-924.406) (-925.935) [-925.751] (-925.053) * (-923.981) (-923.364) [-922.116] (-922.514) -- 0:00:23
      640000 -- (-925.812) [-923.661] (-928.183) (-924.361) * (-926.587) [-924.075] (-924.133) (-923.631) -- 0:00:23

      Average standard deviation of split frequencies: 0.006968

      640500 -- [-922.285] (-926.891) (-926.554) (-923.240) * (-924.010) (-923.461) [-923.106] (-923.076) -- 0:00:23
      641000 -- [-922.738] (-927.247) (-922.061) (-923.161) * (-924.098) (-923.461) [-923.191] (-925.556) -- 0:00:22
      641500 -- (-922.065) (-924.384) [-924.135] (-921.968) * (-925.034) (-923.911) (-922.587) [-923.144] -- 0:00:22
      642000 -- (-922.096) (-924.210) [-922.754] (-922.004) * (-924.919) [-922.298] (-922.363) (-923.564) -- 0:00:22
      642500 -- (-923.825) (-928.927) [-922.213] (-924.638) * [-925.586] (-922.384) (-923.047) (-925.912) -- 0:00:22
      643000 -- [-924.867] (-927.071) (-927.086) (-922.507) * [-923.580] (-922.308) (-929.845) (-924.324) -- 0:00:22
      643500 -- (-927.427) [-924.068] (-931.105) (-922.255) * [-923.060] (-923.422) (-923.103) (-923.500) -- 0:00:22
      644000 -- (-924.217) [-927.664] (-926.911) (-923.853) * (-922.813) (-922.773) [-923.756] (-923.474) -- 0:00:22
      644500 -- (-922.706) [-926.922] (-923.659) (-924.733) * (-924.247) (-929.859) (-924.882) [-926.536] -- 0:00:22
      645000 -- [-924.185] (-925.682) (-922.282) (-923.060) * (-922.905) (-924.162) [-922.541] (-923.690) -- 0:00:22

      Average standard deviation of split frequencies: 0.006954

      645500 -- [-925.193] (-926.288) (-923.755) (-922.328) * (-922.682) (-926.771) [-923.401] (-925.462) -- 0:00:22
      646000 -- (-922.555) (-923.697) (-922.530) [-927.486] * (-922.871) (-928.180) (-923.540) [-923.734] -- 0:00:22
      646500 -- [-926.039] (-923.409) (-922.484) (-924.765) * (-925.103) (-922.876) (-923.739) [-923.172] -- 0:00:22
      647000 -- (-926.395) (-924.800) (-925.001) [-924.230] * [-922.664] (-923.094) (-922.611) (-922.131) -- 0:00:22
      647500 -- (-928.677) (-924.136) [-926.442] (-924.146) * (-927.665) [-922.054] (-930.935) (-922.835) -- 0:00:22
      648000 -- (-925.820) (-924.684) (-924.742) [-922.877] * [-923.539] (-924.708) (-923.874) (-924.594) -- 0:00:22
      648500 -- (-924.105) [-923.267] (-926.226) (-922.790) * (-925.566) (-926.674) (-923.550) [-923.326] -- 0:00:22
      649000 -- (-923.151) (-923.851) [-923.086] (-925.412) * (-926.520) [-923.301] (-923.103) (-923.347) -- 0:00:22
      649500 -- (-928.266) [-923.645] (-923.086) (-928.731) * (-924.085) [-922.968] (-922.350) (-927.944) -- 0:00:22
      650000 -- (-924.389) (-925.343) (-925.914) [-926.658] * (-924.415) [-924.183] (-922.489) (-927.085) -- 0:00:22

