--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:51:18 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2614/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -923.42 -927.46
2 -923.36 -927.41
--------------------------------------
TOTAL -923.39 -927.44
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886245 0.091007 0.354042 1.476781 0.856829 1370.23 1435.62 1.000
r(A<->C){all} 0.165023 0.020648 0.000045 0.452090 0.123932 126.59 168.83 1.000
r(A<->G){all} 0.168702 0.021566 0.000028 0.459620 0.124966 194.07 260.24 1.001
r(A<->T){all} 0.168678 0.020616 0.000075 0.447774 0.129642 205.10 221.61 1.000
r(C<->G){all} 0.171336 0.020274 0.000167 0.455112 0.137901 167.63 230.82 1.003
r(C<->T){all} 0.153119 0.017409 0.000066 0.409588 0.116758 235.34 239.04 1.000
r(G<->T){all} 0.173143 0.019989 0.000017 0.451005 0.138652 162.67 266.84 1.000
pi(A){all} 0.212814 0.000255 0.181547 0.242384 0.212645 1010.19 1046.96 1.000
pi(C){all} 0.284723 0.000305 0.252523 0.319864 0.284504 1025.06 1118.36 1.000
pi(G){all} 0.300139 0.000314 0.265258 0.333001 0.300031 976.26 1068.46 1.000
pi(T){all} 0.202324 0.000243 0.172453 0.234383 0.202104 1307.60 1320.27 1.000
alpha{1,2} 0.416738 0.232762 0.000150 1.427186 0.243712 1311.05 1364.88 1.001
alpha{3} 0.458253 0.241201 0.000251 1.447010 0.287248 1163.09 1332.05 1.000
pinvar{all} 0.997606 0.000010 0.992225 0.999999 0.998572 1338.65 1354.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -884.530304
Model 2: PositiveSelection -884.530381
Model 0: one-ratio -884.530405
Model 7: beta -884.530304
Model 8: beta&w>1 -884.530304
Model 0 vs 1 2.0199999994474638E-4
Model 2 vs 1 1.5400000006593473E-4
Model 8 vs 7 0.0
>C1
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C2
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C3
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C4
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C5
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C6
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=224
C1 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C2 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C3 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C4 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C5 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C6 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
**************************************************
C1 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C2 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C3 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C4 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C5 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C6 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
**************************************************
C1 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C2 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C3 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C4 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C5 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C6 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
**************************************************
C1 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C2 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C3 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C4 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C5 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C6 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
**************************************************
C1 HWSLRLDVSDVDGKLMISHLESIR
C2 HWSLRLDVSDVDGKLMISHLESIR
C3 HWSLRLDVSDVDGKLMISHLESIR
C4 HWSLRLDVSDVDGKLMISHLESIR
C5 HWSLRLDVSDVDGKLMISHLESIR
C6 HWSLRLDVSDVDGKLMISHLESIR
************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 224 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 224 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6720]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6720]--->[6720]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.487 Mb, Max= 30.772 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C2 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C3 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C4 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C5 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
C6 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
**************************************************
C1 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C2 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C3 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C4 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C5 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
C6 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
**************************************************
C1 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C2 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C3 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C4 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C5 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
C6 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
**************************************************
C1 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C2 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C3 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C4 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C5 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
C6 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
**************************************************
C1 HWSLRLDVSDVDGKLMISHLESIR
C2 HWSLRLDVSDVDGKLMISHLESIR
C3 HWSLRLDVSDVDGKLMISHLESIR
C4 HWSLRLDVSDVDGKLMISHLESIR
C5 HWSLRLDVSDVDGKLMISHLESIR
C6 HWSLRLDVSDVDGKLMISHLESIR
************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
C2 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
C3 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
C4 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
C5 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
C6 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
**************************************************
C1 GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
C2 GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
C3 GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
C4 GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
C5 GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
C6 GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
**************************************************
C1 CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
C2 CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
C3 CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
C4 CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
C5 CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
C6 CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
**************************************************
C1 TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
C2 TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
C3 TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
C4 TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
C5 TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
C6 TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
**************************************************
C1 CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
C2 CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
C3 CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
C4 CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
C5 CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
C6 CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
**************************************************
C1 ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
C2 ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
C3 ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
C4 ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
C5 ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
C6 ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
**************************************************
C1 ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
C2 ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
C3 ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
C4 ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
C5 ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
C6 ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
**************************************************
C1 AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
C2 AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
C3 AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
C4 AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
C5 AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
C6 AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
**************************************************
C1 TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
C2 TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
C3 TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
C4 TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
C5 TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
C6 TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
**************************************************
C1 GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
C2 GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
C3 GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
C4 GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
C5 GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
C6 GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
**************************************************
C1 GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
C2 GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
C3 GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
C4 GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
C5 GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
C6 GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
**************************************************
C1 TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
C2 TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
C3 TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
C4 TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
C5 TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
C6 TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
**************************************************
C1 CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
C2 CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
C3 CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
C4 CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
C5 CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
C6 CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
**************************************************
C1 CTCTCACCTTGAGTCAATCCGA
C2 CTCTCACCTTGAGTCAATCCGA
C3 CTCTCACCTTGAGTCAATCCGA
C4 CTCTCACCTTGAGTCAATCCGA
C5 CTCTCACCTTGAGTCAATCCGA
C6 CTCTCACCTTGAGTCAATCCGA
**********************
>C1
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C2
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C3
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C4
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C5
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C6
GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA
GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT
CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA
TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT
CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC
ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC
ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG
AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG
TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC
GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT
GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC
TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG
CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT
CTCTCACCTTGAGTCAATCCGA
>C1
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C2
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C3
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C4
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C5
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
>C6
VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
HWSLRLDVSDVDGKLMISHLESIR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 672 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859398
Setting output file names to "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 940442006
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5743920978
Seed = 589812322
Swapseed = 1579859398
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1503.968130 -- -24.965149
Chain 2 -- -1503.967988 -- -24.965149
Chain 3 -- -1503.968130 -- -24.965149
Chain 4 -- -1503.968217 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1503.968217 -- -24.965149
Chain 2 -- -1503.968217 -- -24.965149
Chain 3 -- -1503.968130 -- -24.965149
Chain 4 -- -1503.967988 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1503.968] (-1503.968) (-1503.968) (-1503.968) * [-1503.968] (-1503.968) (-1503.968) (-1503.968)
500 -- [-932.751] (-935.367) (-935.933) (-931.971) * (-931.712) (-937.830) (-930.582) [-936.382] -- 0:00:00
1000 -- (-932.432) [-931.876] (-933.434) (-941.189) * (-938.174) (-932.899) [-930.291] (-928.763) -- 0:00:00
1500 -- (-932.556) (-931.586) (-937.205) [-931.922] * (-936.680) (-932.106) [-929.135] (-928.665) -- 0:00:00
2000 -- (-937.343) (-938.903) [-928.296] (-931.719) * (-930.815) (-928.950) (-931.641) [-933.492] -- 0:00:00
2500 -- (-938.162) (-930.350) [-934.149] (-931.664) * [-930.548] (-927.341) (-938.770) (-929.397) -- 0:00:00
3000 -- [-938.451] (-927.782) (-927.303) (-930.327) * (-935.684) (-930.453) (-930.553) [-935.819] -- 0:00:00
3500 -- [-932.847] (-932.073) (-926.945) (-935.425) * [-927.141] (-933.363) (-938.403) (-930.046) -- 0:00:00
4000 -- (-933.006) (-932.252) [-930.286] (-936.591) * (-933.952) [-930.726] (-933.262) (-933.160) -- 0:00:00
4500 -- (-938.815) (-929.267) (-940.395) [-934.072] * (-936.967) [-931.965] (-938.670) (-934.549) -- 0:00:00
5000 -- (-930.856) [-934.783] (-932.250) (-932.723) * (-934.080) (-939.242) [-935.135] (-932.406) -- 0:00:00
Average standard deviation of split frequencies: 0.107137
5500 -- (-931.307) (-933.330) [-931.444] (-940.793) * [-931.134] (-929.275) (-935.192) (-934.654) -- 0:00:00
6000 -- (-937.820) [-932.951] (-932.987) (-943.592) * (-943.746) (-933.903) [-931.058] (-928.396) -- 0:00:00
6500 -- [-933.161] (-927.210) (-931.679) (-930.279) * (-930.084) (-936.581) (-936.761) [-932.241] -- 0:00:00
7000 -- [-929.475] (-938.098) (-934.910) (-939.343) * (-926.973) (-928.790) [-933.875] (-936.581) -- 0:00:00
7500 -- (-937.114) [-931.743] (-927.015) (-932.873) * (-939.924) (-930.321) (-930.495) [-934.002] -- 0:00:00
8000 -- (-934.269) (-938.134) [-930.784] (-925.337) * (-932.212) (-933.461) [-932.312] (-932.989) -- 0:00:00
8500 -- (-935.793) [-930.369] (-936.385) (-922.410) * (-940.433) (-939.890) [-935.010] (-937.367) -- 0:00:00
9000 -- (-931.609) (-931.905) [-928.038] (-923.198) * [-930.225] (-942.095) (-938.490) (-939.879) -- 0:00:00
9500 -- (-931.094) (-935.514) [-925.652] (-923.325) * [-937.112] (-929.994) (-929.833) (-932.116) -- 0:00:00
10000 -- (-934.987) [-938.081] (-934.608) (-923.404) * (-929.920) (-936.967) [-940.626] (-928.683) -- 0:00:00
Average standard deviation of split frequencies: 0.061872
10500 -- (-930.191) (-943.574) (-936.329) [-924.467] * (-937.762) (-936.432) [-933.170] (-930.571) -- 0:00:00
11000 -- (-940.393) (-940.640) (-932.723) [-923.355] * (-930.526) (-940.474) (-934.742) [-929.841] -- 0:00:00
11500 -- (-939.351) [-936.579] (-936.432) (-923.559) * (-931.091) (-930.273) (-933.078) [-929.375] -- 0:00:00
12000 -- (-928.077) [-933.011] (-931.259) (-925.254) * [-930.239] (-930.420) (-934.827) (-939.505) -- 0:00:00
12500 -- (-934.823) (-939.465) (-938.566) [-923.315] * (-932.475) (-941.017) (-928.779) [-923.989] -- 0:00:00
13000 -- (-934.345) (-938.801) (-941.338) [-923.473] * (-939.497) (-929.690) [-931.045] (-923.870) -- 0:00:00
13500 -- [-936.680] (-938.385) (-926.543) (-924.223) * [-934.216] (-933.126) (-940.160) (-923.347) -- 0:00:00
14000 -- (-935.686) [-933.269] (-923.337) (-925.811) * (-931.273) [-931.604] (-931.584) (-923.554) -- 0:01:10
14500 -- (-936.089) [-936.847] (-925.378) (-927.893) * (-938.672) (-936.655) [-932.995] (-924.247) -- 0:01:07
15000 -- (-931.083) [-931.724] (-925.242) (-929.480) * (-931.640) [-936.961] (-935.515) (-924.658) -- 0:01:05
Average standard deviation of split frequencies: 0.045667
15500 -- (-953.599) [-931.417] (-923.555) (-930.614) * (-931.201) (-935.833) (-942.547) [-922.874] -- 0:01:03
16000 -- [-932.231] (-934.618) (-923.006) (-931.835) * (-936.099) (-938.648) [-934.155] (-922.321) -- 0:01:01
16500 -- (-934.826) (-934.751) [-924.656] (-928.195) * (-933.387) [-928.369] (-938.430) (-923.914) -- 0:00:59
17000 -- [-939.052] (-938.325) (-923.015) (-924.177) * [-933.328] (-933.909) (-939.926) (-923.265) -- 0:00:57
17500 -- (-930.736) [-937.626] (-922.094) (-926.515) * (-938.614) (-933.086) (-930.557) [-923.124] -- 0:00:56
18000 -- (-940.592) [-932.259] (-923.176) (-923.393) * [-929.997] (-930.074) (-923.255) (-923.909) -- 0:00:54
18500 -- [-929.466] (-931.235) (-922.189) (-923.573) * [-943.570] (-926.721) (-928.066) (-924.933) -- 0:00:53
19000 -- (-940.351) (-942.625) [-924.370] (-924.872) * (-924.679) (-935.421) [-922.361] (-924.835) -- 0:00:51
19500 -- (-947.667) [-936.090] (-922.806) (-930.611) * (-923.479) (-935.536) (-927.591) [-924.195] -- 0:00:50
20000 -- (-932.287) (-931.984) [-922.698] (-924.616) * [-927.335] (-939.598) (-924.627) (-927.911) -- 0:00:49
Average standard deviation of split frequencies: 0.058165
20500 -- (-927.099) (-932.228) (-923.986) [-925.216] * (-927.516) [-935.911] (-926.511) (-925.881) -- 0:00:47
21000 -- [-928.562] (-936.384) (-925.748) (-928.369) * (-923.824) (-938.090) (-923.915) [-924.795] -- 0:00:46
21500 -- [-932.911] (-941.201) (-923.833) (-927.189) * (-923.928) (-928.221) [-924.461] (-924.575) -- 0:00:45
22000 -- (-931.386) [-939.905] (-924.631) (-923.411) * (-922.129) (-929.653) [-925.779] (-924.911) -- 0:00:44
22500 -- (-931.249) (-934.554) [-923.792] (-924.303) * (-922.504) (-937.381) (-922.899) [-922.802] -- 0:00:43
23000 -- [-929.303] (-937.135) (-924.923) (-923.499) * (-923.070) [-934.261] (-923.985) (-925.597) -- 0:00:42
23500 -- (-936.659) [-928.737] (-924.372) (-924.177) * (-924.169) [-930.053] (-923.953) (-925.528) -- 0:00:41
24000 -- (-931.467) [-931.805] (-924.020) (-923.366) * (-923.278) [-931.559] (-923.356) (-926.823) -- 0:00:40
24500 -- (-934.121) [-938.431] (-924.562) (-924.436) * (-923.038) (-932.495) [-923.050] (-928.564) -- 0:00:39
25000 -- (-934.950) (-927.947) [-924.749] (-927.035) * [-923.869] (-938.202) (-924.317) (-923.495) -- 0:00:39
Average standard deviation of split frequencies: 0.054393
25500 -- (-930.608) [-929.147] (-925.208) (-923.975) * (-926.518) (-933.607) [-925.927] (-922.146) -- 0:00:38
26000 -- (-936.966) [-926.131] (-926.649) (-922.954) * (-923.598) [-938.667] (-924.242) (-923.490) -- 0:00:37
26500 -- (-939.373) (-923.826) [-925.767] (-925.354) * [-923.891] (-929.542) (-923.894) (-923.105) -- 0:00:36
27000 -- (-936.480) [-922.519] (-922.936) (-927.920) * [-923.037] (-934.622) (-926.387) (-926.231) -- 0:00:36
27500 -- (-937.094) (-923.890) (-925.187) [-926.825] * (-925.131) (-932.250) (-927.357) [-925.765] -- 0:00:35
28000 -- [-933.727] (-923.739) (-926.237) (-924.591) * [-928.133] (-941.097) (-922.791) (-922.377) -- 0:00:34
28500 -- [-927.181] (-924.513) (-923.605) (-927.474) * (-922.616) [-933.269] (-924.215) (-922.667) -- 0:00:34
29000 -- (-931.148) [-925.286] (-924.139) (-927.367) * (-922.738) (-937.467) (-922.482) [-922.430] -- 0:00:33
29500 -- (-925.443) (-924.777) (-926.159) [-922.156] * (-922.808) (-931.761) [-922.354] (-925.371) -- 0:00:32
30000 -- (-923.829) (-923.189) (-925.654) [-922.946] * (-922.730) (-931.465) [-922.940] (-924.652) -- 0:00:32
Average standard deviation of split frequencies: 0.051240
30500 -- (-923.790) (-925.893) [-922.803] (-924.568) * (-926.511) (-932.591) [-923.632] (-924.063) -- 0:01:03
31000 -- (-922.596) [-924.276] (-922.587) (-925.109) * (-923.436) [-934.372] (-924.564) (-924.537) -- 0:01:02
31500 -- [-922.713] (-926.523) (-923.538) (-928.643) * (-925.064) (-937.903) (-924.804) [-929.289] -- 0:01:01
32000 -- [-925.268] (-926.006) (-927.008) (-923.691) * (-924.798) [-930.272] (-927.285) (-926.120) -- 0:01:00
32500 -- (-927.123) (-925.730) (-923.320) [-923.579] * (-923.065) [-929.528] (-929.668) (-924.261) -- 0:00:59
33000 -- (-928.313) (-925.774) (-922.988) [-923.204] * (-922.279) (-935.343) [-922.798] (-924.107) -- 0:00:58
33500 -- (-923.825) (-925.772) (-923.085) [-923.109] * (-926.410) (-930.897) (-923.602) [-924.416] -- 0:00:57
34000 -- [-922.247] (-922.816) (-926.199) (-924.226) * (-922.496) (-934.638) (-923.828) [-922.936] -- 0:00:56
34500 -- (-924.661) [-923.363] (-925.961) (-923.597) * (-922.554) (-933.505) [-924.152] (-923.598) -- 0:00:55
35000 -- (-923.591) (-923.156) [-924.850] (-924.141) * (-922.546) (-936.230) [-924.367] (-924.962) -- 0:00:55
Average standard deviation of split frequencies: 0.037101
35500 -- (-922.991) [-922.916] (-927.247) (-923.345) * (-922.573) (-930.087) [-924.195] (-924.942) -- 0:00:54
36000 -- (-927.414) [-927.817] (-924.061) (-923.823) * (-924.965) (-937.471) (-926.160) [-925.412] -- 0:00:53
36500 -- (-928.349) [-929.181] (-925.591) (-924.180) * (-922.101) (-929.860) [-928.400] (-922.724) -- 0:00:52
37000 -- (-925.831) (-923.391) [-926.968] (-924.081) * (-921.973) (-931.924) [-924.543] (-922.135) -- 0:00:52
37500 -- [-922.362] (-924.756) (-927.487) (-924.408) * (-927.975) (-930.636) (-922.479) [-922.588] -- 0:00:51
38000 -- (-926.957) (-922.199) (-925.733) [-925.511] * (-926.240) (-940.441) (-922.849) [-924.940] -- 0:00:50
38500 -- [-924.508] (-923.722) (-923.342) (-923.729) * (-927.635) [-926.212] (-924.338) (-922.581) -- 0:00:49
39000 -- (-922.481) (-922.747) [-922.934] (-923.784) * (-924.095) [-930.665] (-923.208) (-924.585) -- 0:00:49
39500 -- (-923.525) (-924.224) (-925.607) [-923.272] * (-924.201) (-930.664) (-923.802) [-924.626] -- 0:00:48
40000 -- (-922.361) (-922.505) (-923.030) [-926.400] * (-924.994) [-936.899] (-923.772) (-923.178) -- 0:00:48
Average standard deviation of split frequencies: 0.034776
40500 -- [-925.039] (-928.212) (-925.280) (-924.814) * [-923.415] (-933.450) (-923.972) (-923.491) -- 0:00:47
41000 -- (-927.106) (-924.390) (-922.233) [-922.434] * (-922.919) (-931.447) [-924.455] (-924.186) -- 0:00:46
41500 -- [-924.144] (-923.033) (-923.161) (-922.616) * (-924.120) (-936.494) [-922.538] (-926.121) -- 0:00:46
42000 -- (-923.972) (-922.842) [-923.804] (-927.189) * (-923.045) [-936.470] (-924.090) (-925.032) -- 0:00:45
42500 -- (-924.152) (-923.981) [-923.219] (-925.370) * (-927.215) (-930.933) (-923.682) [-924.535] -- 0:00:45
43000 -- (-928.993) (-924.138) (-923.206) [-924.951] * (-924.439) (-937.097) (-924.430) [-923.948] -- 0:00:44
43500 -- (-925.210) (-922.592) [-924.969] (-922.874) * [-921.993] (-935.402) (-927.398) (-925.410) -- 0:00:43
44000 -- (-923.275) (-925.049) [-924.820] (-923.638) * (-921.863) [-930.817] (-925.289) (-926.781) -- 0:00:43
44500 -- [-924.345] (-922.958) (-924.227) (-923.925) * (-923.743) (-946.730) [-923.180] (-924.063) -- 0:00:42
45000 -- [-924.244] (-923.471) (-927.176) (-925.803) * [-922.005] (-935.284) (-923.473) (-923.107) -- 0:00:42
Average standard deviation of split frequencies: 0.035868
45500 -- (-922.482) (-923.101) [-923.534] (-926.436) * (-925.461) (-935.029) [-922.154] (-923.402) -- 0:00:41
46000 -- (-922.871) [-923.321] (-923.776) (-929.018) * (-930.963) (-931.435) [-922.157] (-922.783) -- 0:00:41
46500 -- [-924.087] (-923.661) (-925.057) (-923.220) * [-922.167] (-935.426) (-925.211) (-923.122) -- 0:01:01
47000 -- [-923.763] (-923.470) (-927.333) (-923.198) * (-921.889) (-933.688) (-924.164) [-922.944] -- 0:01:00
47500 -- (-923.415) (-924.310) [-924.261] (-923.907) * (-930.392) (-937.259) (-930.145) [-922.357] -- 0:01:00
48000 -- (-926.320) [-922.828] (-922.437) (-923.714) * (-922.802) [-935.556] (-927.593) (-924.729) -- 0:00:59
48500 -- (-926.598) (-922.389) [-925.406] (-923.879) * [-923.442] (-942.372) (-927.861) (-925.058) -- 0:00:58
49000 -- (-926.178) [-923.061] (-925.137) (-925.814) * (-923.526) (-940.356) [-924.622] (-924.380) -- 0:00:58
49500 -- (-926.209) (-922.827) [-928.489] (-924.516) * (-922.738) [-923.441] (-926.314) (-925.403) -- 0:00:57
50000 -- (-922.871) [-922.820] (-925.118) (-923.922) * (-922.321) (-923.343) (-925.487) [-928.060] -- 0:00:57
Average standard deviation of split frequencies: 0.035257
50500 -- [-922.093] (-922.237) (-924.278) (-927.139) * (-923.419) (-924.878) [-923.758] (-924.392) -- 0:00:56
51000 -- [-922.940] (-926.121) (-928.108) (-923.146) * (-926.119) [-924.316] (-925.813) (-923.453) -- 0:00:55
51500 -- (-924.947) [-924.868] (-925.522) (-924.319) * (-930.687) (-923.641) (-922.991) [-925.342] -- 0:00:55
52000 -- [-923.800] (-925.479) (-925.893) (-924.427) * (-928.472) (-922.525) [-923.691] (-930.550) -- 0:00:54
52500 -- (-925.126) (-924.102) [-922.988] (-925.438) * (-923.626) [-925.494] (-923.531) (-925.139) -- 0:00:54
53000 -- (-923.532) (-923.544) [-923.637] (-924.812) * (-923.454) [-924.794] (-922.300) (-925.388) -- 0:00:53
53500 -- (-926.101) (-925.067) (-926.609) [-923.999] * (-923.588) [-926.015] (-923.420) (-923.909) -- 0:00:53
54000 -- [-924.038] (-927.632) (-924.039) (-923.052) * [-922.822] (-926.947) (-923.397) (-923.858) -- 0:00:52
54500 -- [-926.249] (-925.577) (-923.682) (-924.042) * (-927.751) [-924.430] (-924.212) (-922.800) -- 0:00:52
55000 -- [-923.606] (-922.855) (-924.426) (-924.144) * (-928.788) (-924.260) (-922.017) [-924.164] -- 0:00:51
Average standard deviation of split frequencies: 0.037216
55500 -- [-924.577] (-926.351) (-922.559) (-923.547) * (-925.144) (-922.310) [-922.154] (-923.036) -- 0:00:51
56000 -- (-926.578) [-923.089] (-922.519) (-927.958) * (-924.557) (-923.042) (-926.600) [-923.642] -- 0:00:50
56500 -- (-927.217) (-924.249) (-923.316) [-922.779] * [-923.619] (-923.437) (-926.136) (-923.475) -- 0:00:50
57000 -- (-922.246) (-924.946) (-924.302) [-923.320] * (-923.587) (-926.156) (-924.524) [-923.681] -- 0:00:49
57500 -- [-924.034] (-925.540) (-923.306) (-922.035) * (-925.401) (-923.275) (-928.412) [-928.911] -- 0:00:49
58000 -- (-929.404) (-926.293) (-924.723) [-922.197] * (-927.570) (-924.946) [-922.774] (-926.523) -- 0:00:48
58500 -- (-926.985) [-925.985] (-924.162) (-921.850) * (-924.260) [-925.894] (-923.642) (-924.468) -- 0:00:48
59000 -- (-928.197) [-923.137] (-924.945) (-922.396) * (-929.397) (-923.828) [-923.108] (-923.958) -- 0:00:47
59500 -- (-922.340) [-922.555] (-923.641) (-922.984) * (-930.434) (-922.793) (-922.788) [-923.995] -- 0:00:47
60000 -- (-922.929) (-922.671) (-924.538) [-924.313] * (-923.781) [-923.308] (-922.603) (-923.366) -- 0:00:47
Average standard deviation of split frequencies: 0.027585
60500 -- (-927.359) (-922.663) (-923.408) [-923.499] * [-925.078] (-922.616) (-925.341) (-923.402) -- 0:00:46
61000 -- [-925.854] (-922.843) (-923.296) (-925.111) * (-924.368) [-923.889] (-923.653) (-922.964) -- 0:00:46
61500 -- (-924.398) (-923.719) (-922.211) [-924.724] * [-926.725] (-923.022) (-923.451) (-923.052) -- 0:00:45
62000 -- (-923.365) [-922.155] (-922.968) (-923.754) * [-924.300] (-922.961) (-924.030) (-922.411) -- 0:00:45
62500 -- (-925.471) (-924.362) [-923.991] (-922.465) * [-927.015] (-922.523) (-923.515) (-922.462) -- 0:00:45
63000 -- [-926.174] (-922.269) (-924.237) (-924.297) * (-924.433) [-923.826] (-923.784) (-925.670) -- 0:00:44
63500 -- (-922.803) (-922.298) [-926.604] (-924.824) * (-923.678) [-925.921] (-925.445) (-924.536) -- 0:00:58
64000 -- (-926.404) (-923.413) (-922.844) [-922.589] * [-925.379] (-928.234) (-928.544) (-924.625) -- 0:00:58
64500 -- (-923.858) (-922.547) (-924.680) [-923.941] * (-925.877) [-924.694] (-925.541) (-929.042) -- 0:00:58
65000 -- (-923.544) [-922.603] (-924.619) (-923.011) * (-924.509) [-924.329] (-924.911) (-925.262) -- 0:00:57
Average standard deviation of split frequencies: 0.028230
65500 -- (-927.867) [-923.700] (-927.830) (-925.126) * (-927.544) (-923.157) [-925.104] (-925.529) -- 0:00:57
66000 -- (-924.458) (-924.053) (-925.834) [-924.212] * (-924.713) (-922.076) [-924.470] (-924.093) -- 0:00:56
66500 -- (-923.396) (-924.662) (-925.005) [-924.906] * (-923.076) (-922.181) [-924.277] (-925.036) -- 0:00:56
67000 -- (-924.144) [-924.271] (-926.015) (-927.396) * (-926.320) (-922.375) (-922.281) [-922.477] -- 0:00:55
67500 -- (-923.419) (-925.560) [-923.264] (-925.584) * (-926.167) (-925.227) (-922.388) [-922.296] -- 0:00:55
68000 -- (-926.216) [-925.033] (-924.307) (-925.545) * (-924.202) [-926.452] (-922.511) (-925.176) -- 0:00:54
68500 -- (-928.527) [-924.923] (-922.101) (-927.127) * (-926.283) (-923.767) (-924.166) [-926.159] -- 0:00:54
69000 -- (-926.154) (-927.882) (-926.061) [-922.279] * (-928.241) (-926.573) (-924.100) [-923.905] -- 0:00:53
69500 -- (-923.154) (-925.614) (-924.318) [-926.140] * (-923.364) (-926.352) [-927.111] (-922.429) -- 0:00:53
70000 -- (-925.300) [-924.184] (-922.022) (-924.684) * (-925.584) (-925.015) (-923.383) [-925.782] -- 0:00:53
Average standard deviation of split frequencies: 0.029352
70500 -- (-923.914) (-923.232) (-924.334) [-924.998] * (-923.350) [-924.284] (-925.626) (-926.372) -- 0:00:52
71000 -- [-923.504] (-925.450) (-925.657) (-925.514) * [-923.257] (-924.137) (-926.596) (-929.521) -- 0:00:52
71500 -- (-924.039) (-924.123) [-922.049] (-923.666) * (-924.096) (-925.168) [-928.766] (-929.619) -- 0:00:51
72000 -- (-923.830) (-926.072) (-923.579) [-926.801] * (-928.070) (-925.519) [-924.062] (-925.878) -- 0:00:51
72500 -- (-924.233) (-925.832) (-923.636) [-924.874] * [-924.909] (-923.435) (-923.900) (-924.111) -- 0:00:51
73000 -- [-926.306] (-923.167) (-924.205) (-922.755) * (-925.377) (-923.426) [-923.891] (-926.369) -- 0:00:50
73500 -- [-923.693] (-923.975) (-922.586) (-924.803) * (-924.664) (-923.246) [-924.416] (-925.676) -- 0:00:50
74000 -- (-927.416) (-923.897) [-924.944] (-922.658) * [-922.729] (-923.761) (-924.712) (-927.249) -- 0:00:50
74500 -- (-923.258) (-922.254) (-925.770) [-922.549] * (-924.579) (-924.201) [-922.435] (-928.125) -- 0:00:49
75000 -- (-927.261) (-924.385) (-924.068) [-922.800] * (-924.164) (-924.629) [-923.676] (-928.300) -- 0:00:49
Average standard deviation of split frequencies: 0.024501
75500 -- [-923.577] (-925.594) (-924.455) (-925.013) * (-926.325) (-923.265) (-927.000) [-923.195] -- 0:00:48
76000 -- (-924.605) (-924.151) (-923.714) [-924.095] * (-923.045) [-927.424] (-924.216) (-923.094) -- 0:00:48
76500 -- [-927.932] (-923.056) (-922.708) (-923.015) * (-925.193) (-924.837) (-922.927) [-924.420] -- 0:00:48
77000 -- [-926.310] (-924.125) (-923.840) (-923.989) * [-923.537] (-925.422) (-923.946) (-923.779) -- 0:00:47
77500 -- [-924.811] (-923.547) (-922.442) (-926.352) * (-923.039) (-923.822) [-923.803] (-925.375) -- 0:00:47
78000 -- (-922.468) (-923.243) (-926.869) [-923.593] * [-925.075] (-923.012) (-924.784) (-927.044) -- 0:00:47
78500 -- [-925.033] (-923.603) (-922.074) (-923.187) * [-925.088] (-923.411) (-927.183) (-929.997) -- 0:00:46
79000 -- (-924.933) (-923.045) (-923.785) [-925.803] * (-922.597) (-922.950) (-932.423) [-923.329] -- 0:00:46
79500 -- (-923.052) (-922.575) [-922.621] (-928.286) * (-923.628) [-923.004] (-925.785) (-925.370) -- 0:00:57
80000 -- (-922.495) (-922.856) [-923.966] (-926.209) * (-922.446) [-924.363] (-923.977) (-922.615) -- 0:00:57
Average standard deviation of split frequencies: 0.023668
80500 -- (-922.906) (-925.888) (-922.059) [-923.378] * [-922.708] (-926.636) (-924.219) (-923.804) -- 0:00:57
81000 -- [-928.606] (-922.841) (-924.964) (-923.374) * (-922.530) (-924.108) [-924.438] (-925.576) -- 0:00:56
81500 -- [-924.956] (-923.045) (-929.048) (-922.005) * (-923.200) (-926.249) [-924.376] (-925.143) -- 0:00:56
82000 -- (-923.806) (-923.457) (-926.332) [-923.524] * (-926.406) [-926.256] (-928.992) (-924.105) -- 0:00:55
82500 -- (-925.026) [-923.827] (-927.060) (-922.525) * (-925.218) (-926.265) (-923.326) [-922.830] -- 0:00:55
83000 -- (-928.845) [-924.888] (-926.572) (-923.054) * (-924.705) [-923.292] (-923.922) (-923.231) -- 0:00:55