      Average standard deviation of split frequencies: 0.007202

      650500 -- (-923.535) (-931.890) (-925.396) [-923.021] * (-926.441) (-924.906) (-925.903) [-925.520] -- 0:00:22
      651000 -- (-923.553) (-927.543) [-923.358] (-924.685) * (-923.662) (-924.214) (-921.861) [-923.578] -- 0:00:21
      651500 -- (-924.353) (-925.238) (-928.923) [-924.876] * [-923.468] (-926.390) (-922.063) (-928.869) -- 0:00:21
      652000 -- (-924.157) [-923.783] (-930.439) (-924.673) * (-923.160) [-925.205] (-922.685) (-927.239) -- 0:00:21
      652500 -- (-931.355) (-924.902) [-922.773] (-926.782) * (-922.975) (-923.676) [-924.097] (-926.413) -- 0:00:21
      653000 -- [-924.961] (-928.382) (-924.920) (-923.275) * [-927.236] (-923.307) (-925.243) (-926.437) -- 0:00:21
      653500 -- (-929.518) (-925.988) (-924.913) [-922.718] * (-927.816) [-923.506] (-925.089) (-925.411) -- 0:00:21
      654000 -- (-927.104) [-926.914] (-924.050) (-924.205) * [-923.736] (-925.666) (-925.725) (-925.757) -- 0:00:21
      654500 -- (-924.505) (-924.307) [-924.431] (-923.983) * (-923.184) [-922.661] (-925.589) (-926.221) -- 0:00:21
      655000 -- [-924.377] (-923.735) (-927.075) (-922.399) * [-923.358] (-924.636) (-922.325) (-924.423) -- 0:00:22

      Average standard deviation of split frequencies: 0.007186

      655500 -- [-923.338] (-933.709) (-924.466) (-924.774) * [-925.878] (-924.394) (-923.105) (-929.354) -- 0:00:22
      656000 -- [-923.366] (-922.781) (-923.813) (-926.373) * [-926.877] (-926.124) (-924.052) (-928.046) -- 0:00:22
      656500 -- (-924.944) (-925.587) [-923.354] (-923.341) * (-928.469) [-924.961] (-925.219) (-926.788) -- 0:00:21
      657000 -- (-922.466) [-927.175] (-925.364) (-922.148) * (-926.541) (-929.758) [-922.620] (-924.895) -- 0:00:21
      657500 -- (-925.003) [-925.969] (-923.956) (-926.788) * [-923.678] (-922.723) (-922.394) (-926.377) -- 0:00:21
      658000 -- [-923.663] (-924.583) (-925.511) (-922.260) * (-924.027) (-923.555) (-926.122) [-924.138] -- 0:00:21
      658500 -- (-923.546) [-924.867] (-923.899) (-922.518) * (-923.955) (-924.259) (-925.797) [-923.676] -- 0:00:21
      659000 -- (-923.533) (-925.868) (-924.339) [-922.393] * (-923.201) [-923.299] (-925.431) (-922.346) -- 0:00:21
      659500 -- (-923.162) [-929.072] (-926.232) (-925.665) * (-927.435) (-923.018) (-925.524) [-922.285] -- 0:00:21
      660000 -- (-923.118) (-928.572) [-923.295] (-928.092) * (-923.320) (-929.974) (-926.244) [-924.614] -- 0:00:21

      Average standard deviation of split frequencies: 0.007345

      660500 -- (-925.299) (-925.197) [-924.929] (-923.003) * (-923.442) (-922.044) (-928.790) [-923.636] -- 0:00:21
      661000 -- (-931.458) (-923.901) (-924.837) [-925.590] * (-925.292) [-922.271] (-923.713) (-923.103) -- 0:00:21
      661500 -- (-929.189) [-924.490] (-924.191) (-929.858) * (-925.620) [-924.961] (-923.359) (-927.151) -- 0:00:21
      662000 -- (-925.023) (-929.886) [-922.506] (-923.722) * [-923.645] (-927.956) (-924.207) (-923.920) -- 0:00:21
      662500 -- (-931.347) (-923.570) (-923.023) [-923.444] * (-924.834) (-926.667) [-925.074] (-925.955) -- 0:00:21
      663000 -- (-928.018) (-924.583) (-923.465) [-925.046] * (-923.086) (-925.518) (-924.448) [-924.686] -- 0:00:21
      663500 -- [-926.260] (-923.795) (-925.029) (-926.310) * (-925.018) (-924.400) [-925.142] (-922.743) -- 0:00:21
      664000 -- (-928.000) (-924.332) (-926.997) [-924.007] * (-923.781) (-924.419) [-926.366] (-923.562) -- 0:00:21
      664500 -- (-924.983) [-923.030] (-926.492) (-924.146) * (-922.437) (-922.591) [-923.229] (-922.244) -- 0:00:21
      665000 -- (-925.351) (-925.096) (-926.410) [-923.929] * (-924.346) (-923.347) [-922.141] (-923.106) -- 0:00:21