83500 -- (-929.491) [-924.139] (-922.297) (-927.970) * [-926.002] (-925.144) (-924.235) (-926.790) -- 0:00:54
84000 -- (-924.510) [-928.555] (-922.854) (-930.139) * (-922.668) [-925.169] (-923.090) (-924.518) -- 0:00:54
84500 -- (-922.974) [-924.479] (-925.639) (-925.873) * (-922.491) (-923.988) [-924.342] (-924.002) -- 0:00:54
85000 -- (-923.247) (-926.948) [-924.064] (-925.906) * [-927.721] (-926.442) (-926.284) (-925.269) -- 0:00:53
Average standard deviation of split frequencies: 0.020830
85500 -- (-922.716) (-923.430) [-922.560] (-923.963) * (-922.290) [-925.726] (-923.795) (-925.163) -- 0:00:53
86000 -- (-922.868) [-924.166] (-928.193) (-924.915) * (-923.554) (-922.653) [-924.055] (-922.781) -- 0:00:53
86500 -- [-924.708] (-923.120) (-922.734) (-928.226) * (-926.244) [-922.389] (-923.139) (-926.523) -- 0:00:52
87000 -- [-923.055] (-922.485) (-924.228) (-925.040) * [-923.529] (-922.985) (-924.267) (-925.881) -- 0:00:52
87500 -- [-925.458] (-924.541) (-925.889) (-926.685) * (-923.570) (-924.586) (-929.422) [-923.860] -- 0:00:52
88000 -- (-925.791) (-924.023) (-926.121) [-924.357] * (-923.558) [-923.251] (-927.255) (-923.763) -- 0:00:51
88500 -- (-923.791) (-927.248) (-924.226) [-924.521] * (-923.408) (-924.744) [-922.421] (-923.536) -- 0:00:51
89000 -- (-923.116) [-925.593] (-922.289) (-924.142) * (-924.182) [-926.518] (-923.711) (-923.363) -- 0:00:51
89500 -- (-923.623) (-927.083) (-926.288) [-924.203] * (-922.836) [-925.144] (-930.291) (-926.131) -- 0:00:50
90000 -- [-924.341] (-926.186) (-924.493) (-925.212) * (-922.407) [-923.256] (-927.726) (-923.452) -- 0:00:50
Average standard deviation of split frequencies: 0.022357
90500 -- (-923.252) (-924.525) (-924.795) [-922.421] * (-924.694) (-924.236) (-927.131) [-925.974] -- 0:00:50
91000 -- [-927.870] (-924.332) (-923.925) (-924.579) * (-925.104) (-926.719) (-924.201) [-924.677] -- 0:00:49
91500 -- [-925.300] (-925.623) (-924.564) (-928.296) * [-924.344] (-923.701) (-924.462) (-921.799) -- 0:00:49
92000 -- (-924.681) [-928.474] (-925.891) (-924.045) * (-924.232) (-922.822) (-924.732) [-924.090] -- 0:00:49
92500 -- (-923.824) (-928.724) [-925.709] (-928.396) * (-926.057) [-924.387] (-928.788) (-924.689) -- 0:00:49
93000 -- (-923.677) [-928.250] (-927.531) (-927.285) * (-926.851) (-922.967) [-924.278] (-924.045) -- 0:00:48
93500 -- [-922.795] (-928.222) (-923.343) (-924.232) * [-922.348] (-924.102) (-923.076) (-922.287) -- 0:00:48
94000 -- (-922.125) [-925.295] (-925.331) (-929.202) * (-924.918) (-928.935) (-924.989) [-921.959] -- 0:00:48
94500 -- [-927.284] (-923.576) (-924.669) (-924.383) * [-925.488] (-924.305) (-923.190) (-922.509) -- 0:00:47
95000 -- (-926.847) (-923.625) [-924.327] (-922.578) * (-922.591) [-923.013] (-924.024) (-922.239) -- 0:00:47
Average standard deviation of split frequencies: 0.023570
95500 -- (-928.146) (-923.775) (-927.277) [-922.401] * (-923.114) [-923.739] (-922.708) (-922.239) -- 0:00:47
96000 -- (-925.041) [-926.020] (-923.383) (-923.077) * (-926.580) [-921.773] (-923.337) (-922.307) -- 0:00:56
96500 -- (-924.281) (-925.171) (-924.482) [-925.896] * [-925.603] (-925.641) (-925.969) (-922.669) -- 0:00:56
97000 -- [-926.203] (-924.923) (-923.827) (-923.723) * (-923.045) (-925.732) [-923.024] (-926.276) -- 0:00:55
97500 -- (-922.012) (-924.125) (-928.453) [-923.749] * [-922.166] (-923.180) (-923.786) (-928.086) -- 0:00:55
98000 -- (-921.859) (-927.443) (-924.528) [-924.826] * [-923.697] (-922.527) (-924.756) (-922.777) -- 0:00:55
98500 -- (-922.133) (-923.832) [-925.354] (-926.767) * (-922.631) (-924.184) [-924.839] (-925.236) -- 0:00:54
99000 -- (-923.829) [-922.332] (-923.382) (-929.174) * (-926.610) (-925.767) [-923.787] (-924.243) -- 0:00:54
99500 -- (-924.201) [-924.900] (-924.011) (-927.768) * (-927.857) (-923.178) (-926.083) [-923.067] -- 0:00:54
100000 -- [-923.554] (-922.516) (-924.983) (-923.472) * (-932.207) (-924.717) [-921.758] (-926.692) -- 0:00:54
Average standard deviation of split frequencies: 0.023168
100500 -- (-926.850) (-922.794) (-923.738) [-924.107] * (-924.410) [-924.411] (-922.090) (-926.766) -- 0:00:53
101000 -- (-922.548) [-923.748] (-924.527) (-922.758) * (-923.247) [-922.891] (-924.589) (-922.620) -- 0:00:53
101500 -- (-923.972) [-923.741] (-923.284) (-922.133) * [-922.978] (-923.133) (-924.038) (-922.988) -- 0:00:53
102000 -- (-925.722) (-925.120) [-922.848] (-924.205) * [-924.413] (-922.837) (-923.948) (-923.197) -- 0:00:52
102500 -- (-927.054) [-928.640] (-923.049) (-924.280) * (-925.697) (-922.825) (-922.693) [-922.864] -- 0:00:52
103000 -- (-927.512) [-923.467] (-922.495) (-923.196) * (-924.788) (-922.737) (-923.014) [-924.111] -- 0:00:52
103500 -- [-926.681] (-925.538) (-923.658) (-925.943) * (-924.416) (-928.108) [-923.191] (-926.528) -- 0:00:51
104000 -- (-922.823) (-925.924) (-924.075) [-923.961] * (-923.008) (-923.056) (-923.438) [-923.549] -- 0:00:51
104500 -- (-924.428) (-926.067) [-925.487] (-924.221) * (-923.643) (-926.578) (-924.456) [-921.877] -- 0:00:51
105000 -- (-925.134) (-928.486) [-927.126] (-923.985) * (-926.151) [-922.747] (-926.513) (-923.780) -- 0:00:51
Average standard deviation of split frequencies: 0.023406
105500 -- (-928.866) (-928.483) (-924.201) [-923.257] * [-925.578] (-922.557) (-927.618) (-922.628) -- 0:00:50
106000 -- (-926.002) (-928.994) (-929.158) [-926.115] * (-922.911) (-926.425) (-927.082) [-923.873] -- 0:00:50
106500 -- [-923.704] (-928.388) (-924.059) (-928.421) * (-923.438) (-927.190) [-926.808] (-923.036) -- 0:00:50
107000 -- (-924.148) [-923.323] (-925.014) (-933.660) * [-923.382] (-923.191) (-925.015) (-923.124) -- 0:00:50
107500 -- [-923.029] (-924.034) (-923.711) (-930.272) * (-925.656) (-925.955) (-923.998) [-925.441] -- 0:00:49
108000 -- (-923.310) [-923.055] (-925.206) (-923.315) * [-927.808] (-925.407) (-925.220) (-926.127) -- 0:00:49
108500 -- (-922.987) (-922.434) (-929.983) [-922.467] * (-926.442) (-924.791) [-924.896] (-925.603) -- 0:00:49
109000 -- [-922.741] (-922.778) (-925.065) (-923.308) * (-924.307) (-927.859) (-925.088) [-922.310] -- 0:00:49
109500 -- (-923.989) (-922.211) (-924.802) [-922.075] * [-923.689] (-929.309) (-924.110) (-922.937) -- 0:00:56
110000 -- (-932.234) [-922.385] (-924.135) (-926.352) * (-922.140) [-927.595] (-925.732) (-922.547) -- 0:00:56
Average standard deviation of split frequencies: 0.024213
110500 -- (-927.040) (-925.473) [-922.445] (-925.485) * (-923.920) (-925.573) (-926.230) [-924.272] -- 0:00:56
111000 -- [-929.508] (-925.102) (-924.827) (-926.061) * (-923.631) (-924.426) (-927.786) [-922.298] -- 0:00:56
111500 -- (-925.945) [-922.983] (-925.291) (-931.211) * (-922.141) (-924.869) [-922.592] (-923.441) -- 0:00:55
112000 -- [-923.435] (-924.595) (-928.369) (-923.528) * (-922.005) (-924.499) [-924.654] (-923.270) -- 0:00:55
112500 -- (-922.975) (-924.101) (-924.312) [-922.089] * [-922.296] (-924.916) (-927.446) (-923.164) -- 0:00:55
113000 -- (-921.879) [-927.366] (-922.890) (-923.298) * [-923.187] (-923.533) (-925.399) (-925.258) -- 0:00:54
113500 -- (-924.404) [-924.967] (-922.375) (-926.664) * (-923.281) (-925.762) [-922.333] (-922.835) -- 0:00:54
114000 -- (-925.188) (-923.528) (-922.564) [-924.102] * (-928.378) (-926.909) [-922.421] (-922.684) -- 0:00:54
114500 -- (-922.781) [-921.996] (-923.733) (-927.355) * [-926.346] (-925.648) (-925.735) (-926.153) -- 0:00:54
115000 -- [-926.685] (-926.684) (-924.412) (-924.817) * (-924.453) (-922.787) (-924.842) [-923.683] -- 0:00:53
Average standard deviation of split frequencies: 0.022803
115500 -- (-929.365) (-922.514) (-928.388) [-925.263] * [-925.422] (-924.337) (-928.292) (-933.614) -- 0:00:53
116000 -- (-924.812) (-923.092) (-925.977) [-924.082] * [-925.073] (-926.823) (-923.610) (-922.533) -- 0:00:53
116500 -- [-922.999] (-923.580) (-923.379) (-922.589) * (-926.359) [-924.643] (-924.170) (-923.418) -- 0:00:53
117000 -- (-923.537) [-923.406] (-924.140) (-922.962) * (-924.837) [-922.871] (-921.882) (-925.239) -- 0:00:52
117500 -- (-925.755) [-922.239] (-923.006) (-922.300) * (-924.441) (-924.847) (-922.772) [-922.731] -- 0:00:52
118000 -- [-925.581] (-924.306) (-925.248) (-923.079) * (-922.032) (-925.270) [-924.932] (-922.832) -- 0:00:52
118500 -- [-922.312] (-923.873) (-924.774) (-922.107) * (-922.874) (-925.656) [-922.171] (-923.534) -- 0:00:52
119000 -- (-923.318) (-924.056) [-922.777] (-925.136) * (-924.353) (-925.750) (-922.290) [-924.254] -- 0:00:51
119500 -- (-924.028) (-924.278) [-923.271] (-923.230) * (-924.544) (-923.310) (-924.146) [-923.964] -- 0:00:51
120000 -- (-922.993) [-923.940] (-922.520) (-922.875) * (-923.850) (-923.233) (-929.097) [-922.697] -- 0:00:51
Average standard deviation of split frequencies: 0.023874
120500 -- (-921.971) (-924.330) (-924.336) [-924.898] * (-925.716) (-924.215) (-923.805) [-922.740] -- 0:00:51
121000 -- (-922.115) (-924.374) [-924.055] (-922.675) * (-927.214) (-923.936) [-923.390] (-928.599) -- 0:00:50
121500 -- (-925.729) [-926.722] (-925.177) (-922.604) * (-926.703) (-924.792) [-922.954] (-924.782) -- 0:00:50
122000 -- (-926.361) (-925.471) (-921.984) [-923.545] * (-923.513) [-924.349] (-924.337) (-924.326) -- 0:00:50
122500 -- (-927.625) (-922.866) [-922.210] (-922.631) * (-923.781) (-924.861) (-925.227) [-923.190] -- 0:00:57
123000 -- (-923.676) [-922.609] (-925.161) (-923.401) * (-931.006) (-924.703) [-923.985] (-925.651) -- 0:00:57
123500 -- [-924.646] (-923.851) (-924.242) (-926.687) * (-927.541) (-923.214) [-924.864] (-924.391) -- 0:00:56
124000 -- (-927.280) (-922.247) [-923.842] (-925.220) * (-924.810) (-929.329) [-923.957] (-926.732) -- 0:00:56
124500 -- (-922.761) (-923.119) [-922.872] (-926.099) * (-924.328) (-922.096) (-923.912) [-925.154] -- 0:00:56
125000 -- (-922.955) (-923.747) (-927.165) [-924.365] * (-926.589) (-923.408) [-922.766] (-923.930) -- 0:00:56
Average standard deviation of split frequencies: 0.024506
125500 -- [-923.708] (-923.023) (-922.108) (-922.007) * [-928.091] (-923.452) (-922.638) (-924.524) -- 0:00:55
126000 -- (-923.527) [-923.617] (-925.641) (-923.952) * (-926.384) (-923.466) [-923.194] (-924.578) -- 0:00:55
126500 -- (-922.676) (-921.735) [-923.970] (-922.357) * (-924.473) (-923.923) [-924.181] (-923.215) -- 0:00:55
127000 -- (-926.917) [-922.572] (-925.723) (-922.436) * (-924.780) [-923.732] (-924.327) (-922.676) -- 0:00:54
127500 -- (-922.944) [-925.927] (-924.691) (-922.801) * (-926.716) (-924.464) (-923.704) [-924.864] -- 0:00:54
128000 -- (-924.097) [-925.917] (-926.321) (-923.376) * [-924.000] (-922.258) (-923.605) (-926.362) -- 0:00:54
128500 -- [-922.865] (-922.672) (-925.047) (-922.655) * (-922.836) (-924.296) (-923.424) [-924.173] -- 0:00:54
129000 -- (-924.018) (-923.943) [-923.600] (-923.963) * (-923.526) (-924.730) [-922.557] (-926.086) -- 0:00:54
129500 -- [-922.512] (-929.203) (-923.716) (-924.788) * [-924.847] (-922.833) (-922.979) (-923.939) -- 0:00:53
130000 -- (-925.551) [-926.100] (-924.508) (-924.090) * (-923.083) (-923.276) [-923.668] (-925.183) -- 0:00:53
Average standard deviation of split frequencies: 0.021285
130500 -- (-926.505) (-924.729) (-925.997) [-924.015] * (-926.960) (-923.529) [-923.682] (-926.006) -- 0:00:53
131000 -- (-926.238) (-927.781) (-923.642) [-922.630] * (-930.626) [-924.894] (-923.817) (-924.564) -- 0:00:53
131500 -- (-926.687) (-923.361) (-924.531) [-922.356] * (-925.547) (-924.815) (-922.992) [-926.425] -- 0:00:52
132000 -- [-923.018] (-924.183) (-925.746) (-923.369) * [-922.350] (-923.437) (-924.520) (-925.145) -- 0:00:52
132500 -- (-922.961) (-924.311) (-924.039) [-922.356] * (-923.796) (-923.724) [-922.672] (-921.968) -- 0:00:52
133000 -- (-923.898) (-925.212) (-923.229) [-922.361] * (-924.407) (-923.607) [-922.851] (-923.393) -- 0:00:52
133500 -- (-928.426) [-923.480] (-924.377) (-927.036) * (-924.783) [-923.179] (-925.235) (-924.792) -- 0:00:51
134000 -- [-924.835] (-923.521) (-925.186) (-922.665) * [-924.014] (-929.409) (-924.985) (-922.389) -- 0:00:51
134500 -- (-924.609) (-922.432) [-924.088] (-923.779) * [-927.295] (-924.261) (-924.784) (-923.262) -- 0:00:51
135000 -- (-924.440) (-926.520) [-925.575] (-923.323) * (-927.187) (-922.043) (-925.497) [-927.857] -- 0:00:57
Average standard deviation of split frequencies: 0.023716
135500 -- (-925.069) (-924.841) (-925.595) [-922.477] * (-923.214) (-923.729) (-922.645) [-922.058] -- 0:00:57
136000 -- (-925.868) (-925.266) [-923.967] (-923.252) * (-924.089) [-923.714] (-922.648) (-922.270) -- 0:00:57
136500 -- (-923.031) [-923.914] (-925.033) (-923.198) * [-924.132] (-922.553) (-926.610) (-924.913) -- 0:00:56
137000 -- (-922.831) [-925.031] (-924.809) (-927.959) * (-927.471) (-923.452) (-923.785) [-923.027] -- 0:00:56
137500 -- (-924.053) [-923.561] (-923.207) (-924.254) * (-932.126) (-922.261) (-923.563) [-925.357] -- 0:00:56
138000 -- (-924.755) (-924.888) (-922.469) [-933.390] * (-924.112) (-924.017) [-924.661] (-926.001) -- 0:00:56
138500 -- (-923.278) (-926.216) (-923.790) [-922.665] * [-922.715] (-924.961) (-922.640) (-924.185) -- 0:00:55
139000 -- (-923.278) (-926.008) [-922.763] (-924.956) * [-922.708] (-924.298) (-924.160) (-925.625) -- 0:00:55
139500 -- (-922.869) (-927.428) (-922.779) [-929.030] * (-923.035) (-923.883) (-923.581) [-922.794] -- 0:00:55
140000 -- (-928.361) [-927.206] (-923.167) (-924.076) * (-922.248) (-921.863) [-924.520] (-930.050) -- 0:00:55
Average standard deviation of split frequencies: 0.023988
140500 -- (-928.421) [-928.841] (-923.487) (-922.272) * (-924.225) (-922.651) [-922.883] (-927.683) -- 0:00:55
141000 -- [-924.222] (-931.586) (-922.837) (-923.199) * (-931.994) [-924.590] (-921.892) (-928.044) -- 0:00:54
141500 -- [-923.240] (-925.906) (-922.992) (-923.779) * (-926.300) [-923.011] (-923.635) (-925.346) -- 0:00:54
142000 -- [-923.262] (-923.767) (-923.801) (-923.833) * (-925.003) (-923.544) (-922.855) [-924.652] -- 0:00:54
142500 -- (-932.542) (-923.415) (-923.003) [-924.163] * (-924.320) (-926.286) [-923.501] (-923.494) -- 0:00:54
143000 -- (-928.326) [-923.948] (-926.484) (-923.413) * (-924.274) [-925.945] (-924.148) (-924.164) -- 0:00:53
143500 -- (-926.537) (-924.010) (-924.156) [-924.695] * [-923.269] (-923.675) (-924.118) (-924.261) -- 0:00:53
144000 -- (-924.314) (-924.148) [-925.451] (-924.508) * (-922.948) (-925.674) (-924.353) [-921.915] -- 0:00:53
144500 -- [-922.378] (-924.232) (-925.131) (-923.638) * (-923.634) [-924.548] (-924.201) (-922.841) -- 0:00:53
145000 -- (-924.339) (-923.961) (-926.145) [-925.365] * (-925.471) (-923.045) [-923.148] (-925.604) -- 0:00:53
Average standard deviation of split frequencies: 0.023281
145500 -- (-924.615) [-924.661] (-924.175) (-924.533) * (-924.917) (-924.787) [-922.812] (-924.267) -- 0:00:52
146000 -- (-924.889) (-923.970) (-924.033) [-924.061] * [-924.351] (-927.517) (-924.180) (-922.239) -- 0:00:52
146500 -- (-923.817) (-927.060) [-924.514] (-923.416) * (-922.808) [-926.252] (-925.620) (-923.081) -- 0:00:52
147000 -- (-923.553) [-926.117] (-925.961) (-922.862) * (-923.773) [-924.000] (-924.116) (-923.758) -- 0:00:52
147500 -- [-922.445] (-922.800) (-922.878) (-922.840) * (-923.972) [-924.765] (-923.381) (-924.899) -- 0:00:57
148000 -- (-922.443) (-922.289) [-924.469] (-923.216) * (-922.977) (-928.179) [-927.857] (-927.499) -- 0:00:57
148500 -- [-923.016] (-928.783) (-926.494) (-922.521) * (-923.405) (-922.419) [-923.958] (-922.435) -- 0:00:57
149000 -- [-925.558] (-925.910) (-924.556) (-925.254) * (-922.141) [-922.415] (-923.820) (-926.098) -- 0:00:57
149500 -- [-924.532] (-928.180) (-923.472) (-924.779) * (-922.037) (-926.518) (-925.752) [-927.900] -- 0:00:56
150000 -- (-924.091) [-926.633] (-925.832) (-925.989) * (-924.524) [-926.846] (-923.537) (-928.667) -- 0:00:56
Average standard deviation of split frequencies: 0.021737
150500 -- (-923.854) (-926.819) [-925.588] (-924.282) * (-922.742) (-925.908) [-922.537] (-925.412) -- 0:00:56
151000 -- (-922.502) [-926.181] (-925.795) (-926.680) * (-926.648) (-923.928) [-922.903] (-922.967) -- 0:00:56
151500 -- [-925.978] (-928.393) (-924.906) (-925.602) * (-926.531) [-926.797] (-926.614) (-926.160) -- 0:00:56
152000 -- (-926.294) (-925.993) [-931.083] (-923.583) * (-926.624) [-923.225] (-923.454) (-923.050) -- 0:00:55
152500 -- [-922.672] (-922.358) (-929.867) (-924.821) * (-922.598) (-929.192) (-925.094) [-923.239] -- 0:00:55
153000 -- (-923.513) (-925.725) [-931.617] (-923.864) * [-924.324] (-927.436) (-926.569) (-923.735) -- 0:00:55
153500 -- (-925.872) [-924.379] (-931.756) (-923.869) * (-925.681) [-926.776] (-927.049) (-925.498) -- 0:00:55
154000 -- [-924.532] (-922.948) (-926.943) (-924.103) * (-926.474) (-924.142) (-922.431) [-924.666] -- 0:00:54
154500 -- (-925.657) (-922.011) [-925.218] (-924.229) * (-926.371) [-924.083] (-924.253) (-923.156) -- 0:00:54
155000 -- (-924.951) (-923.933) [-925.271] (-924.533) * (-924.124) [-926.409] (-923.907) (-926.743) -- 0:00:54
Average standard deviation of split frequencies: 0.021630
155500 -- [-924.782] (-923.198) (-924.680) (-924.136) * (-922.806) (-922.638) [-925.839] (-926.086) -- 0:00:54
156000 -- (-923.830) [-922.355] (-929.188) (-923.715) * (-923.454) (-921.989) (-925.082) [-924.553] -- 0:00:54
156500 -- (-925.173) (-924.293) [-925.398] (-923.535) * (-923.693) [-922.543] (-923.860) (-924.273) -- 0:00:53
157000 -- [-925.026] (-921.757) (-925.037) (-923.584) * (-923.833) (-924.440) [-922.618] (-923.901) -- 0:00:53
157500 -- (-923.958) (-922.330) (-925.283) [-923.120] * (-922.867) [-926.566] (-929.170) (-922.945) -- 0:00:53
158000 -- (-922.755) [-922.415] (-923.347) (-923.012) * (-922.929) [-922.346] (-927.826) (-922.858) -- 0:00:53
158500 -- [-922.434] (-926.464) (-924.172) (-923.422) * (-922.482) [-922.905] (-922.688) (-923.964) -- 0:00:53
159000 -- [-922.112] (-924.230) (-922.393) (-925.168) * [-924.382] (-922.973) (-923.744) (-924.215) -- 0:00:52
159500 -- (-923.286) (-923.983) [-924.294] (-925.474) * (-925.986) (-923.102) (-923.447) [-923.576] -- 0:00:52
160000 -- (-925.713) (-923.347) (-923.733) [-923.501] * (-924.826) (-922.215) [-925.213] (-925.490) -- 0:00:57
Average standard deviation of split frequencies: 0.019723
160500 -- [-922.093] (-925.963) (-922.445) (-925.452) * (-924.795) [-924.093] (-927.392) (-922.889) -- 0:00:57
161000 -- [-926.365] (-928.688) (-924.947) (-923.744) * (-930.295) [-925.852] (-923.523) (-922.414) -- 0:00:57
161500 -- (-924.190) (-924.371) [-928.778] (-924.824) * (-929.032) (-926.214) [-924.279] (-926.505) -- 0:00:57
162000 -- [-923.800] (-923.190) (-923.660) (-927.327) * (-924.047) (-925.163) [-923.478] (-923.532) -- 0:00:56
162500 -- [-923.640] (-928.033) (-922.915) (-924.807) * (-924.101) (-924.353) (-922.608) [-923.288] -- 0:00:56
163000 -- (-923.751) [-923.617] (-923.899) (-925.318) * (-925.446) (-923.850) (-924.777) [-923.169] -- 0:00:56
163500 -- (-923.977) [-924.364] (-922.839) (-925.450) * (-926.233) [-922.850] (-926.056) (-922.746) -- 0:00:56
164000 -- (-924.024) [-926.432] (-923.661) (-923.324) * (-922.113) (-922.759) (-923.231) [-924.147] -- 0:00:56
164500 -- (-922.300) (-927.177) (-922.901) [-922.064] * (-922.092) [-922.667] (-925.453) (-926.537) -- 0:00:55
165000 -- [-922.674] (-925.890) (-924.976) (-923.306) * [-922.714] (-924.159) (-923.878) (-930.254) -- 0:00:55
Average standard deviation of split frequencies: 0.019721
165500 -- (-922.746) (-924.254) [-924.105] (-924.603) * [-923.509] (-930.757) (-924.246) (-925.446) -- 0:00:55
166000 -- (-922.471) (-924.233) [-926.972] (-924.056) * (-923.651) [-923.300] (-923.925) (-928.443) -- 0:00:55
166500 -- [-922.068] (-924.545) (-928.652) (-927.033) * (-922.333) (-922.959) (-924.703) [-925.690] -- 0:00:55
167000 -- (-922.971) [-923.655] (-924.890) (-925.749) * (-922.718) (-923.337) [-927.241] (-925.765) -- 0:00:54
167500 -- [-923.746] (-926.418) (-923.897) (-924.874) * [-923.012] (-923.550) (-922.484) (-922.732) -- 0:00:54
168000 -- (-922.904) (-927.191) [-924.230] (-923.296) * [-923.808] (-923.735) (-922.394) (-923.561) -- 0:00:54
168500 -- [-922.594] (-923.077) (-924.964) (-923.659) * (-924.245) (-924.587) (-929.343) [-922.243] -- 0:00:54
169000 -- (-923.066) (-923.210) [-924.676] (-924.260) * (-924.853) [-924.790] (-927.362) (-922.122) -- 0:00:54
169500 -- (-928.369) (-922.733) (-927.177) [-922.486] * [-923.519] (-923.549) (-925.753) (-924.035) -- 0:00:53
170000 -- (-924.534) [-924.632] (-925.704) (-925.323) * (-923.291) (-927.268) [-922.660] (-923.523) -- 0:00:53
Average standard deviation of split frequencies: 0.017494
170500 -- (-924.701) (-923.080) (-925.210) [-923.675] * (-922.641) [-923.414] (-923.856) (-926.529) -- 0:00:53
171000 -- (-923.414) [-927.335] (-927.754) (-924.219) * [-923.894] (-928.022) (-923.130) (-926.140) -- 0:00:53
171500 -- (-923.451) (-926.295) (-925.004) [-924.040] * [-923.907] (-925.072) (-923.396) (-923.448) -- 0:00:53
172000 -- (-923.798) (-922.420) [-924.322] (-923.647) * [-925.067] (-923.825) (-923.815) (-924.510) -- 0:00:52
172500 -- (-923.532) [-923.262] (-924.817) (-924.005) * (-924.150) (-924.072) (-925.663) [-925.752] -- 0:00:57
173000 -- (-923.107) (-924.142) [-924.363] (-923.750) * [-923.467] (-928.586) (-927.314) (-922.820) -- 0:00:57
173500 -- [-923.143] (-924.387) (-924.566) (-922.254) * (-925.030) [-927.063] (-923.467) (-923.929) -- 0:00:57
174000 -- (-922.902) (-924.309) (-926.662) [-922.613] * (-923.896) (-926.838) (-923.696) [-923.676] -- 0:00:56
174500 -- (-922.959) [-922.932] (-924.666) (-923.266) * [-922.799] (-923.155) (-923.933) (-926.174) -- 0:00:56
175000 -- (-925.658) (-925.025) (-925.579) [-925.104] * [-924.960] (-924.161) (-924.200) (-926.206) -- 0:00:56
Average standard deviation of split frequencies: 0.016205
175500 -- (-922.592) (-925.023) [-923.750] (-924.602) * (-922.719) [-923.394] (-923.653) (-927.245) -- 0:00:56
176000 -- [-925.676] (-924.686) (-923.140) (-925.881) * (-924.464) (-923.320) [-925.881] (-926.139) -- 0:00:56
176500 -- [-922.120] (-926.697) (-925.227) (-927.996) * (-928.569) (-923.082) [-923.110] (-925.961) -- 0:00:55
177000 -- (-924.370) (-922.989) (-925.188) [-924.923] * (-925.574) (-924.339) (-925.441) [-924.983] -- 0:00:55
177500 -- (-929.277) (-923.986) (-929.517) [-924.147] * (-924.665) (-923.396) (-925.981) [-923.554] -- 0:00:55
178000 -- (-925.870) (-923.168) (-922.779) [-923.960] * [-924.028] (-923.330) (-925.400) (-922.456) -- 0:00:55
178500 -- (-923.643) [-923.466] (-925.037) (-927.847) * (-924.494) [-925.861] (-925.030) (-925.970) -- 0:00:55
179000 -- (-925.676) (-921.850) (-923.067) [-927.074] * (-922.426) (-922.570) [-924.744] (-926.970) -- 0:00:55
179500 -- [-927.763] (-923.405) (-923.759) (-927.836) * (-922.284) (-922.680) [-926.781] (-924.097) -- 0:00:54
180000 -- [-925.412] (-924.234) (-927.493) (-924.196) * (-927.256) (-923.080) (-926.209) [-925.468] -- 0:00:54
Average standard deviation of split frequencies: 0.016569
180500 -- [-923.319] (-924.163) (-926.851) (-922.101) * (-925.157) (-927.030) [-929.776] (-927.002) -- 0:00:54
181000 -- (-922.618) [-923.474] (-925.668) (-922.345) * [-927.979] (-922.976) (-930.857) (-927.999) -- 0:00:54
181500 -- [-923.585] (-924.175) (-924.250) (-922.529) * (-923.031) [-924.857] (-927.621) (-929.726) -- 0:00:54
182000 -- [-922.422] (-925.262) (-926.946) (-923.234) * (-924.206) (-924.117) (-926.982) [-923.527] -- 0:00:53
182500 -- (-922.422) [-922.707] (-922.457) (-922.428) * (-924.569) (-924.870) (-922.782) [-922.400] -- 0:00:53
183000 -- (-924.568) [-922.178] (-924.760) (-923.083) * (-923.257) (-922.330) (-923.021) [-922.469] -- 0:00:53
183500 -- [-922.141] (-924.200) (-928.914) (-924.598) * (-923.471) [-923.822] (-926.598) (-923.237) -- 0:00:53
184000 -- (-925.545) [-924.562] (-924.056) (-923.931) * (-923.018) (-923.968) (-928.827) [-926.286] -- 0:00:53
184500 -- (-928.020) (-924.238) (-922.549) [-922.733] * [-923.421] (-922.836) (-933.614) (-929.406) -- 0:00:53
185000 -- [-924.590] (-924.457) (-924.963) (-923.690) * (-923.386) (-922.469) [-922.842] (-926.767) -- 0:00:57
Average standard deviation of split frequencies: 0.016601
185500 -- (-926.326) (-925.148) [-926.477] (-924.809) * (-923.268) (-923.551) [-922.875] (-925.767) -- 0:00:57
186000 -- [-923.580] (-922.558) (-925.921) (-922.946) * (-928.842) (-923.428) (-926.661) [-926.342] -- 0:00:56
186500 -- (-924.025) (-922.080) [-924.304] (-922.742) * (-923.684) [-922.816] (-923.313) (-925.037) -- 0:00:56
187000 -- (-925.330) [-922.850] (-922.186) (-924.050) * (-925.899) (-922.791) (-922.878) [-922.307] -- 0:00:56
187500 -- [-924.356] (-926.159) (-923.407) (-924.382) * (-924.354) (-923.292) (-929.621) [-924.550] -- 0:00:56
188000 -- (-923.658) (-923.770) [-922.541] (-925.493) * (-924.540) [-924.554] (-924.325) (-926.026) -- 0:00:56
188500 -- (-924.049) (-924.454) [-922.953] (-926.112) * [-923.719] (-930.243) (-922.757) (-922.287) -- 0:00:55
189000 -- (-927.576) [-922.264] (-928.020) (-924.513) * (-927.535) (-924.918) [-922.837] (-924.515) -- 0:00:55
189500 -- (-926.653) (-924.157) [-928.125] (-925.960) * (-925.634) (-923.135) [-922.839] (-922.372) -- 0:00:55
190000 -- (-923.845) [-924.491] (-927.750) (-925.249) * (-928.060) [-923.183] (-923.178) (-925.840) -- 0:00:55
Average standard deviation of split frequencies: 0.014958
190500 -- (-925.165) (-926.727) (-926.699) [-923.903] * [-924.266] (-924.007) (-922.476) (-923.164) -- 0:00:55
191000 -- (-925.011) [-927.104] (-927.571) (-923.085) * [-924.394] (-924.677) (-924.856) (-924.231) -- 0:00:55
191500 -- (-922.162) [-926.999] (-923.644) (-922.867) * (-924.664) (-924.077) [-924.838] (-925.776) -- 0:00:54
192000 -- (-925.497) [-924.841] (-926.100) (-923.254) * [-923.421] (-923.518) (-924.996) (-926.171) -- 0:00:54
192500 -- (-922.272) (-923.335) (-928.981) [-924.166] * (-923.441) (-925.772) (-926.370) [-922.538] -- 0:00:54
193000 -- (-922.096) [-924.392] (-923.963) (-924.941) * (-925.845) (-928.690) [-930.349] (-922.416) -- 0:00:54
193500 -- (-926.266) (-924.058) (-926.081) [-923.206] * (-923.190) (-926.192) (-924.801) [-923.856] -- 0:00:54
194000 -- (-923.480) (-927.858) (-923.451) [-924.319] * (-922.681) (-926.106) [-925.652] (-923.532) -- 0:00:54
194500 -- (-922.394) (-926.920) [-922.873] (-923.319) * (-923.581) [-925.062] (-925.908) (-922.892) -- 0:00:53
195000 -- (-927.412) [-923.211] (-922.966) (-923.494) * [-924.474] (-927.785) (-925.403) (-922.810) -- 0:00:53
Average standard deviation of split frequencies: 0.014178
195500 -- (-929.131) (-926.798) [-923.495] (-923.548) * (-924.146) (-925.582) (-924.405) [-924.342] -- 0:00:53
196000 -- (-922.649) (-924.792) [-922.264] (-922.929) * (-924.699) (-925.329) (-924.226) [-924.935] -- 0:00:53
196500 -- (-923.141) [-924.769] (-923.253) (-922.321) * [-924.850] (-924.998) (-925.258) (-924.445) -- 0:00:53
197000 -- (-922.689) (-922.939) [-924.930] (-927.947) * [-925.445] (-925.224) (-923.187) (-926.319) -- 0:00:57
197500 -- (-925.652) [-924.782] (-927.976) (-924.594) * [-924.894] (-925.338) (-925.187) (-924.494) -- 0:00:56
198000 -- [-925.927] (-926.108) (-926.822) (-924.922) * (-926.456) (-924.093) [-924.613] (-923.241) -- 0:00:56
198500 -- (-923.233) [-924.624] (-927.658) (-924.329) * (-924.623) (-925.065) [-923.885] (-925.312) -- 0:00:56
199000 -- (-922.585) (-922.918) [-923.535] (-923.782) * (-924.911) (-925.959) (-924.939) [-923.435] -- 0:00:56
199500 -- (-925.685) (-923.192) [-922.685] (-924.742) * (-923.421) (-923.335) (-931.668) [-921.929] -- 0:00:56
200000 -- (-928.015) (-923.429) [-925.067] (-926.202) * (-924.127) (-922.476) [-924.609] (-927.878) -- 0:00:55
Average standard deviation of split frequencies: 0.014356
200500 -- (-929.494) [-924.326] (-923.043) (-926.803) * (-925.383) [-923.238] (-923.913) (-922.536) -- 0:00:55
201000 -- [-924.903] (-924.117) (-925.359) (-925.583) * (-923.513) (-924.615) (-924.853) [-922.231] -- 0:00:55
201500 -- (-927.680) [-925.806] (-925.778) (-925.697) * (-925.110) (-925.605) [-927.231] (-923.435) -- 0:00:55
202000 -- (-924.342) [-922.904] (-924.308) (-924.879) * (-922.844) [-925.728] (-928.714) (-922.711) -- 0:00:55
202500 -- (-923.406) [-922.994] (-927.403) (-925.421) * (-926.450) (-925.186) (-924.486) [-923.701] -- 0:00:55
203000 -- (-922.623) (-922.232) [-925.794] (-924.164) * (-924.132) (-928.103) (-925.628) [-922.672] -- 0:00:54
203500 -- [-923.033] (-923.787) (-922.995) (-924.490) * (-924.152) [-924.101] (-929.393) (-924.940) -- 0:00:54
204000 -- (-924.264) [-924.321] (-926.557) (-927.792) * (-925.950) [-922.977] (-929.783) (-923.811) -- 0:00:54
204500 -- (-924.780) [-926.375] (-931.184) (-924.550) * (-925.047) [-922.326] (-925.058) (-922.183) -- 0:00:54
205000 -- (-924.482) (-925.400) (-928.226) [-924.442] * (-925.766) [-923.348] (-923.633) (-926.271) -- 0:00:54
Average standard deviation of split frequencies: 0.014620
205500 -- (-922.387) (-925.642) (-923.364) [-923.099] * [-923.860] (-922.761) (-925.956) (-924.312) -- 0:00:54
206000 -- (-923.386) (-923.706) [-923.405] (-931.558) * (-925.027) (-922.959) [-928.341] (-924.122) -- 0:00:53
206500 -- (-927.110) (-923.024) [-923.568] (-926.283) * (-923.656) (-924.508) (-922.925) [-927.184] -- 0:00:53
207000 -- (-923.967) (-922.360) (-922.760) [-923.244] * (-922.961) [-924.130] (-928.738) (-927.649) -- 0:00:53
207500 -- (-924.678) (-925.711) (-922.192) [-925.880] * (-924.041) (-926.385) [-927.674] (-923.498) -- 0:00:53
208000 -- (-925.501) [-922.907] (-922.574) (-927.810) * (-921.950) (-923.709) [-923.658] (-924.937) -- 0:00:53
208500 -- (-923.654) (-927.777) (-928.689) [-926.092] * (-923.704) [-922.549] (-926.629) (-927.175) -- 0:00:53
209000 -- [-923.425] (-923.491) (-924.251) (-926.593) * [-925.014] (-922.183) (-921.695) (-922.996) -- 0:00:52
209500 -- [-923.449] (-924.232) (-926.967) (-926.891) * (-925.253) [-922.570] (-922.717) (-922.693) -- 0:00:52
210000 -- (-926.186) [-926.772] (-926.021) (-925.374) * (-924.730) [-924.521] (-923.739) (-923.225) -- 0:00:56
Average standard deviation of split frequencies: 0.014048
210500 -- (-931.603) (-928.752) (-924.779) [-927.355] * (-923.543) [-926.878] (-925.035) (-922.839) -- 0:00:56
211000 -- (-923.738) (-924.613) (-930.086) [-926.495] * (-925.300) (-922.540) (-924.416) [-923.707] -- 0:00:56
211500 -- (-924.340) (-928.050) [-922.698] (-926.493) * (-923.919) [-922.059] (-925.927) (-923.009) -- 0:00:55
212000 -- [-923.038] (-924.323) (-923.640) (-927.576) * (-922.617) (-922.059) (-925.565) [-922.727] -- 0:00:55
212500 -- [-923.735] (-929.605) (-924.990) (-924.113) * (-924.568) [-924.756] (-927.920) (-926.900) -- 0:00:55
213000 -- (-928.835) (-925.253) (-923.041) [-924.254] * (-921.880) [-925.650] (-925.922) (-926.439) -- 0:00:55
213500 -- (-923.636) (-922.951) (-924.593) [-922.665] * (-922.303) [-923.946] (-924.395) (-923.706) -- 0:00:55
214000 -- [-923.683] (-923.164) (-923.201) (-925.154) * (-922.810) (-925.145) [-922.820] (-925.695) -- 0:00:55
214500 -- (-924.330) (-923.122) [-926.576] (-926.853) * [-922.810] (-925.887) (-927.521) (-926.702) -- 0:00:54
215000 -- [-922.276] (-923.344) (-924.850) (-925.227) * (-922.259) [-924.092] (-924.025) (-923.903) -- 0:00:54
Average standard deviation of split frequencies: 0.013439
215500 -- (-926.179) (-929.406) [-925.244] (-923.322) * [-924.029] (-922.535) (-925.120) (-922.688) -- 0:00:54
216000 -- [-923.311] (-924.354) (-925.984) (-923.914) * (-922.911) (-927.030) [-924.195] (-922.812) -- 0:00:54
216500 -- (-925.601) (-931.330) (-924.592) [-924.966] * (-925.020) (-923.639) (-924.255) [-923.328] -- 0:00:54
217000 -- (-926.803) (-925.114) (-924.322) [-923.069] * [-923.439] (-925.212) (-922.607) (-924.517) -- 0:00:54
217500 -- (-923.594) (-924.740) [-922.673] (-922.857) * (-927.563) (-925.252) (-922.034) [-923.840] -- 0:00:53
218000 -- [-922.254] (-928.023) (-922.861) (-922.906) * (-927.982) [-924.107] (-923.370) (-924.192) -- 0:00:53
218500 -- (-923.282) [-923.199] (-924.302) (-922.552) * (-922.440) [-924.333] (-925.458) (-930.028) -- 0:00:53
219000 -- (-921.753) (-922.790) [-924.875] (-923.337) * (-924.296) (-924.218) [-925.553] (-926.701) -- 0:00:53
219500 -- (-923.136) [-923.615] (-926.997) (-921.889) * (-923.935) [-924.213] (-925.534) (-923.507) -- 0:00:53
220000 -- (-926.382) [-925.102] (-924.523) (-922.952) * (-923.297) [-922.625] (-923.218) (-924.202) -- 0:00:53
Average standard deviation of split frequencies: 0.012462
220500 -- (-924.125) [-924.288] (-924.041) (-922.603) * (-927.135) [-926.750] (-925.990) (-922.724) -- 0:00:53
221000 -- (-924.348) (-924.122) [-922.430] (-924.175) * (-926.316) [-925.335] (-925.002) (-926.261) -- 0:00:52
221500 -- [-926.101] (-924.534) (-924.440) (-922.646) * [-925.527] (-923.778) (-924.048) (-925.700) -- 0:00:52
222000 -- [-923.231] (-923.504) (-922.763) (-922.535) * [-923.681] (-925.161) (-924.743) (-925.264) -- 0:00:52