      Average standard deviation of split frequencies: 0.007578

      665500 -- (-925.959) [-923.439] (-928.680) (-923.245) * (-922.913) (-924.031) [-923.808] (-933.759) -- 0:00:21
      666000 -- (-923.318) [-923.849] (-925.169) (-922.199) * [-923.866] (-924.259) (-925.536) (-925.922) -- 0:00:21
      666500 -- (-922.805) (-924.585) (-926.588) [-924.397] * (-923.385) (-925.484) [-923.493] (-924.835) -- 0:00:21
      667000 -- [-930.008] (-923.493) (-922.404) (-923.024) * (-926.965) [-924.861] (-924.082) (-925.275) -- 0:00:20
      667500 -- (-926.253) [-922.449] (-923.768) (-925.765) * [-924.700] (-924.510) (-923.319) (-925.619) -- 0:00:20
      668000 -- [-925.420] (-926.517) (-924.878) (-927.844) * (-922.489) [-922.278] (-924.961) (-923.983) -- 0:00:20
      668500 -- (-924.290) [-925.551] (-927.247) (-924.254) * [-922.670] (-926.252) (-925.431) (-923.227) -- 0:00:20
      669000 -- (-923.211) (-925.338) [-923.301] (-929.063) * (-922.793) (-923.665) [-925.320] (-922.760) -- 0:00:20
      669500 -- (-924.608) (-925.052) (-926.299) [-923.404] * (-923.429) [-923.458] (-925.446) (-923.400) -- 0:00:20
      670000 -- (-924.366) (-924.630) [-924.329] (-924.462) * (-922.145) (-925.666) (-927.563) [-922.283] -- 0:00:20

      Average standard deviation of split frequencies: 0.007773

      670500 -- [-925.730] (-924.907) (-922.926) (-924.223) * (-924.384) (-927.877) (-927.740) [-924.504] -- 0:00:20
      671000 -- (-927.371) (-923.785) (-925.870) [-921.976] * (-923.911) [-928.069] (-924.233) (-922.548) -- 0:00:20
      671500 -- (-922.343) [-923.057] (-925.917) (-922.021) * (-928.676) [-926.139] (-921.960) (-922.516) -- 0:00:21
      672000 -- (-923.914) [-924.177] (-924.202) (-922.021) * [-923.020] (-923.508) (-924.195) (-922.606) -- 0:00:20
      672500 -- (-928.399) (-923.953) [-926.112] (-929.765) * (-923.334) (-922.628) [-923.318] (-922.330) -- 0:00:20
      673000 -- (-924.229) [-925.185] (-924.835) (-925.929) * (-928.912) [-923.837] (-924.585) (-923.047) -- 0:00:20
      673500 -- (-922.835) (-923.403) [-924.387] (-923.235) * (-922.394) (-926.168) (-926.484) [-923.939] -- 0:00:20
      674000 -- (-922.688) (-923.475) [-922.330] (-922.315) * (-922.068) [-924.567] (-926.718) (-924.701) -- 0:00:20
      674500 -- (-922.173) (-922.486) (-923.418) [-925.376] * (-923.964) (-923.369) [-925.194] (-924.813) -- 0:00:20
      675000 -- (-922.812) (-922.161) (-922.213) [-923.191] * (-926.903) (-924.414) (-923.687) [-924.741] -- 0:00:20

      Average standard deviation of split frequencies: 0.007835

      675500 -- (-922.628) (-922.374) (-925.871) [-928.316] * (-922.346) [-922.868] (-924.043) (-922.895) -- 0:00:20
      676000 -- (-923.615) (-924.326) [-924.512] (-925.825) * [-922.316] (-927.522) (-925.350) (-923.588) -- 0:00:20
      676500 -- (-927.005) (-925.502) (-924.791) [-924.875] * (-922.634) (-926.347) (-925.350) [-923.489] -- 0:00:20
      677000 -- (-923.797) (-923.481) (-924.470) [-923.777] * [-922.757] (-927.563) (-922.427) (-923.887) -- 0:00:20
      677500 -- [-924.338] (-923.979) (-924.266) (-924.961) * (-925.148) (-922.831) [-926.946] (-923.223) -- 0:00:20
      678000 -- (-928.592) (-922.888) [-924.617] (-923.782) * (-924.125) (-925.119) [-924.071] (-923.802) -- 0:00:20
      678500 -- [-925.205] (-924.318) (-928.158) (-927.739) * (-925.340) (-926.726) [-924.906] (-923.636) -- 0:00:20
      679000 -- (-922.532) (-925.804) (-922.561) [-928.610] * (-922.238) (-923.985) (-925.112) [-925.087] -- 0:00:20
      679500 -- [-927.154] (-927.860) (-922.584) (-928.080) * (-924.261) [-922.816] (-923.053) (-925.466) -- 0:00:20
      680000 -- (-926.057) (-922.503) [-923.746] (-926.843) * (-924.062) [-921.920] (-928.287) (-926.270) -- 0:00:20