222500 -- (-923.232) [-922.363] (-927.629) (-924.508) * (-926.645) [-922.998] (-924.400) (-923.212) -- 0:00:52
223000 -- [-928.872] (-925.227) (-927.989) (-926.407) * (-923.362) [-922.140] (-924.304) (-922.495) -- 0:00:52
223500 -- (-922.558) (-923.445) [-923.349] (-926.357) * (-925.148) (-925.716) [-924.511] (-923.786) -- 0:00:52
224000 -- (-924.676) [-921.890] (-924.890) (-923.846) * (-930.375) (-927.922) [-924.434] (-924.847) -- 0:00:51
224500 -- [-924.340] (-923.273) (-925.471) (-923.381) * (-924.768) (-931.386) (-923.811) [-924.027] -- 0:00:51
225000 -- (-925.144) [-921.877] (-925.306) (-923.044) * [-923.508] (-924.061) (-925.268) (-927.062) -- 0:00:51
Average standard deviation of split frequencies: 0.012619
225500 -- [-923.024] (-925.076) (-923.138) (-924.353) * (-922.617) (-922.248) (-923.968) [-923.312] -- 0:00:51
226000 -- (-922.145) (-927.349) (-922.504) [-923.745] * [-923.537] (-922.295) (-928.510) (-923.994) -- 0:00:54
226500 -- (-927.336) (-923.958) [-924.998] (-923.621) * [-925.472] (-922.626) (-924.340) (-925.538) -- 0:00:54
227000 -- (-923.454) (-924.261) (-923.555) [-922.091] * (-922.452) (-925.166) [-923.586] (-923.887) -- 0:00:54
227500 -- (-924.035) (-923.771) [-921.991] (-923.002) * (-923.814) (-925.454) (-929.718) [-924.117] -- 0:00:54
228000 -- (-923.505) (-925.098) (-922.622) [-922.282] * [-924.242] (-925.720) (-924.251) (-923.584) -- 0:00:54
228500 -- (-925.717) [-923.583] (-922.938) (-924.552) * (-922.551) (-924.361) (-925.220) [-924.314] -- 0:00:54
229000 -- (-923.371) (-923.749) [-922.690] (-926.562) * [-923.194] (-931.315) (-925.100) (-923.310) -- 0:00:53
229500 -- (-925.352) (-922.955) [-922.973] (-925.116) * (-922.666) (-928.336) [-923.905] (-927.185) -- 0:00:53
230000 -- (-925.195) [-923.898] (-925.530) (-924.814) * (-922.000) (-931.095) (-923.789) [-924.040] -- 0:00:53
Average standard deviation of split frequencies: 0.013182
230500 -- (-924.084) (-926.163) (-922.048) [-924.679] * (-922.447) (-931.254) [-927.627] (-925.210) -- 0:00:53
231000 -- (-924.629) (-924.121) (-924.599) [-922.822] * [-922.156] (-924.616) (-924.776) (-924.922) -- 0:00:53
231500 -- (-923.083) (-923.187) [-924.151] (-924.785) * (-922.080) (-925.118) [-926.237] (-922.012) -- 0:00:53
232000 -- [-922.580] (-922.700) (-925.552) (-925.204) * (-925.401) (-924.929) [-927.654] (-925.126) -- 0:00:52
232500 -- [-925.454] (-924.328) (-922.783) (-923.749) * (-924.456) (-927.496) [-925.783] (-926.188) -- 0:00:52
233000 -- [-923.114] (-923.574) (-923.691) (-923.736) * [-921.775] (-922.873) (-923.113) (-923.883) -- 0:00:52
233500 -- (-922.343) [-923.376] (-924.899) (-924.356) * (-922.751) (-924.611) [-923.931] (-923.352) -- 0:00:52
234000 -- [-927.394] (-923.946) (-924.120) (-924.768) * [-923.217] (-923.784) (-923.428) (-925.364) -- 0:00:52
234500 -- (-926.409) [-923.948] (-923.411) (-926.503) * (-922.517) (-925.883) [-922.199] (-925.451) -- 0:00:52
235000 -- (-925.127) (-928.839) (-924.804) [-926.659] * [-922.108] (-927.595) (-922.686) (-926.864) -- 0:00:52
Average standard deviation of split frequencies: 0.012616
235500 -- (-925.427) (-927.752) [-926.966] (-922.823) * (-922.908) [-923.345] (-922.860) (-927.221) -- 0:00:51
236000 -- (-922.763) (-923.557) (-924.771) [-923.545] * (-923.038) (-922.215) (-922.117) [-922.493] -- 0:00:51
236500 -- [-922.729] (-926.233) (-924.370) (-925.091) * (-925.567) (-926.309) [-924.440] (-924.314) -- 0:00:51
237000 -- (-926.440) [-925.428] (-926.538) (-926.674) * [-922.685] (-923.346) (-929.934) (-924.950) -- 0:00:51
237500 -- (-925.222) (-924.412) (-922.876) [-925.877] * (-926.806) (-922.666) (-924.100) [-925.350] -- 0:00:51
238000 -- [-923.223] (-923.596) (-926.210) (-922.758) * (-927.171) (-923.422) [-924.260] (-925.601) -- 0:00:51
238500 -- (-925.999) [-926.435] (-923.479) (-923.824) * (-924.370) (-925.495) (-924.148) [-926.999] -- 0:00:51
239000 -- (-922.334) [-924.483] (-923.033) (-925.397) * (-922.645) [-923.847] (-925.825) (-922.816) -- 0:00:50
239500 -- (-922.474) (-923.982) [-921.983] (-924.548) * (-925.540) (-923.296) (-925.511) [-924.883] -- 0:00:50
240000 -- (-923.464) (-924.141) [-925.672] (-924.940) * (-927.118) [-924.781] (-923.599) (-921.860) -- 0:00:50
Average standard deviation of split frequencies: 0.011208
240500 -- (-923.641) (-924.904) (-926.078) [-922.740] * [-925.123] (-923.363) (-925.549) (-922.784) -- 0:00:50
241000 -- (-923.668) (-922.627) [-925.844] (-924.806) * (-922.085) (-922.418) [-925.263] (-922.460) -- 0:00:50
241500 -- [-922.385] (-923.944) (-926.150) (-923.652) * (-922.199) [-926.546] (-924.731) (-922.918) -- 0:00:50
242000 -- (-924.340) (-922.590) [-925.043] (-924.277) * (-926.648) (-923.729) (-925.267) [-923.436] -- 0:00:50
242500 -- (-925.463) [-924.687] (-924.583) (-923.846) * (-925.281) (-925.210) (-924.743) [-922.573] -- 0:00:49
243000 -- (-922.824) (-923.420) [-923.805] (-925.522) * (-926.145) [-923.706] (-928.326) (-922.706) -- 0:00:52
243500 -- (-927.263) (-923.553) (-923.836) [-923.027] * (-924.032) [-924.880] (-923.115) (-923.833) -- 0:00:52
244000 -- [-922.270] (-922.719) (-924.499) (-924.512) * (-924.249) (-922.907) (-922.350) [-923.396] -- 0:00:52
244500 -- (-925.368) [-925.250] (-926.418) (-926.730) * (-923.242) (-923.180) (-926.045) [-925.496] -- 0:00:52
245000 -- (-924.852) (-925.523) (-924.806) [-931.384] * [-923.230] (-925.268) (-923.403) (-925.535) -- 0:00:52
Average standard deviation of split frequencies: 0.010114
245500 -- (-924.634) [-924.228] (-923.375) (-922.571) * (-922.928) [-926.115] (-922.873) (-924.266) -- 0:00:52
246000 -- [-922.810] (-922.488) (-924.247) (-924.098) * (-924.003) (-925.141) (-923.156) [-922.284] -- 0:00:52
246500 -- (-923.807) (-923.623) [-927.203] (-924.756) * (-922.543) (-926.184) (-924.842) [-925.217] -- 0:00:51
247000 -- [-924.227] (-922.712) (-927.957) (-930.016) * [-923.976] (-928.019) (-923.596) (-922.556) -- 0:00:51
247500 -- (-925.157) [-922.888] (-925.699) (-926.516) * (-923.864) [-924.771] (-925.991) (-924.177) -- 0:00:51
248000 -- (-923.227) (-922.539) [-925.940] (-925.996) * (-926.292) (-922.481) (-924.964) [-922.013] -- 0:00:51
248500 -- (-922.918) [-921.968] (-927.431) (-927.288) * (-927.246) (-923.462) (-922.440) [-922.325] -- 0:00:51
249000 -- (-923.795) (-921.991) [-922.290] (-923.659) * (-924.670) (-923.593) (-922.749) [-922.389] -- 0:00:51
249500 -- (-922.722) (-923.518) (-924.219) [-923.151] * [-922.696] (-923.431) (-922.609) (-922.241) -- 0:00:51
250000 -- (-922.895) [-923.259] (-922.468) (-925.093) * (-924.715) (-925.027) [-928.312] (-925.753) -- 0:00:51
Average standard deviation of split frequencies: 0.011179
250500 -- [-923.599] (-922.639) (-923.082) (-926.439) * (-923.650) (-924.548) [-924.393] (-923.401) -- 0:00:50
251000 -- (-923.398) (-924.914) (-925.795) [-927.479] * (-924.265) (-925.742) [-923.268] (-922.075) -- 0:00:50
251500 -- (-923.978) [-924.484] (-923.191) (-925.773) * (-925.823) (-924.355) (-923.264) [-922.039] -- 0:00:50
252000 -- (-924.319) [-923.295] (-922.390) (-926.055) * [-922.643] (-926.602) (-923.437) (-922.856) -- 0:00:50
252500 -- (-924.679) (-922.298) [-923.788] (-925.186) * [-924.303] (-922.171) (-922.616) (-923.664) -- 0:00:50
253000 -- (-925.299) [-925.885] (-923.770) (-923.620) * (-923.003) (-926.820) [-924.059] (-923.786) -- 0:00:50
253500 -- (-922.374) (-924.882) [-924.522] (-923.077) * (-922.167) [-924.194] (-924.087) (-923.403) -- 0:00:50
254000 -- [-922.878] (-924.730) (-925.574) (-923.449) * (-922.676) (-922.763) [-923.557] (-924.249) -- 0:00:49
254500 -- (-923.233) [-924.827] (-923.345) (-923.290) * (-922.676) [-922.841] (-923.399) (-923.875) -- 0:00:49
255000 -- (-924.092) (-925.125) [-923.578] (-926.152) * (-925.128) (-923.977) (-923.035) [-924.545] -- 0:00:49
Average standard deviation of split frequencies: 0.010844
255500 -- [-924.443] (-924.330) (-923.492) (-927.246) * (-923.396) (-924.387) (-925.962) [-923.017] -- 0:00:49
256000 -- (-923.142) (-925.192) [-923.978] (-926.975) * [-924.270] (-924.064) (-925.721) (-922.798) -- 0:00:49
256500 -- (-925.052) [-922.859] (-925.688) (-925.727) * (-924.250) (-923.651) (-927.970) [-922.161] -- 0:00:49
257000 -- (-923.094) (-923.542) (-923.352) [-928.060] * [-922.272] (-925.774) (-927.202) (-922.986) -- 0:00:49
257500 -- [-925.227] (-923.791) (-923.509) (-923.453) * (-922.936) [-925.017] (-923.045) (-924.559) -- 0:00:49
258000 -- (-926.874) (-923.919) [-924.386] (-922.905) * (-923.121) [-925.184] (-923.054) (-923.355) -- 0:00:48
258500 -- [-926.088] (-923.977) (-923.773) (-922.977) * (-922.830) (-922.851) [-923.684] (-922.871) -- 0:00:48
259000 -- (-927.607) [-924.562] (-922.690) (-923.715) * (-922.294) [-924.939] (-922.747) (-925.010) -- 0:00:48
259500 -- [-924.729] (-923.876) (-926.185) (-922.807) * (-928.984) (-922.288) [-923.819] (-926.200) -- 0:00:51
260000 -- (-925.719) [-924.404] (-926.557) (-923.245) * (-924.522) [-922.942] (-924.178) (-928.548) -- 0:00:51
Average standard deviation of split frequencies: 0.010951
260500 -- (-923.350) (-924.536) [-927.198] (-925.412) * (-926.646) [-922.954] (-925.982) (-926.657) -- 0:00:51
261000 -- (-924.762) (-924.536) [-924.466] (-924.429) * (-924.546) (-922.834) (-924.409) [-925.100] -- 0:00:50
261500 -- (-924.032) [-923.405] (-925.927) (-925.735) * (-924.500) [-923.563] (-922.786) (-923.415) -- 0:00:50
262000 -- (-922.673) (-926.077) [-923.440] (-922.879) * (-925.544) (-922.483) [-923.598] (-925.584) -- 0:00:50
262500 -- (-925.278) [-922.470] (-922.006) (-923.704) * [-928.540] (-927.079) (-923.449) (-927.960) -- 0:00:50
263000 -- [-924.427] (-923.210) (-922.872) (-925.305) * (-927.015) (-923.914) (-922.869) [-923.237] -- 0:00:50
263500 -- [-922.100] (-924.020) (-923.128) (-927.560) * (-924.112) (-925.699) [-923.054] (-922.424) -- 0:00:50
264000 -- [-922.415] (-925.460) (-924.199) (-923.424) * [-922.275] (-924.570) (-923.573) (-924.624) -- 0:00:50
264500 -- [-926.041] (-924.897) (-924.938) (-927.127) * [-923.316] (-926.658) (-924.151) (-923.799) -- 0:00:50
265000 -- (-922.758) (-923.824) (-922.551) [-928.985] * (-928.586) (-930.022) [-925.556] (-925.680) -- 0:00:49
Average standard deviation of split frequencies: 0.010929
265500 -- [-923.674] (-925.058) (-922.507) (-922.807) * [-924.129] (-922.995) (-922.708) (-929.939) -- 0:00:49
266000 -- (-922.411) [-925.277] (-923.988) (-923.536) * [-926.532] (-923.087) (-924.543) (-926.189) -- 0:00:49
266500 -- (-925.417) (-922.475) [-924.452] (-923.755) * (-927.644) (-922.971) [-925.681] (-923.365) -- 0:00:49
267000 -- (-922.282) (-923.080) (-931.556) [-923.626] * (-926.191) [-922.799] (-924.254) (-925.095) -- 0:00:49
267500 -- (-923.261) [-923.502] (-926.085) (-926.471) * (-924.107) (-922.483) (-926.666) [-925.830] -- 0:00:49
268000 -- (-928.329) (-927.357) [-925.040] (-923.410) * [-922.278] (-922.504) (-924.534) (-925.533) -- 0:00:49
268500 -- (-923.383) (-924.746) (-924.084) [-924.206] * (-922.466) [-922.504] (-922.851) (-925.194) -- 0:00:49
269000 -- (-922.132) [-924.765] (-926.313) (-923.982) * (-926.144) (-925.589) [-924.326] (-928.872) -- 0:00:48
269500 -- (-922.877) [-928.293] (-929.370) (-925.729) * (-923.765) [-923.591] (-924.090) (-925.007) -- 0:00:48
270000 -- [-924.079] (-925.276) (-932.466) (-924.578) * (-924.192) (-923.832) [-923.540] (-924.260) -- 0:00:48
Average standard deviation of split frequencies: 0.011417
270500 -- (-923.385) (-924.125) [-926.306] (-924.782) * (-926.640) [-923.797] (-923.745) (-928.878) -- 0:00:48
271000 -- (-924.532) (-924.590) [-924.052] (-923.318) * (-923.583) [-922.858] (-926.600) (-923.956) -- 0:00:48
271500 -- (-923.112) (-923.646) (-931.335) [-924.776] * (-923.359) (-922.863) [-924.997] (-924.028) -- 0:00:48
272000 -- (-923.460) (-926.512) (-924.583) [-924.147] * (-924.751) [-923.197] (-924.791) (-924.525) -- 0:00:48
272500 -- (-924.444) [-930.752] (-924.392) (-924.807) * [-923.912] (-923.576) (-923.885) (-923.031) -- 0:00:48
273000 -- (-925.637) (-924.043) [-924.159] (-925.050) * (-928.298) [-922.870] (-923.590) (-924.373) -- 0:00:47
273500 -- (-927.541) (-922.997) [-924.389] (-922.938) * (-922.778) (-923.789) [-923.264] (-924.318) -- 0:00:47
274000 -- [-923.571] (-922.983) (-923.911) (-923.198) * (-924.979) [-924.595] (-924.020) (-924.054) -- 0:00:47
274500 -- [-922.908] (-923.325) (-927.578) (-922.459) * (-924.045) (-926.097) (-925.494) [-924.333] -- 0:00:47
275000 -- [-922.923] (-924.410) (-924.832) (-928.410) * (-922.178) (-923.342) (-922.887) [-923.239] -- 0:00:50
Average standard deviation of split frequencies: 0.010851
275500 -- (-925.673) [-924.088] (-925.083) (-923.308) * [-922.161] (-923.379) (-923.296) (-923.793) -- 0:00:49
276000 -- [-923.703] (-927.004) (-924.443) (-924.244) * (-924.676) [-924.849] (-923.902) (-925.512) -- 0:00:49
276500 -- (-927.294) (-927.275) (-923.242) [-922.861] * (-923.864) [-922.352] (-921.806) (-924.722) -- 0:00:49
277000 -- (-923.960) (-926.676) (-922.385) [-923.049] * (-923.948) [-922.860] (-928.896) (-924.444) -- 0:00:49
277500 -- [-923.799] (-925.131) (-923.460) (-923.199) * (-926.507) (-922.870) (-923.674) [-923.991] -- 0:00:49
278000 -- [-922.924] (-923.915) (-925.778) (-926.512) * (-927.988) [-925.432] (-923.664) (-923.417) -- 0:00:49
278500 -- (-924.835) (-923.857) [-922.960] (-926.028) * (-923.749) [-924.897] (-925.422) (-923.862) -- 0:00:49
279000 -- (-923.627) (-924.082) [-922.960] (-924.018) * (-923.153) [-924.875] (-924.409) (-924.694) -- 0:00:49
279500 -- (-923.489) [-924.811] (-928.683) (-925.249) * (-922.943) (-924.201) [-923.308] (-924.078) -- 0:00:48
280000 -- [-924.794] (-922.684) (-925.102) (-922.936) * (-924.528) [-923.375] (-922.587) (-923.015) -- 0:00:48
Average standard deviation of split frequencies: 0.011461
280500 -- (-923.020) (-925.055) [-924.869] (-925.614) * (-922.999) (-924.596) (-923.934) [-924.477] -- 0:00:48
281000 -- [-925.783] (-923.303) (-922.395) (-924.234) * (-927.281) [-923.161] (-925.551) (-922.382) -- 0:00:48
281500 -- (-922.842) (-922.970) (-923.729) [-924.207] * (-924.930) (-922.220) [-926.690] (-922.678) -- 0:00:48
282000 -- (-926.447) [-924.023] (-925.860) (-923.213) * (-927.115) (-922.582) (-923.559) [-923.678] -- 0:00:48
282500 -- [-923.837] (-924.932) (-928.189) (-923.583) * (-933.082) [-926.318] (-924.059) (-926.117) -- 0:00:48
283000 -- [-922.396] (-926.331) (-924.091) (-924.967) * (-922.420) [-923.748] (-924.107) (-926.347) -- 0:00:48
283500 -- (-923.404) (-924.477) (-923.178) [-926.921] * (-922.829) (-923.693) [-924.265] (-925.518) -- 0:00:48
284000 -- (-924.025) (-923.388) [-924.427] (-922.973) * (-924.964) (-924.162) (-924.428) [-925.263] -- 0:00:47
284500 -- (-924.959) [-922.683] (-924.439) (-923.548) * (-923.996) [-923.701] (-924.191) (-922.995) -- 0:00:47
285000 -- (-923.530) (-923.757) [-923.117] (-926.574) * (-922.669) (-923.808) [-924.261] (-923.605) -- 0:00:47
Average standard deviation of split frequencies: 0.011441
285500 -- (-923.530) (-926.678) (-923.677) [-928.123] * (-922.519) (-924.821) (-926.176) [-926.366] -- 0:00:47
286000 -- (-925.928) (-924.465) [-923.318] (-927.711) * (-924.675) (-923.985) [-923.943] (-925.645) -- 0:00:47
286500 -- [-926.161] (-926.723) (-926.755) (-924.118) * (-924.155) [-922.251] (-925.757) (-924.342) -- 0:00:47
287000 -- (-924.876) (-923.501) [-924.741] (-924.300) * (-924.142) [-926.034] (-925.273) (-923.336) -- 0:00:47
287500 -- (-924.363) (-931.273) [-922.642] (-926.062) * (-923.725) [-924.297] (-922.606) (-923.024) -- 0:00:47
288000 -- [-924.212] (-930.104) (-921.896) (-927.760) * (-922.577) [-922.806] (-924.770) (-925.191) -- 0:00:46
288500 -- (-922.913) [-924.772] (-921.896) (-922.365) * (-923.940) [-923.581] (-922.079) (-925.914) -- 0:00:46
289000 -- (-923.231) (-923.303) (-922.234) [-923.036] * (-924.555) (-924.124) (-922.541) [-923.669] -- 0:00:46
289500 -- (-922.743) (-922.525) [-922.830] (-922.951) * [-925.174] (-924.393) (-923.651) (-923.605) -- 0:00:46
290000 -- (-923.909) (-921.930) [-924.203] (-927.667) * (-929.460) [-926.410] (-924.274) (-924.759) -- 0:00:46
Average standard deviation of split frequencies: 0.011353
290500 -- (-922.662) (-921.967) (-926.349) [-923.686] * (-926.373) (-926.472) [-921.984] (-922.885) -- 0:00:48
291000 -- (-923.757) (-923.292) (-924.020) [-924.786] * (-922.773) [-923.364] (-924.876) (-923.650) -- 0:00:48
291500 -- [-923.654] (-923.559) (-927.811) (-926.514) * [-924.129] (-923.478) (-923.353) (-925.577) -- 0:00:48
292000 -- [-925.476] (-923.213) (-922.877) (-924.830) * [-923.968] (-927.641) (-926.979) (-924.457) -- 0:00:48
292500 -- [-924.948] (-926.258) (-925.690) (-924.880) * (-925.140) (-930.851) [-925.536] (-925.081) -- 0:00:48
293000 -- (-927.063) (-923.940) [-925.369] (-926.345) * [-923.435] (-926.617) (-921.964) (-922.393) -- 0:00:48
293500 -- (-924.822) [-925.330] (-923.323) (-931.443) * (-925.355) (-924.555) (-922.302) [-929.321] -- 0:00:48
294000 -- (-923.514) [-924.289] (-922.159) (-925.572) * (-923.045) (-924.343) [-922.825] (-932.271) -- 0:00:48
294500 -- (-922.412) (-923.240) [-928.113] (-925.044) * (-923.010) (-923.955) [-923.640] (-924.852) -- 0:00:47
295000 -- [-922.235] (-922.772) (-928.899) (-924.226) * (-923.453) [-923.344] (-922.647) (-925.283) -- 0:00:47
Average standard deviation of split frequencies: 0.010961
295500 -- (-923.858) (-923.394) (-923.832) [-923.624] * (-923.146) (-924.926) (-924.055) [-924.324] -- 0:00:47
296000 -- [-922.630] (-922.836) (-924.425) (-923.403) * [-923.284] (-922.844) (-924.100) (-928.119) -- 0:00:47
296500 -- (-929.302) (-924.034) [-923.215] (-926.128) * [-921.905] (-923.961) (-922.909) (-928.539) -- 0:00:47
297000 -- (-927.246) (-923.783) (-925.310) [-923.195] * (-922.604) (-924.117) [-922.602] (-923.417) -- 0:00:47
297500 -- (-923.239) (-925.377) [-925.216] (-922.872) * (-921.786) (-922.371) (-925.894) [-923.321] -- 0:00:47
298000 -- (-927.797) [-922.467] (-922.248) (-923.711) * [-926.704] (-924.254) (-923.711) (-923.309) -- 0:00:47
298500 -- (-926.322) [-922.467] (-925.401) (-924.768) * [-927.488] (-927.238) (-926.293) (-926.142) -- 0:00:47
299000 -- (-922.492) (-926.084) (-923.132) [-924.872] * [-924.895] (-922.143) (-923.851) (-924.962) -- 0:00:46
299500 -- (-923.579) [-924.944] (-923.132) (-924.977) * [-923.290] (-931.268) (-924.160) (-928.119) -- 0:00:46
300000 -- (-922.909) [-922.295] (-923.172) (-925.245) * [-925.813] (-929.430) (-926.645) (-923.098) -- 0:00:46
Average standard deviation of split frequencies: 0.010883
300500 -- (-928.826) (-923.265) (-930.742) [-924.531] * (-925.338) [-922.848] (-924.424) (-925.467) -- 0:00:46
301000 -- (-927.723) [-923.669] (-923.112) (-925.075) * (-924.631) (-921.814) (-924.454) [-922.435] -- 0:00:46
301500 -- (-926.088) (-923.324) [-924.437] (-922.861) * [-923.858] (-923.515) (-924.702) (-924.276) -- 0:00:46
302000 -- (-923.177) (-923.321) [-924.531] (-922.388) * (-923.501) (-926.591) (-924.926) [-923.453] -- 0:00:46
302500 -- (-925.227) (-922.517) [-926.250] (-923.169) * (-923.224) [-924.014] (-924.399) (-925.734) -- 0:00:46
303000 -- (-927.361) (-926.716) [-924.796] (-924.320) * [-923.018] (-923.478) (-924.509) (-927.871) -- 0:00:46
303500 -- (-923.958) (-923.625) (-923.054) [-923.370] * (-923.533) (-923.760) [-923.497] (-924.952) -- 0:00:45
304000 -- (-925.794) [-924.229] (-923.576) (-923.057) * (-923.062) [-922.144] (-924.435) (-926.292) -- 0:00:45
304500 -- (-922.909) (-928.165) (-926.243) [-923.160] * (-924.923) (-922.241) [-924.692] (-926.209) -- 0:00:45
305000 -- (-922.783) [-924.242] (-924.893) (-924.191) * [-924.765] (-922.649) (-925.848) (-923.293) -- 0:00:45
Average standard deviation of split frequencies: 0.010512
305500 -- (-923.792) [-922.519] (-924.803) (-925.658) * (-922.791) [-922.385] (-926.989) (-924.221) -- 0:00:45
306000 -- (-922.627) (-923.725) [-922.836] (-927.309) * [-922.871] (-921.874) (-924.184) (-926.410) -- 0:00:45
306500 -- [-923.514] (-923.802) (-922.809) (-925.368) * [-922.641] (-921.711) (-924.189) (-928.315) -- 0:00:45
307000 -- [-925.061] (-923.489) (-925.001) (-927.079) * (-922.156) (-925.628) (-922.662) [-925.738] -- 0:00:47
307500 -- (-925.777) (-925.444) (-925.155) [-928.125] * (-922.924) (-932.149) (-923.446) [-922.904] -- 0:00:47
308000 -- (-926.459) [-924.416] (-923.888) (-923.323) * (-922.463) (-930.459) (-923.553) [-926.539] -- 0:00:47
308500 -- (-926.219) [-923.874] (-929.709) (-924.217) * (-923.525) (-925.510) (-922.838) [-922.979] -- 0:00:47
309000 -- (-923.818) [-922.186] (-924.553) (-924.299) * (-925.553) [-921.833] (-923.317) (-924.092) -- 0:00:46
309500 -- (-924.935) [-922.518] (-924.290) (-926.841) * [-924.616] (-924.416) (-925.599) (-925.219) -- 0:00:46
310000 -- (-923.765) (-923.714) (-923.235) [-927.341] * (-923.481) (-926.652) [-925.354] (-924.075) -- 0:00:46
Average standard deviation of split frequencies: 0.010800
310500 -- (-930.785) (-922.069) (-923.090) [-925.414] * (-924.227) (-925.318) [-925.906] (-921.990) -- 0:00:46
311000 -- (-930.493) [-928.475] (-927.168) (-925.745) * [-924.811] (-923.384) (-922.442) (-922.610) -- 0:00:46
311500 -- (-929.699) (-924.758) (-925.221) [-922.944] * (-923.999) (-925.136) [-922.551] (-923.038) -- 0:00:46
312000 -- (-923.774) (-923.809) (-928.308) [-925.897] * (-924.249) (-922.611) (-925.260) [-922.435] -- 0:00:46
312500 -- (-924.075) (-922.702) (-924.729) [-922.937] * (-923.796) (-924.465) (-921.921) [-922.839] -- 0:00:46
313000 -- (-923.753) (-926.708) [-925.309] (-924.822) * [-923.220] (-922.546) (-922.094) (-924.057) -- 0:00:46
313500 -- (-923.381) (-923.895) [-925.210] (-926.652) * (-924.767) (-922.543) (-931.579) [-925.639] -- 0:00:45
314000 -- (-924.686) (-924.231) (-923.226) [-927.350] * (-922.768) (-925.473) [-922.465] (-924.108) -- 0:00:45
314500 -- (-923.235) (-924.360) [-924.993] (-930.801) * [-923.551] (-921.835) (-926.995) (-929.579) -- 0:00:45
315000 -- (-925.507) (-922.341) [-923.693] (-923.812) * (-922.648) (-921.672) (-923.821) [-927.614] -- 0:00:45
Average standard deviation of split frequencies: 0.011145
315500 -- (-925.079) [-923.670] (-923.361) (-927.886) * [-922.331] (-923.153) (-923.555) (-923.336) -- 0:00:45
316000 -- (-922.339) [-922.686] (-922.905) (-924.231) * (-924.849) [-922.061] (-922.505) (-923.662) -- 0:00:45
316500 -- (-923.342) (-923.375) [-923.486] (-924.835) * (-929.173) (-924.509) (-922.267) [-924.986] -- 0:00:45
317000 -- (-923.717) (-923.804) [-922.964] (-927.996) * (-924.732) (-924.233) [-925.915] (-924.844) -- 0:00:45
317500 -- (-923.625) [-923.461] (-923.974) (-925.553) * (-923.768) [-923.420] (-924.945) (-923.635) -- 0:00:45
318000 -- (-924.584) (-925.471) [-926.851] (-924.343) * (-924.040) (-923.842) [-924.117] (-927.915) -- 0:00:45
318500 -- (-924.230) (-926.331) (-926.834) [-928.868] * (-923.825) [-924.464] (-923.709) (-928.235) -- 0:00:44
319000 -- (-924.133) (-923.932) (-923.587) [-925.277] * (-923.456) (-926.451) [-922.282] (-924.713) -- 0:00:44
319500 -- (-927.400) (-923.747) [-924.539] (-923.366) * (-923.162) [-924.778] (-922.854) (-922.506) -- 0:00:44
320000 -- (-926.667) (-925.727) (-924.594) [-923.868] * (-928.444) (-923.182) (-922.115) [-924.580] -- 0:00:44
Average standard deviation of split frequencies: 0.011242
320500 -- (-923.837) (-923.647) [-922.999] (-924.198) * (-926.428) (-923.770) (-924.064) [-926.171] -- 0:00:44
321000 -- (-923.471) (-922.050) [-922.153] (-923.534) * (-923.953) (-924.434) (-925.559) [-923.958] -- 0:00:44
321500 -- (-923.810) (-923.238) [-922.310] (-925.092) * [-933.421] (-925.602) (-923.596) (-924.093) -- 0:00:44
322000 -- (-923.537) (-926.032) [-924.987] (-925.214) * (-930.453) [-924.314] (-927.192) (-926.506) -- 0:00:44
322500 -- (-923.712) [-923.903] (-924.160) (-923.869) * (-923.393) (-925.339) [-925.480] (-923.435) -- 0:00:44
323000 -- (-925.157) (-923.721) (-922.738) [-924.403] * (-921.965) (-923.363) (-924.659) [-922.700] -- 0:00:44
323500 -- (-925.272) (-925.075) (-923.492) [-923.961] * [-922.582] (-923.003) (-926.710) (-922.943) -- 0:00:43
324000 -- (-926.172) (-925.871) [-923.055] (-925.375) * (-922.667) (-924.732) (-925.450) [-922.668] -- 0:00:45
324500 -- (-924.886) (-925.158) (-926.946) [-927.500] * (-924.488) (-927.977) [-927.992] (-924.054) -- 0:00:45
325000 -- [-926.690] (-927.370) (-928.156) (-926.856) * (-923.472) [-926.769] (-927.273) (-923.483) -- 0:00:45
Average standard deviation of split frequencies: 0.011006
325500 -- (-922.702) [-923.049] (-925.002) (-924.685) * [-923.293] (-924.000) (-922.621) (-924.419) -- 0:00:45
326000 -- (-922.563) (-923.101) [-925.954] (-928.175) * (-926.005) (-925.204) [-925.087] (-923.900) -- 0:00:45
326500 -- [-922.988] (-923.019) (-923.224) (-924.997) * (-924.882) (-926.622) [-923.224] (-923.371) -- 0:00:45
327000 -- (-923.393) (-924.295) [-923.379] (-923.284) * (-923.190) (-925.094) (-925.942) [-926.304] -- 0:00:45
327500 -- [-923.312] (-925.547) (-924.040) (-925.798) * (-924.374) [-925.485] (-928.238) (-922.444) -- 0:00:45
328000 -- [-924.320] (-925.021) (-927.229) (-924.154) * (-922.272) (-923.650) [-923.867] (-922.477) -- 0:00:45
328500 -- (-925.360) [-922.427] (-928.502) (-922.780) * [-921.831] (-924.955) (-925.276) (-922.500) -- 0:00:44
329000 -- [-924.888] (-922.612) (-925.518) (-922.537) * (-922.450) [-924.801] (-923.145) (-922.839) -- 0:00:44
329500 -- (-925.696) (-921.878) [-924.417] (-922.201) * (-923.715) (-923.000) (-923.219) [-923.424] -- 0:00:44
330000 -- (-922.853) (-922.735) [-926.452] (-923.375) * (-922.622) [-923.528] (-922.006) (-924.388) -- 0:00:44
Average standard deviation of split frequencies: 0.010613
330500 -- [-925.147] (-925.198) (-925.116) (-922.594) * [-922.578] (-924.107) (-925.844) (-924.527) -- 0:00:44
331000 -- (-924.879) (-924.064) [-922.572] (-923.856) * [-922.816] (-925.495) (-925.390) (-924.031) -- 0:00:44
331500 -- (-924.079) [-925.057] (-922.694) (-925.433) * (-926.605) (-923.765) (-923.867) [-926.512] -- 0:00:44
332000 -- (-923.058) (-923.424) [-923.683] (-926.095) * (-922.063) (-925.573) [-924.366] (-925.043) -- 0:00:44
332500 -- (-925.810) [-924.375] (-923.714) (-924.699) * (-924.237) [-928.537] (-925.038) (-926.406) -- 0:00:44
333000 -- (-925.704) (-923.029) [-925.590] (-925.621) * (-924.688) [-928.096] (-925.889) (-922.375) -- 0:00:44
333500 -- (-923.005) [-922.599] (-928.791) (-923.673) * (-922.432) (-925.424) (-927.570) [-922.905] -- 0:00:43
334000 -- (-926.183) (-924.384) (-925.725) [-922.738] * [-921.961] (-929.809) (-927.086) (-926.987) -- 0:00:43
334500 -- (-924.532) (-923.348) (-922.561) [-922.922] * (-922.966) (-923.469) (-925.556) [-925.563] -- 0:00:43
335000 -- (-926.887) (-926.062) [-923.090] (-922.700) * (-924.985) [-924.103] (-926.751) (-923.682) -- 0:00:43
Average standard deviation of split frequencies: 0.009747
335500 -- [-922.963] (-924.012) (-923.971) (-923.413) * (-928.016) (-925.161) (-925.612) [-923.675] -- 0:00:43
336000 -- (-924.481) (-923.820) (-923.079) [-924.649] * (-922.271) (-926.659) (-922.852) [-924.077] -- 0:00:43
336500 -- [-923.924] (-925.921) (-923.676) (-925.781) * [-923.494] (-928.992) (-924.144) (-924.177) -- 0:00:43
337000 -- [-923.637] (-923.209) (-923.441) (-924.733) * [-922.530] (-924.040) (-925.528) (-926.563) -- 0:00:43
337500 -- [-925.436] (-927.404) (-924.368) (-924.914) * (-925.335) [-923.165] (-922.801) (-924.660) -- 0:00:43
338000 -- (-926.905) (-928.340) [-925.892] (-922.713) * (-923.965) (-924.409) [-925.313] (-922.451) -- 0:00:43
338500 -- (-923.276) (-922.925) (-923.316) [-923.497] * (-923.434) [-924.243] (-923.077) (-924.115) -- 0:00:42
339000 -- [-924.825] (-922.702) (-922.612) (-924.492) * [-925.204] (-924.035) (-924.132) (-927.145) -- 0:00:42
339500 -- (-925.138) (-922.999) (-922.606) [-923.530] * (-927.458) (-924.604) (-925.301) [-925.826] -- 0:00:42
340000 -- (-923.293) [-924.068] (-922.726) (-928.016) * [-923.532] (-924.304) (-926.579) (-923.900) -- 0:00:42
Average standard deviation of split frequencies: 0.009840
340500 -- [-923.734] (-923.403) (-923.801) (-928.466) * (-930.062) [-924.349] (-923.641) (-922.712) -- 0:00:44
341000 -- (-922.801) [-922.209] (-925.739) (-928.217) * (-930.060) [-923.412] (-923.256) (-923.232) -- 0:00:44
341500 -- (-922.910) (-921.931) [-923.067] (-922.450) * (-923.534) [-925.161] (-922.356) (-922.647) -- 0:00:44
342000 -- [-923.151] (-921.999) (-925.682) (-922.823) * (-925.382) (-924.762) [-924.887] (-923.958) -- 0:00:44
342500 -- (-926.719) (-923.008) (-924.603) [-922.725] * [-925.418] (-926.483) (-922.195) (-924.636) -- 0:00:44
343000 -- [-923.783] (-923.039) (-925.856) (-923.744) * (-923.206) [-925.782] (-925.036) (-925.175) -- 0:00:44
343500 -- [-923.231] (-922.461) (-925.223) (-925.002) * (-924.675) (-923.751) [-926.984] (-929.356) -- 0:00:43
344000 -- [-922.841] (-922.376) (-927.579) (-925.616) * (-922.081) [-923.169] (-923.437) (-929.145) -- 0:00:43
344500 -- (-924.816) (-927.255) [-922.690] (-928.493) * (-924.684) (-926.073) [-925.225] (-925.110) -- 0:00:43
345000 -- (-922.451) (-923.670) (-924.022) [-924.758] * [-924.218] (-923.992) (-923.897) (-928.163) -- 0:00:43
Average standard deviation of split frequencies: 0.009688
345500 -- [-923.148] (-926.021) (-926.556) (-923.384) * (-925.322) [-924.339] (-926.457) (-922.331) -- 0:00:43
346000 -- (-927.524) [-925.761] (-927.965) (-924.411) * (-924.415) [-924.809] (-925.015) (-926.264) -- 0:00:43
346500 -- (-924.720) (-922.895) [-922.123] (-923.852) * (-925.215) [-922.333] (-923.737) (-926.169) -- 0:00:43
347000 -- [-922.702] (-923.383) (-927.468) (-921.934) * [-923.123] (-922.826) (-922.280) (-926.784) -- 0:00:43
347500 -- (-924.286) [-925.854] (-926.225) (-925.175) * [-923.373] (-923.205) (-926.659) (-922.311) -- 0:00:43
348000 -- (-925.981) (-924.708) [-923.543] (-924.140) * (-923.743) (-923.121) (-924.084) [-923.004] -- 0:00:43
348500 -- (-923.982) (-926.289) [-922.930] (-927.325) * (-926.338) (-925.004) (-922.415) [-923.444] -- 0:00:42
349000 -- (-923.240) (-926.010) [-922.843] (-922.998) * (-923.016) (-926.259) (-924.575) [-923.331] -- 0:00:42
349500 -- (-923.816) (-927.195) [-923.506] (-923.669) * (-926.629) (-925.292) (-925.010) [-924.242] -- 0:00:42
350000 -- (-928.870) (-923.320) [-926.009] (-923.944) * [-926.431] (-922.545) (-924.442) (-923.501) -- 0:00:42
Average standard deviation of split frequencies: 0.009858
350500 -- (-926.021) (-922.193) (-925.472) [-922.285] * (-930.395) (-923.133) [-924.442] (-924.601) -- 0:00:42
351000 -- (-924.156) (-922.991) (-924.183) [-926.785] * (-930.941) [-922.541] (-929.906) (-923.545) -- 0:00:42
351500 -- [-925.128] (-922.212) (-924.466) (-924.799) * (-926.315) (-924.631) [-923.416] (-922.412) -- 0:00:42
352000 -- (-924.243) (-934.057) [-923.692] (-924.991) * (-923.016) (-925.322) [-923.190] (-922.601) -- 0:00:42
352500 -- (-922.498) (-925.079) (-921.875) [-924.452] * (-922.515) (-924.669) (-926.303) [-924.971] -- 0:00:42
353000 -- (-922.417) (-926.024) (-923.403) [-925.621] * (-922.586) (-924.807) (-923.992) [-923.313] -- 0:00:42
353500 -- (-922.014) (-922.945) (-921.792) [-924.390] * (-922.912) (-924.450) [-922.794] (-926.079) -- 0:00:42
354000 -- (-922.767) (-926.101) (-922.763) [-926.853] * [-923.103] (-926.795) (-922.781) (-923.845) -- 0:00:41
354500 -- (-924.684) (-924.719) [-923.024] (-922.054) * (-923.923) (-926.163) [-926.756] (-924.090) -- 0:00:41
355000 -- (-925.943) (-927.292) [-922.986] (-924.128) * (-922.863) (-927.914) (-925.271) [-926.061] -- 0:00:41
Average standard deviation of split frequencies: 0.009343
355500 -- (-925.822) (-923.145) [-923.669] (-925.101) * (-922.945) (-927.413) [-924.492] (-926.993) -- 0:00:41
356000 -- (-922.514) [-927.621] (-925.839) (-926.504) * (-923.450) (-923.080) [-923.353] (-924.935) -- 0:00:41
356500 -- (-923.918) [-926.721] (-922.721) (-922.155) * (-923.663) (-923.953) [-922.740] (-923.397) -- 0:00:41
357000 -- [-922.505] (-926.023) (-926.516) (-922.878) * (-923.845) [-924.068] (-923.620) (-923.655) -- 0:00:43
357500 -- [-922.520] (-926.771) (-926.706) (-923.991) * (-926.522) (-922.945) [-925.327] (-925.520) -- 0:00:43
358000 -- (-922.018) [-926.242] (-927.039) (-922.928) * (-925.378) [-928.552] (-926.084) (-926.990) -- 0:00:43
358500 -- (-922.460) (-925.614) [-925.742] (-923.976) * (-926.082) (-928.049) [-923.442] (-923.842) -- 0:00:42
359000 -- (-926.392) [-923.914] (-924.151) (-922.558) * (-925.600) [-924.435] (-924.519) (-925.930) -- 0:00:42
359500 -- (-923.777) (-925.727) (-926.233) [-924.286] * (-925.525) (-924.814) [-927.670] (-926.205) -- 0:00:42
360000 -- (-923.697) [-928.601] (-922.834) (-927.748) * [-923.239] (-923.455) (-924.318) (-923.825) -- 0:00:42
Average standard deviation of split frequencies: 0.009222
360500 -- [-922.858] (-925.680) (-924.683) (-929.803) * [-922.652] (-925.782) (-922.562) (-925.483) -- 0:00:42
361000 -- (-924.649) (-923.138) [-924.541] (-924.931) * [-923.864] (-925.801) (-922.745) (-924.854) -- 0:00:42