      Average standard deviation of split frequencies: 0.008026

      680500 -- [-924.424] (-923.901) (-923.581) (-927.110) * (-924.135) [-923.298] (-923.757) (-926.162) -- 0:00:20
      681000 -- [-923.246] (-924.323) (-923.187) (-931.173) * (-921.955) (-923.955) (-923.449) [-923.742] -- 0:00:20
      681500 -- [-924.289] (-930.409) (-927.251) (-923.332) * (-921.893) (-931.338) [-926.926] (-923.928) -- 0:00:20
      682000 -- (-924.825) [-928.943] (-924.241) (-926.869) * (-923.778) (-928.906) (-925.448) [-923.097] -- 0:00:20
      682500 -- [-923.445] (-924.504) (-925.905) (-922.192) * (-923.843) (-924.448) (-924.726) [-923.025] -- 0:00:20
      683000 -- (-923.929) [-924.223] (-923.831) (-923.972) * [-923.273] (-922.743) (-924.606) (-924.499) -- 0:00:19
      683500 -- [-923.518] (-924.498) (-923.837) (-922.104) * (-925.267) (-924.868) [-923.522] (-924.705) -- 0:00:19
      684000 -- (-922.620) (-923.312) [-922.744] (-922.626) * [-923.652] (-923.896) (-922.620) (-924.397) -- 0:00:19
      684500 -- (-923.825) [-922.178] (-923.077) (-923.041) * (-926.112) (-923.074) [-924.481] (-925.562) -- 0:00:19
      685000 -- (-924.113) [-923.104] (-922.388) (-923.906) * [-924.023] (-925.181) (-923.807) (-925.806) -- 0:00:19

      Average standard deviation of split frequencies: 0.007761

      685500 -- [-924.726] (-929.520) (-922.883) (-923.254) * (-926.400) [-924.872] (-924.277) (-923.608) -- 0:00:19
      686000 -- (-926.161) (-924.001) [-923.228] (-922.668) * (-922.093) (-923.120) [-924.367] (-922.684) -- 0:00:19
      686500 -- (-924.746) (-925.510) [-923.041] (-925.082) * [-922.842] (-926.046) (-924.050) (-925.477) -- 0:00:19
      687000 -- (-926.375) (-925.994) [-923.842] (-923.014) * (-922.643) (-924.123) [-924.586] (-924.739) -- 0:00:19
      687500 -- [-925.277] (-926.957) (-923.737) (-928.477) * (-929.015) (-923.334) (-924.057) [-922.864] -- 0:00:20
      688000 -- (-930.135) [-925.689] (-927.264) (-929.211) * (-927.255) [-923.657] (-923.879) (-922.785) -- 0:00:19
      688500 -- [-928.385] (-922.106) (-926.137) (-923.798) * (-928.362) (-922.510) [-927.363] (-927.526) -- 0:00:19
      689000 -- (-924.798) (-923.166) [-922.776] (-923.331) * (-929.708) [-922.904] (-923.555) (-924.495) -- 0:00:19
      689500 -- (-923.270) (-922.830) (-923.757) [-924.095] * [-924.849] (-922.297) (-925.877) (-925.619) -- 0:00:19
      690000 -- (-922.691) [-923.543] (-924.036) (-925.056) * (-922.616) (-923.442) (-927.575) [-923.054] -- 0:00:19