361500 -- [-924.041] (-922.792) (-922.883) (-925.816) * (-923.316) [-922.562] (-923.019) (-923.910) -- 0:00:42
362000 -- (-922.341) [-922.676] (-923.721) (-923.775) * [-924.233] (-923.531) (-922.976) (-923.251) -- 0:00:42
362500 -- (-923.798) (-922.520) (-926.159) [-926.224] * (-925.312) (-923.373) [-926.539] (-922.866) -- 0:00:42
363000 -- (-926.043) [-921.822] (-923.533) (-926.764) * (-923.310) [-925.917] (-923.499) (-922.842) -- 0:00:42
363500 -- [-924.973] (-924.019) (-923.212) (-925.314) * [-924.984] (-923.844) (-925.160) (-922.599) -- 0:00:42
364000 -- (-924.360) [-930.346] (-923.705) (-925.774) * (-922.523) (-924.654) [-926.295] (-924.981) -- 0:00:41
364500 -- (-923.227) [-926.214] (-930.158) (-924.875) * (-924.086) [-926.830] (-924.543) (-927.207) -- 0:00:41
365000 -- [-925.031] (-930.823) (-926.300) (-930.212) * (-924.778) (-925.133) [-924.068] (-922.948) -- 0:00:41
Average standard deviation of split frequencies: 0.009660
365500 -- (-924.716) (-923.320) [-923.841] (-930.861) * [-924.549] (-925.993) (-924.021) (-923.181) -- 0:00:41
366000 -- (-924.112) [-923.620] (-922.712) (-922.876) * (-922.167) (-926.781) (-925.095) [-922.759] -- 0:00:41
366500 -- (-923.062) (-925.303) [-922.936] (-923.777) * (-923.318) (-924.462) [-922.093] (-923.745) -- 0:00:41
367000 -- (-932.714) (-923.044) (-923.660) [-923.563] * (-926.361) (-926.438) [-923.962] (-922.389) -- 0:00:41
367500 -- (-925.874) (-923.033) [-924.466] (-927.404) * (-926.550) (-924.869) [-927.537] (-924.021) -- 0:00:41
368000 -- (-923.314) (-922.505) [-925.128] (-922.595) * (-923.423) [-922.753] (-929.214) (-926.857) -- 0:00:41
368500 -- [-924.231] (-927.579) (-923.124) (-925.043) * (-922.436) (-922.509) (-923.475) [-924.908] -- 0:00:41
369000 -- (-923.971) [-926.120] (-923.054) (-923.090) * (-923.305) (-924.120) (-923.180) [-924.968] -- 0:00:41
369500 -- (-923.659) (-925.377) [-923.108] (-928.088) * (-923.435) [-925.127] (-924.565) (-923.943) -- 0:00:40
370000 -- (-923.781) (-929.764) [-922.848] (-927.919) * (-922.345) [-925.151] (-928.609) (-922.310) -- 0:00:40
Average standard deviation of split frequencies: 0.010457
370500 -- (-925.394) [-923.444] (-923.090) (-924.139) * (-923.770) (-924.845) [-927.436] (-923.518) -- 0:00:40
371000 -- (-930.314) (-924.693) (-922.691) [-927.071] * (-925.827) (-924.620) (-930.832) [-924.367] -- 0:00:40
371500 -- (-926.362) [-925.648] (-923.436) (-925.882) * (-923.678) (-928.997) [-924.274] (-923.285) -- 0:00:40
372000 -- (-922.439) (-930.255) [-922.601] (-922.789) * (-925.521) (-932.760) (-922.351) [-923.908] -- 0:00:40
372500 -- (-922.303) [-923.638] (-923.941) (-924.001) * (-925.590) (-924.913) [-924.672] (-923.276) -- 0:00:40
373000 -- (-922.320) (-924.310) [-925.036] (-923.840) * (-926.163) (-926.074) (-928.267) [-923.331] -- 0:00:40
373500 -- (-924.474) [-927.389] (-925.129) (-924.847) * (-923.229) (-926.555) (-927.292) [-923.732] -- 0:00:41
374000 -- [-921.862] (-926.343) (-925.450) (-922.240) * (-924.364) [-923.081] (-922.519) (-925.379) -- 0:00:41
374500 -- (-921.996) [-930.944] (-930.828) (-922.309) * (-922.544) [-922.593] (-924.849) (-924.633) -- 0:00:41
375000 -- (-923.863) (-924.859) (-922.952) [-922.886] * [-925.653] (-923.493) (-925.397) (-923.443) -- 0:00:41
Average standard deviation of split frequencies: 0.010100
375500 -- (-923.403) (-926.603) (-925.205) [-924.802] * (-922.706) (-923.554) (-925.107) [-922.926] -- 0:00:41
376000 -- [-922.816] (-924.655) (-926.150) (-924.952) * [-923.517] (-928.462) (-925.514) (-922.713) -- 0:00:41
376500 -- [-921.979] (-925.973) (-926.161) (-924.348) * [-924.492] (-932.780) (-924.355) (-922.035) -- 0:00:41
377000 -- (-922.232) (-925.450) (-922.998) [-933.635] * (-924.581) (-929.942) [-923.715] (-927.101) -- 0:00:41
377500 -- (-923.453) (-925.674) (-923.512) [-922.882] * (-925.844) (-926.158) (-922.512) [-924.833] -- 0:00:41
378000 -- (-923.311) (-925.940) (-922.576) [-924.548] * (-924.044) (-922.627) [-925.384] (-922.763) -- 0:00:41
378500 -- (-933.166) (-924.828) (-923.369) [-927.100] * (-923.618) [-923.518] (-922.511) (-931.124) -- 0:00:41
379000 -- [-923.620] (-923.832) (-924.102) (-924.316) * [-923.339] (-922.850) (-928.811) (-923.256) -- 0:00:40
379500 -- (-923.910) (-924.261) [-923.839] (-923.777) * (-924.709) (-922.654) [-922.705] (-926.974) -- 0:00:40
380000 -- [-926.382] (-922.695) (-925.591) (-925.116) * (-923.091) (-923.122) [-925.045] (-923.291) -- 0:00:40
Average standard deviation of split frequencies: 0.011489
380500 -- (-930.391) (-922.967) (-922.769) [-923.158] * (-922.623) (-926.806) [-924.509] (-923.468) -- 0:00:40
381000 -- (-925.839) [-923.545] (-925.933) (-923.047) * (-925.027) (-924.228) [-923.016] (-926.409) -- 0:00:40
381500 -- (-923.208) (-924.962) (-927.669) [-921.746] * (-924.125) (-926.007) [-923.703] (-924.229) -- 0:00:40
382000 -- (-925.889) [-923.731] (-925.525) (-923.933) * [-924.146] (-924.271) (-926.204) (-922.788) -- 0:00:40
382500 -- (-925.296) (-925.618) (-923.239) [-924.478] * (-923.450) (-923.826) [-925.098] (-924.195) -- 0:00:40
383000 -- (-926.350) [-923.843] (-923.662) (-923.374) * (-923.333) [-923.761] (-922.634) (-922.050) -- 0:00:40
383500 -- (-922.334) (-926.147) (-926.928) [-923.666] * (-923.391) (-924.740) [-925.826] (-922.517) -- 0:00:40
384000 -- (-922.245) (-925.508) [-923.935] (-925.084) * (-925.048) (-924.364) [-923.878] (-923.363) -- 0:00:40
384500 -- [-926.449] (-923.319) (-925.015) (-933.362) * (-930.516) [-922.705] (-923.848) (-923.683) -- 0:00:40
385000 -- (-924.570) (-923.508) [-923.949] (-924.952) * (-924.591) [-927.912] (-925.317) (-923.768) -- 0:00:39
Average standard deviation of split frequencies: 0.010720
385500 -- (-922.148) (-926.053) [-923.978] (-926.696) * (-922.771) (-925.827) (-925.901) [-922.449] -- 0:00:39
386000 -- (-923.732) [-924.051] (-923.712) (-923.039) * (-924.528) (-924.605) [-922.549] (-922.461) -- 0:00:39
386500 -- (-924.663) [-924.945] (-925.881) (-924.264) * [-925.065] (-922.363) (-923.519) (-922.759) -- 0:00:39
387000 -- [-927.224] (-928.731) (-923.811) (-923.748) * [-923.704] (-922.288) (-924.848) (-923.920) -- 0:00:39
387500 -- [-929.363] (-924.065) (-927.033) (-925.234) * (-923.800) (-923.697) (-923.698) [-922.963] -- 0:00:39
388000 -- (-924.382) [-923.651] (-924.324) (-924.682) * [-925.724] (-923.700) (-927.352) (-922.566) -- 0:00:39
388500 -- [-922.404] (-922.793) (-926.033) (-923.125) * (-925.037) (-925.419) (-923.741) [-923.280] -- 0:00:39
389000 -- [-924.974] (-923.708) (-925.880) (-925.257) * (-925.168) (-928.377) [-922.186] (-925.482) -- 0:00:39
389500 -- [-925.938] (-923.621) (-924.860) (-925.680) * (-926.476) (-923.090) [-922.905] (-932.763) -- 0:00:39
390000 -- (-926.751) (-922.684) (-922.994) [-924.821] * (-923.901) (-924.105) [-924.809] (-928.692) -- 0:00:39
Average standard deviation of split frequencies: 0.010525
390500 -- (-924.513) (-922.578) (-923.816) [-922.677] * (-924.205) (-922.731) [-921.951] (-926.543) -- 0:00:40
391000 -- [-926.552] (-926.684) (-925.342) (-923.198) * [-925.879] (-924.407) (-926.250) (-926.900) -- 0:00:40
391500 -- [-924.228] (-928.451) (-926.251) (-926.478) * (-922.277) (-927.809) (-924.821) [-923.700] -- 0:00:40
392000 -- (-925.915) (-925.269) (-927.237) [-923.103] * (-923.538) (-927.882) [-926.210] (-924.043) -- 0:00:40
392500 -- (-928.819) (-928.875) [-923.864] (-924.061) * (-924.345) (-925.431) [-922.534] (-925.143) -- 0:00:40
393000 -- (-923.261) (-924.981) [-924.512] (-924.035) * (-923.507) [-924.602] (-922.418) (-925.563) -- 0:00:40
393500 -- (-922.811) (-923.338) (-923.666) [-922.997] * (-926.880) (-927.637) [-924.370] (-924.609) -- 0:00:40
394000 -- [-927.889] (-922.841) (-927.241) (-927.993) * [-922.652] (-926.088) (-923.886) (-925.532) -- 0:00:39
394500 -- (-925.207) (-924.816) (-924.067) [-926.176] * [-923.851] (-925.620) (-926.672) (-925.579) -- 0:00:39
395000 -- (-932.058) (-922.982) (-924.692) [-925.257] * (-924.574) (-923.840) (-923.945) [-923.182] -- 0:00:39
Average standard deviation of split frequencies: 0.010912
395500 -- [-926.049] (-923.053) (-925.316) (-923.468) * (-922.203) [-922.993] (-924.551) (-927.389) -- 0:00:39
396000 -- (-924.326) (-923.080) [-922.788] (-923.922) * (-923.096) (-922.768) (-922.348) [-925.786] -- 0:00:39
396500 -- (-925.446) (-923.071) (-924.344) [-923.639] * (-923.629) (-922.908) [-922.168] (-925.903) -- 0:00:39
397000 -- (-923.581) (-925.428) (-923.031) [-922.068] * (-922.959) (-923.715) [-924.569] (-924.328) -- 0:00:39
397500 -- (-923.566) (-925.043) [-927.136] (-927.881) * (-925.374) [-923.619] (-922.838) (-925.233) -- 0:00:39
398000 -- (-926.624) (-922.754) [-927.180] (-922.268) * (-927.348) [-926.299] (-923.594) (-925.887) -- 0:00:39
398500 -- (-925.873) [-922.247] (-923.461) (-924.975) * [-924.024] (-923.943) (-924.213) (-924.858) -- 0:00:39
399000 -- (-923.136) [-924.802] (-924.711) (-924.565) * (-923.030) (-926.959) [-927.075] (-925.553) -- 0:00:39
399500 -- (-924.596) [-924.736] (-923.045) (-926.737) * (-923.038) [-922.160] (-925.140) (-924.962) -- 0:00:39
400000 -- [-922.663] (-923.031) (-924.411) (-924.374) * [-926.645] (-924.330) (-925.491) (-922.121) -- 0:00:39
Average standard deviation of split frequencies: 0.010458
400500 -- (-924.343) [-926.208] (-924.542) (-927.227) * (-927.053) (-923.341) [-923.300] (-925.927) -- 0:00:38
401000 -- (-924.154) (-922.821) (-924.012) [-926.050] * (-927.269) (-926.913) [-927.236] (-924.510) -- 0:00:38
401500 -- [-922.486] (-922.814) (-925.446) (-928.163) * (-924.834) [-923.359] (-926.020) (-926.498) -- 0:00:38
402000 -- (-922.669) (-925.138) (-922.754) [-924.801] * (-922.371) (-923.823) [-927.595] (-923.528) -- 0:00:38
402500 -- (-926.538) (-924.747) [-922.125] (-923.960) * (-922.960) [-922.460] (-925.492) (-924.465) -- 0:00:38
403000 -- (-928.709) (-928.503) [-925.463] (-923.600) * (-923.388) (-925.625) [-922.481] (-927.795) -- 0:00:38
403500 -- (-925.402) [-924.932] (-923.317) (-924.628) * [-923.030] (-924.992) (-924.143) (-924.243) -- 0:00:38
404000 -- (-923.359) [-923.023] (-924.654) (-926.818) * (-925.351) [-923.644] (-922.638) (-926.643) -- 0:00:38
404500 -- (-924.141) [-922.817] (-924.530) (-931.470) * (-924.985) (-926.911) (-927.142) [-925.985] -- 0:00:38
405000 -- (-926.378) [-924.506] (-923.831) (-924.059) * (-923.989) [-923.300] (-924.645) (-924.549) -- 0:00:38
Average standard deviation of split frequencies: 0.010385
405500 -- (-925.454) (-926.389) [-921.971] (-923.176) * (-922.742) (-923.120) (-923.699) [-923.105] -- 0:00:38
406000 -- (-925.344) (-926.136) (-922.388) [-923.680] * (-924.572) (-922.941) [-925.087] (-922.670) -- 0:00:38
406500 -- [-926.874] (-925.586) (-922.537) (-925.405) * (-926.716) [-922.636] (-924.164) (-925.267) -- 0:00:39
407000 -- (-928.941) (-928.052) (-922.490) [-924.232] * (-927.941) [-923.633] (-924.835) (-922.966) -- 0:00:39
407500 -- (-923.866) [-924.796] (-922.194) (-923.988) * (-923.882) [-926.005] (-928.630) (-924.249) -- 0:00:39
408000 -- (-924.495) [-923.210] (-921.993) (-925.940) * (-922.392) [-923.976] (-925.191) (-928.659) -- 0:00:39
408500 -- [-926.431] (-924.040) (-923.920) (-925.367) * (-922.628) [-924.474] (-926.445) (-927.205) -- 0:00:39
409000 -- (-924.049) (-923.996) (-929.453) [-927.233] * (-927.127) [-924.399] (-923.789) (-924.599) -- 0:00:39
409500 -- (-924.163) (-923.369) (-923.373) [-926.939] * (-923.651) (-928.522) [-924.166] (-923.835) -- 0:00:38
410000 -- (-922.496) [-923.249] (-923.159) (-926.043) * (-924.444) (-923.860) [-926.743] (-926.076) -- 0:00:38
Average standard deviation of split frequencies: 0.010140
410500 -- (-922.221) (-925.707) [-926.099] (-925.339) * (-924.515) [-924.740] (-922.983) (-928.326) -- 0:00:38
411000 -- (-924.133) (-927.774) [-932.232] (-923.868) * (-925.542) (-923.921) (-925.361) [-925.250] -- 0:00:38
411500 -- (-925.916) [-924.161] (-927.125) (-924.245) * (-925.042) (-924.613) (-927.011) [-924.662] -- 0:00:38
412000 -- (-926.240) (-923.449) (-922.419) [-924.437] * (-927.049) [-923.542] (-922.757) (-924.293) -- 0:00:38
412500 -- (-922.753) (-927.951) [-923.466] (-926.223) * (-927.603) [-923.580] (-926.922) (-924.484) -- 0:00:38
413000 -- (-923.878) [-922.245] (-924.568) (-929.445) * (-924.994) (-923.144) [-924.555] (-922.502) -- 0:00:38
413500 -- (-923.907) (-923.260) (-923.309) [-923.315] * [-924.329] (-923.225) (-923.342) (-924.166) -- 0:00:38
414000 -- [-924.002] (-923.455) (-925.695) (-924.531) * (-923.808) (-923.567) (-925.055) [-922.980] -- 0:00:38
414500 -- (-923.217) (-922.833) (-925.787) [-924.448] * [-923.363] (-925.445) (-923.917) (-923.345) -- 0:00:38
415000 -- (-922.846) (-923.163) [-923.276] (-927.430) * (-924.591) [-924.223] (-923.123) (-924.107) -- 0:00:38
Average standard deviation of split frequencies: 0.009695
415500 -- (-923.707) [-923.365] (-924.130) (-924.270) * (-922.273) (-924.888) (-924.332) [-923.771] -- 0:00:37
416000 -- [-923.291] (-925.789) (-926.835) (-924.908) * (-924.894) [-925.327] (-931.849) (-923.858) -- 0:00:37
416500 -- [-922.668] (-923.904) (-923.274) (-923.679) * (-922.561) (-928.754) (-923.860) [-924.773] -- 0:00:37
417000 -- (-923.235) [-923.295] (-923.639) (-925.368) * (-923.048) (-924.657) (-923.354) [-922.941] -- 0:00:37
417500 -- [-922.982] (-922.267) (-928.206) (-923.222) * (-926.388) (-928.965) [-924.273] (-922.769) -- 0:00:37
418000 -- (-927.850) (-924.239) (-923.498) [-924.552] * (-925.427) (-922.415) (-928.230) [-922.245] -- 0:00:37
418500 -- [-922.408] (-922.827) (-927.615) (-928.722) * (-924.947) [-923.942] (-925.747) (-922.662) -- 0:00:37
419000 -- [-922.495] (-922.157) (-924.110) (-925.498) * (-928.945) (-924.410) (-924.791) [-926.095] -- 0:00:37
419500 -- [-923.367] (-925.332) (-923.842) (-923.951) * (-927.545) (-925.136) [-924.436] (-927.298) -- 0:00:37
420000 -- (-923.462) (-922.219) (-924.379) [-923.420] * (-923.380) (-923.082) (-924.218) [-922.486] -- 0:00:37
Average standard deviation of split frequencies: 0.009774
420500 -- (-922.492) (-923.087) (-928.944) [-925.300] * [-922.988] (-923.563) (-928.617) (-924.729) -- 0:00:37
421000 -- (-922.784) [-924.495] (-925.797) (-923.741) * [-924.510] (-922.137) (-924.731) (-922.526) -- 0:00:37
421500 -- (-922.028) (-923.472) (-928.024) [-925.777] * (-926.310) (-922.447) (-924.736) [-925.233] -- 0:00:37
422000 -- [-921.812] (-925.233) (-928.048) (-925.412) * (-924.865) (-925.533) (-924.732) [-923.590] -- 0:00:36
422500 -- [-921.865] (-926.919) (-923.042) (-928.175) * (-926.536) (-928.167) [-927.608] (-928.413) -- 0:00:36
423000 -- [-921.812] (-928.270) (-924.721) (-923.203) * [-928.282] (-925.985) (-926.789) (-923.405) -- 0:00:38
423500 -- (-925.454) (-927.230) (-923.913) [-928.210] * (-922.833) [-927.332] (-923.594) (-926.898) -- 0:00:38
424000 -- (-927.989) (-922.891) [-923.467] (-923.385) * (-927.012) (-929.210) (-922.308) [-923.488] -- 0:00:38
424500 -- (-926.818) (-925.724) [-922.656] (-926.480) * (-922.871) [-924.652] (-923.427) (-924.510) -- 0:00:37
425000 -- [-924.606] (-924.837) (-923.056) (-924.244) * (-924.635) (-922.587) (-924.359) [-923.641] -- 0:00:37
Average standard deviation of split frequencies: 0.010205
425500 -- (-922.312) (-924.215) [-923.121] (-924.049) * (-922.367) (-926.314) (-922.490) [-925.516] -- 0:00:37
426000 -- (-926.123) (-923.998) (-923.956) [-922.601] * [-922.325] (-924.764) (-922.209) (-924.137) -- 0:00:37
426500 -- [-925.458] (-925.762) (-924.788) (-924.251) * (-923.613) (-928.884) [-922.595] (-923.328) -- 0:00:37
427000 -- [-924.024] (-921.809) (-927.094) (-924.421) * (-925.462) [-922.335] (-922.629) (-923.243) -- 0:00:37
427500 -- (-923.067) [-923.000] (-925.762) (-927.468) * [-925.624] (-924.934) (-926.314) (-922.102) -- 0:00:37
428000 -- (-925.202) (-922.711) (-929.365) [-925.450] * [-923.770] (-924.759) (-927.813) (-923.106) -- 0:00:37
428500 -- (-927.004) (-924.439) [-924.862] (-923.708) * [-926.864] (-923.447) (-925.641) (-929.971) -- 0:00:37
429000 -- (-928.368) (-923.862) (-924.822) [-922.307] * (-923.990) (-928.661) [-922.375] (-924.153) -- 0:00:37
429500 -- [-922.389] (-922.009) (-922.189) (-922.351) * [-924.456] (-925.667) (-923.058) (-923.578) -- 0:00:37
430000 -- (-923.657) [-922.934] (-922.592) (-923.898) * (-925.298) [-923.388] (-923.618) (-923.818) -- 0:00:37
Average standard deviation of split frequencies: 0.010216
430500 -- [-924.568] (-923.320) (-923.199) (-925.749) * [-933.948] (-924.834) (-923.196) (-925.124) -- 0:00:37