      Average standard deviation of split frequencies: 0.007508

      690500 -- (-923.806) (-924.639) (-925.651) [-922.867] * (-924.016) [-922.870] (-930.390) (-925.616) -- 0:00:19
      691000 -- (-924.966) (-925.143) [-925.455] (-925.526) * [-925.037] (-922.286) (-931.397) (-923.576) -- 0:00:19
      691500 -- (-924.935) (-923.145) [-925.504] (-924.662) * (-924.552) [-921.978] (-922.762) (-924.275) -- 0:00:19
      692000 -- (-924.277) (-924.460) (-923.737) [-925.101] * (-925.650) (-922.124) (-923.723) [-922.923] -- 0:00:19
      692500 -- [-923.033] (-924.751) (-922.675) (-924.387) * (-929.702) (-925.623) (-924.977) [-924.647] -- 0:00:19
      693000 -- (-927.262) (-928.819) [-923.073] (-924.320) * (-925.543) (-923.148) [-930.681] (-925.788) -- 0:00:19
      693500 -- [-925.851] (-925.837) (-924.220) (-923.767) * (-924.417) (-929.228) [-924.257] (-928.351) -- 0:00:19
      694000 -- (-923.675) [-925.533] (-924.256) (-924.093) * (-929.045) (-923.121) (-923.640) [-927.204] -- 0:00:19
      694500 -- [-923.631] (-923.268) (-922.379) (-926.751) * [-924.178] (-924.866) (-924.725) (-923.184) -- 0:00:19
      695000 -- (-923.574) (-922.791) (-923.314) [-923.786] * (-923.278) (-924.869) (-925.321) [-923.082] -- 0:00:19

      Average standard deviation of split frequencies: 0.007689

      695500 -- [-925.505] (-925.639) (-924.073) (-926.649) * [-923.329] (-922.427) (-924.743) (-924.434) -- 0:00:19
      696000 -- [-926.496] (-923.910) (-922.242) (-926.830) * (-924.611) (-923.922) [-923.811] (-923.831) -- 0:00:19
      696500 -- [-922.122] (-922.306) (-923.396) (-925.359) * (-922.731) [-923.042] (-924.377) (-925.462) -- 0:00:19
      697000 -- (-923.540) (-929.003) (-923.428) [-923.225] * (-923.779) (-922.628) (-927.661) [-923.073] -- 0:00:19
      697500 -- (-924.353) [-923.822] (-924.486) (-923.683) * (-922.535) (-924.117) [-923.379] (-922.249) -- 0:00:19
      698000 -- [-923.589] (-923.030) (-922.809) (-924.273) * (-924.583) (-922.417) (-923.278) [-923.731] -- 0:00:19
      698500 -- [-925.246] (-923.640) (-922.428) (-925.214) * (-925.821) (-924.988) [-922.570] (-926.954) -- 0:00:18
      699000 -- (-924.756) (-923.982) [-924.677] (-926.704) * (-928.499) (-923.560) [-923.788] (-924.443) -- 0:00:18
      699500 -- (-923.891) [-922.069] (-925.245) (-925.351) * (-926.054) (-923.769) (-923.149) [-925.091] -- 0:00:18
      700000 -- (-924.317) (-922.481) (-923.520) [-922.142] * [-926.026] (-924.246) (-924.552) (-924.898) -- 0:00:18

      Average standard deviation of split frequencies: 0.007443

      700500 -- (-925.105) (-923.092) [-923.140] (-924.193) * (-926.026) [-923.808] (-922.250) (-923.601) -- 0:00:18
      701000 -- (-924.368) (-922.704) [-922.135] (-924.211) * (-926.249) (-922.401) [-922.768] (-923.985) -- 0:00:18
      701500 -- [-924.713] (-924.323) (-922.107) (-925.075) * (-924.518) (-922.523) [-922.978] (-926.208) -- 0:00:18
      702000 -- (-924.433) (-924.842) [-926.354] (-923.437) * (-923.347) (-924.235) (-924.886) [-926.429] -- 0:00:18
      702500 -- (-923.799) [-926.246] (-925.356) (-923.498) * (-924.397) (-923.716) (-923.066) [-924.202] -- 0:00:18
      703000 -- (-924.314) [-927.492] (-923.198) (-923.238) * (-923.436) (-921.859) [-924.806] (-925.138) -- 0:00:18
      703500 -- (-922.531) [-925.596] (-923.282) (-923.631) * (-925.857) [-923.46