431000 -- [-923.961] (-923.758) (-926.977) (-925.513) * (-929.202) (-922.788) (-925.902) [-926.258] -- 0:00:36
431500 -- [-923.242] (-924.357) (-923.416) (-925.353) * (-927.292) (-924.048) [-924.676] (-927.274) -- 0:00:36
432000 -- (-923.733) (-929.224) (-923.076) [-924.008] * (-927.283) (-923.247) (-922.430) [-924.963] -- 0:00:36
432500 -- (-922.795) [-924.721] (-922.919) (-922.051) * (-924.278) (-923.714) (-923.484) [-923.996] -- 0:00:36
433000 -- (-923.702) (-924.786) [-925.853] (-927.727) * (-924.541) [-924.647] (-924.065) (-926.099) -- 0:00:36
433500 -- (-924.181) (-925.550) [-924.274] (-932.060) * (-925.933) (-926.328) (-924.334) [-926.213] -- 0:00:36
434000 -- (-924.540) [-925.015] (-927.042) (-932.473) * (-925.920) [-926.131] (-923.570) (-926.399) -- 0:00:36
434500 -- (-922.814) (-923.718) [-927.530] (-927.429) * [-925.827] (-924.243) (-925.373) (-923.342) -- 0:00:36
435000 -- [-922.116] (-924.649) (-926.079) (-927.514) * [-923.117] (-923.206) (-925.761) (-925.395) -- 0:00:36
Average standard deviation of split frequencies: 0.010572
435500 -- (-923.185) (-923.295) (-925.677) [-923.768] * (-923.785) (-923.237) (-925.309) [-922.684] -- 0:00:36
436000 -- (-923.269) (-923.367) (-926.536) [-924.457] * (-925.472) (-923.042) [-923.394] (-922.744) -- 0:00:36
436500 -- [-923.739] (-928.442) (-925.612) (-930.275) * (-925.128) [-926.329] (-923.951) (-924.466) -- 0:00:36
437000 -- [-924.823] (-924.325) (-923.016) (-933.081) * (-924.879) [-924.391] (-923.710) (-922.167) -- 0:00:36
437500 -- [-924.124] (-926.211) (-923.427) (-923.918) * [-924.382] (-923.298) (-924.479) (-922.299) -- 0:00:36
438000 -- (-925.272) (-923.947) (-924.556) [-927.599] * (-923.338) (-923.146) (-924.583) [-922.189] -- 0:00:35
438500 -- [-923.014] (-922.661) (-925.640) (-928.504) * (-922.336) [-926.811] (-924.182) (-925.515) -- 0:00:35
439000 -- (-922.876) (-922.443) [-925.107] (-929.194) * [-922.680] (-924.821) (-925.536) (-923.468) -- 0:00:35
439500 -- (-924.819) [-922.573] (-926.548) (-923.896) * (-923.436) [-926.812] (-924.743) (-921.695) -- 0:00:36
440000 -- (-922.956) (-922.522) (-929.526) [-923.181] * (-924.088) [-927.586] (-927.838) (-923.232) -- 0:00:36
Average standard deviation of split frequencies: 0.010282
440500 -- [-925.912] (-923.877) (-923.553) (-926.351) * [-923.603] (-924.204) (-927.837) (-923.716) -- 0:00:36
441000 -- (-922.489) (-928.300) [-923.175] (-926.533) * (-923.628) [-922.375] (-922.670) (-927.231) -- 0:00:36
441500 -- (-923.048) [-922.254] (-922.588) (-925.912) * (-927.387) (-923.110) (-923.794) [-923.397] -- 0:00:36
442000 -- (-924.048) (-923.520) (-923.317) [-925.408] * (-924.850) (-925.272) [-924.412] (-923.478) -- 0:00:36
442500 -- (-926.375) (-923.622) [-923.245] (-926.959) * (-925.625) (-926.222) (-923.742) [-923.353] -- 0:00:36
443000 -- (-924.231) [-922.557] (-926.112) (-926.605) * (-922.549) [-926.224] (-923.254) (-923.259) -- 0:00:36
443500 -- (-932.785) (-923.697) (-924.023) [-924.278] * [-924.337] (-922.850) (-923.106) (-923.659) -- 0:00:36
444000 -- (-922.851) (-924.528) (-924.221) [-922.724] * (-924.104) (-929.865) [-923.360] (-924.715) -- 0:00:36
444500 -- (-922.768) (-924.767) (-923.271) [-924.130] * (-923.845) [-923.897] (-923.431) (-924.453) -- 0:00:36
445000 -- (-924.245) [-924.296] (-926.026) (-926.585) * (-922.872) [-923.112] (-922.782) (-927.584) -- 0:00:36
Average standard deviation of split frequencies: 0.009454
445500 -- (-924.628) [-923.932] (-923.715) (-924.041) * [-922.156] (-923.390) (-923.757) (-926.575) -- 0:00:36
446000 -- (-925.575) [-924.099] (-922.401) (-923.829) * [-924.199] (-923.973) (-924.195) (-924.548) -- 0:00:36
446500 -- (-923.965) (-923.666) (-924.642) [-925.944] * (-923.403) [-925.368] (-924.825) (-926.841) -- 0:00:35
447000 -- [-922.996] (-926.796) (-924.192) (-924.900) * (-924.750) [-922.295] (-922.594) (-924.360) -- 0:00:35
447500 -- [-924.091] (-925.929) (-925.958) (-928.073) * (-922.272) (-923.748) (-924.097) [-924.568] -- 0:00:35
448000 -- [-923.287] (-921.947) (-923.128) (-923.369) * (-922.240) (-929.468) (-923.381) [-922.041] -- 0:00:35
448500 -- (-924.299) [-921.973] (-925.569) (-923.413) * [-923.955] (-923.309) (-923.120) (-923.588) -- 0:00:35
449000 -- (-923.685) (-925.368) [-927.048] (-924.087) * (-923.108) (-928.216) (-923.490) [-922.794] -- 0:00:35
449500 -- (-926.030) (-927.465) (-923.708) [-922.640] * (-927.551) (-927.681) (-923.475) [-922.761] -- 0:00:35
450000 -- (-924.940) (-929.915) [-923.763] (-922.710) * (-924.558) [-925.300] (-926.234) (-922.284) -- 0:00:35
Average standard deviation of split frequencies: 0.010829
450500 -- (-928.528) [-924.577] (-924.169) (-923.089) * (-928.570) [-923.771] (-925.331) (-922.190) -- 0:00:35
451000 -- (-925.495) [-923.149] (-923.993) (-922.186) * (-924.451) (-924.312) [-924.122] (-923.366) -- 0:00:35
451500 -- (-922.343) (-924.965) [-923.869] (-922.657) * [-923.231] (-925.004) (-926.378) (-924.729) -- 0:00:35
452000 -- (-927.217) (-922.417) (-924.604) [-924.860] * (-924.429) (-923.468) [-925.311] (-924.455) -- 0:00:35
452500 -- (-925.170) (-924.410) [-924.642] (-924.961) * [-925.615] (-922.034) (-934.446) (-928.600) -- 0:00:35
453000 -- (-923.304) (-922.842) (-923.577) [-924.090] * [-923.872] (-924.276) (-922.909) (-924.361) -- 0:00:35
453500 -- (-928.019) [-922.024] (-924.610) (-923.003) * (-924.419) (-922.828) (-924.178) [-924.193] -- 0:00:34
454000 -- [-924.421] (-925.067) (-923.340) (-925.733) * [-924.076] (-923.886) (-925.412) (-923.509) -- 0:00:34
454500 -- (-924.894) (-924.617) (-922.659) [-923.892] * (-925.475) [-925.567] (-925.645) (-922.743) -- 0:00:34
455000 -- (-923.324) (-926.499) (-931.466) [-922.567] * (-923.238) (-922.207) (-922.246) [-922.809] -- 0:00:34
Average standard deviation of split frequencies: 0.010763
455500 -- (-922.326) (-927.417) [-925.158] (-925.795) * (-927.769) [-922.211] (-922.374) (-923.557) -- 0:00:34
456000 -- (-923.048) (-924.488) [-924.743] (-924.162) * (-923.871) [-922.354] (-923.753) (-926.711) -- 0:00:35
456500 -- (-925.417) (-923.466) [-924.340] (-925.345) * (-924.677) (-924.116) [-922.349] (-923.633) -- 0:00:35
457000 -- [-923.667] (-926.404) (-926.887) (-927.725) * (-924.614) [-927.036] (-923.627) (-924.710) -- 0:00:35
457500 -- (-927.699) [-923.764] (-922.986) (-928.505) * (-926.346) (-925.268) [-925.959] (-926.685) -- 0:00:35
458000 -- (-926.022) (-924.458) [-922.569] (-922.454) * (-925.703) (-923.237) (-922.064) [-924.137] -- 0:00:35
458500 -- (-925.398) [-924.035] (-926.924) (-922.539) * (-923.147) (-923.849) [-923.934] (-928.249) -- 0:00:35
459000 -- [-926.483] (-923.087) (-924.507) (-934.201) * (-926.429) (-924.717) [-925.009] (-923.241) -- 0:00:35
459500 -- [-925.354] (-922.404) (-925.669) (-923.015) * (-925.272) [-926.707] (-924.433) (-923.486) -- 0:00:35
460000 -- [-926.851] (-923.554) (-925.387) (-922.189) * (-926.791) (-929.924) [-922.851] (-922.560) -- 0:00:35
Average standard deviation of split frequencies: 0.009571
460500 -- [-923.668] (-928.995) (-923.710) (-922.995) * (-928.795) (-927.060) (-923.107) [-922.677] -- 0:00:35
461000 -- (-924.187) [-923.862] (-924.063) (-923.379) * (-925.475) (-930.407) (-924.865) [-922.591] -- 0:00:35
461500 -- (-933.361) (-921.985) [-923.381] (-923.273) * (-925.822) (-923.764) [-923.225] (-925.659) -- 0:00:35
462000 -- (-923.391) (-922.505) [-923.184] (-922.789) * (-924.187) (-924.236) (-922.867) [-923.092] -- 0:00:34
462500 -- [-923.544] (-925.069) (-924.770) (-922.851) * (-924.341) [-926.031] (-922.052) (-922.564) -- 0:00:34
463000 -- (-929.282) (-927.192) [-925.804] (-922.877) * (-922.852) (-926.691) (-924.490) [-927.854] -- 0:00:34
463500 -- (-922.814) [-925.586] (-924.741) (-923.092) * [-922.180] (-925.645) (-924.763) (-923.199) -- 0:00:34
464000 -- (-925.638) (-923.461) (-922.234) [-923.175] * (-923.260) (-927.718) (-922.603) [-922.288] -- 0:00:34
464500 -- [-924.966] (-922.512) (-926.154) (-925.367) * (-924.371) (-928.325) (-923.668) [-924.219] -- 0:00:34
465000 -- (-925.678) [-923.983] (-922.678) (-924.229) * (-925.447) (-926.335) (-924.011) [-921.979] -- 0:00:34
Average standard deviation of split frequencies: 0.008926
465500 -- (-922.394) (-927.606) (-925.899) [-924.066] * (-925.596) [-926.742] (-922.923) (-924.022) -- 0:00:34
466000 -- (-923.918) (-925.300) (-922.946) [-921.959] * (-924.976) [-924.935] (-923.827) (-923.339) -- 0:00:34
466500 -- [-925.046] (-925.986) (-923.448) (-923.702) * (-928.646) (-921.983) [-924.718] (-922.472) -- 0:00:34
467000 -- [-922.751] (-924.480) (-923.740) (-923.111) * [-926.120] (-925.175) (-923.035) (-923.229) -- 0:00:34
467500 -- (-925.321) (-925.667) (-926.166) [-923.645] * (-924.443) (-922.464) [-922.754] (-922.796) -- 0:00:34
468000 -- (-925.003) [-924.422] (-926.859) (-922.508) * (-928.124) (-923.588) (-921.913) [-923.214] -- 0:00:34
468500 -- (-927.290) (-929.277) [-923.005] (-923.468) * (-928.845) (-928.755) (-921.772) [-922.744] -- 0:00:34
469000 -- (-925.337) (-927.186) (-924.214) [-923.475] * [-923.717] (-925.375) (-922.495) (-923.759) -- 0:00:33
469500 -- (-924.229) [-925.003] (-923.020) (-925.013) * (-924.768) (-925.794) (-922.196) [-924.638] -- 0:00:33
470000 -- (-924.574) (-922.912) [-922.160] (-923.442) * (-925.388) (-925.880) [-923.023] (-925.337) -- 0:00:33
Average standard deviation of split frequencies: 0.009191
470500 -- [-922.753] (-926.845) (-926.879) (-926.173) * [-925.985] (-924.203) (-924.382) (-922.980) -- 0:00:33
471000 -- (-924.795) [-923.317] (-923.489) (-926.774) * (-924.548) [-925.778] (-927.897) (-924.263) -- 0:00:33
471500 -- (-927.701) (-923.110) (-924.200) [-930.225] * (-922.738) (-923.724) (-924.078) [-922.435] -- 0:00:33
472000 -- (-926.961) (-924.504) [-925.747] (-925.785) * (-923.137) [-924.396] (-922.442) (-923.496) -- 0:00:33
472500 -- (-928.022) [-924.477] (-925.437) (-924.600) * (-922.155) [-924.694] (-924.486) (-924.882) -- 0:00:34
473000 -- (-921.943) [-923.895] (-923.694) (-925.942) * (-922.569) (-923.272) (-923.835) [-926.651] -- 0:00:34
473500 -- (-923.675) [-924.171] (-923.746) (-923.136) * (-924.792) [-922.670] (-922.447) (-923.747) -- 0:00:34
474000 -- [-923.567] (-922.810) (-925.968) (-927.372) * (-924.005) (-923.497) [-923.737] (-931.735) -- 0:00:34
474500 -- (-927.593) (-924.413) (-923.389) [-924.333] * [-922.714] (-928.335) (-922.087) (-923.990) -- 0:00:34
475000 -- (-928.445) [-925.305] (-923.410) (-924.817) * [-922.506] (-923.359) (-922.288) (-923.325) -- 0:00:34
Average standard deviation of split frequencies: 0.009463
475500 -- (-927.366) (-926.641) (-924.383) [-922.499] * (-922.419) (-923.277) [-922.700] (-922.173) -- 0:00:34
476000 -- [-925.533] (-922.991) (-925.370) (-926.068) * (-923.450) (-926.774) [-922.854] (-922.418) -- 0:00:34
476500 -- (-924.580) (-925.615) [-924.692] (-927.198) * (-924.004) (-928.440) (-925.211) [-924.447] -- 0:00:34
477000 -- (-928.016) [-924.880] (-922.286) (-925.308) * (-924.279) [-927.011] (-929.520) (-922.732) -- 0:00:33
477500 -- (-923.089) (-924.897) (-924.202) [-927.633] * (-923.502) (-926.714) (-925.009) [-924.274] -- 0:00:33
478000 -- [-922.382] (-923.788) (-924.383) (-922.593) * (-922.588) [-922.659] (-926.363) (-922.431) -- 0:00:33
478500 -- (-922.808) (-923.537) [-926.948] (-925.306) * (-922.568) [-923.426] (-922.668) (-922.267) -- 0:00:33
479000 -- (-925.600) (-924.144) (-925.390) [-923.848] * (-924.961) [-923.880] (-922.895) (-923.696) -- 0:00:33
479500 -- (-924.714) (-924.742) [-924.046] (-923.252) * (-924.708) (-925.821) (-923.686) [-922.414] -- 0:00:33
480000 -- (-923.475) [-924.918] (-923.312) (-923.589) * (-923.034) [-925.318] (-925.097) (-922.061) -- 0:00:33
Average standard deviation of split frequencies: 0.009692
480500 -- (-925.809) (-925.056) (-923.719) [-926.828] * [-923.184] (-924.535) (-922.298) (-923.351) -- 0:00:33
481000 -- (-922.234) [-925.437] (-926.750) (-924.182) * (-922.733) [-923.164] (-922.712) (-923.119) -- 0:00:33
481500 -- [-922.160] (-925.318) (-923.232) (-923.449) * (-922.374) (-922.418) [-922.257] (-923.702) -- 0:00:33
482000 -- (-923.341) (-925.085) (-924.510) [-922.590] * [-926.339] (-924.761) (-926.559) (-923.179) -- 0:00:33
482500 -- (-924.152) [-926.145] (-924.277) (-925.045) * (-924.009) [-923.012] (-924.273) (-924.532) -- 0:00:33
483000 -- (-922.470) [-925.775] (-924.412) (-924.095) * (-923.697) (-922.901) (-923.822) [-923.572] -- 0:00:33
483500 -- (-927.333) [-922.632] (-924.069) (-923.921) * (-923.531) [-924.610] (-926.132) (-924.416) -- 0:00:33
484000 -- (-924.076) (-925.549) (-929.359) [-922.538] * (-923.089) (-923.450) [-922.482] (-928.371) -- 0:00:33
484500 -- (-923.697) (-925.709) [-924.185] (-922.667) * (-923.606) (-925.293) [-923.555] (-925.805) -- 0:00:32
485000 -- (-922.477) (-925.325) [-926.514] (-927.022) * (-926.120) [-925.077] (-922.987) (-925.745) -- 0:00:32
Average standard deviation of split frequencies: 0.009322
485500 -- (-923.839) [-923.600] (-927.296) (-922.012) * (-923.912) (-924.480) (-922.953) [-924.143] -- 0:00:32
486000 -- (-928.110) (-928.199) (-926.006) [-924.965] * (-923.595) (-923.723) [-922.677] (-924.561) -- 0:00:32
486500 -- (-925.024) [-926.408] (-922.199) (-930.745) * (-925.588) (-922.529) [-924.601] (-923.131) -- 0:00:32
487000 -- (-922.292) (-923.827) (-924.854) [-923.367] * (-923.781) [-925.004] (-924.236) (-924.664) -- 0:00:32
487500 -- (-924.212) [-926.927] (-924.245) (-923.030) * [-923.204] (-922.501) (-924.422) (-926.252) -- 0:00:32
488000 -- (-923.059) (-924.319) [-923.489] (-923.763) * [-923.657] (-927.206) (-924.028) (-928.680) -- 0:00:32
488500 -- (-922.529) (-922.547) [-922.776] (-925.102) * (-922.108) (-923.182) (-924.526) [-924.641] -- 0:00:32
489000 -- (-923.277) [-922.595] (-925.129) (-925.798) * (-923.002) (-926.589) (-922.531) [-922.375] -- 0:00:33
489500 -- (-923.448) (-924.536) [-922.734] (-923.516) * [-922.928] (-927.249) (-922.700) (-923.321) -- 0:00:33
490000 -- (-924.998) [-924.307] (-923.162) (-926.428) * [-922.655] (-924.119) (-923.510) (-924.823) -- 0:00:33
Average standard deviation of split frequencies: 0.009890
490500 -- [-925.201] (-922.844) (-924.324) (-922.778) * [-922.932] (-928.586) (-923.573) (-922.628) -- 0:00:33
491000 -- [-923.577] (-924.395) (-924.374) (-922.537) * [-925.478] (-923.693) (-925.016) (-922.828) -- 0:00:33
491500 -- (-922.170) (-922.213) [-922.846] (-922.882) * (-925.342) (-923.347) (-924.588) [-924.611] -- 0:00:33
492000 -- (-923.098) (-924.626) (-923.406) [-927.372] * (-924.255) (-922.390) [-927.623] (-927.216) -- 0:00:33
492500 -- [-922.122] (-924.049) (-924.893) (-930.665) * (-927.634) [-924.803] (-923.885) (-924.280) -- 0:00:32
493000 -- (-924.954) (-922.155) [-923.958] (-924.467) * (-928.417) [-924.122] (-924.475) (-926.280) -- 0:00:32
493500 -- (-922.611) (-923.497) (-923.509) [-925.405] * [-927.633] (-926.375) (-924.349) (-924.646) -- 0:00:32
494000 -- (-923.783) (-927.144) (-926.243) [-923.220] * [-922.741] (-929.321) (-929.020) (-922.702) -- 0:00:32
494500 -- [-924.154] (-926.814) (-922.506) (-923.879) * (-926.798) [-925.556] (-923.313) (-922.668) -- 0:00:32
495000 -- [-924.407] (-926.289) (-924.301) (-927.443) * (-924.103) (-924.680) [-922.673] (-921.974) -- 0:00:32
Average standard deviation of split frequencies: 0.009336
495500 -- (-926.441) [-924.109] (-929.880) (-923.631) * (-926.609) (-924.808) (-921.964) [-924.128] -- 0:00:32
496000 -- [-923.315] (-923.323) (-925.380) (-922.410) * [-928.344] (-922.641) (-922.894) (-921.981) -- 0:00:32
496500 -- (-923.035) [-924.053] (-925.441) (-922.486) * (-927.053) [-923.225] (-923.513) (-922.159) -- 0:00:32
497000 -- (-924.231) (-929.410) (-923.318) [-923.021] * (-924.994) (-924.070) (-926.340) [-923.613] -- 0:00:32
497500 -- (-925.327) [-924.484] (-923.349) (-922.926) * (-924.863) (-924.647) (-922.881) [-922.190] -- 0:00:32
498000 -- [-925.038] (-925.325) (-922.660) (-923.014) * [-922.815] (-925.554) (-927.228) (-923.730) -- 0:00:32
498500 -- (-923.672) [-923.406] (-922.971) (-921.811) * [-924.827] (-923.438) (-926.278) (-928.616) -- 0:00:32
499000 -- (-929.654) (-922.548) (-923.204) [-922.306] * (-925.114) (-924.723) [-925.049] (-922.464) -- 0:00:32
499500 -- (-923.236) (-923.061) (-927.263) [-924.534] * (-926.841) [-922.905] (-924.631) (-923.494) -- 0:00:32
500000 -- [-921.677] (-922.568) (-926.701) (-922.414) * (-926.706) [-923.675] (-927.542) (-925.940) -- 0:00:32
Average standard deviation of split frequencies: 0.009526
500500 -- [-921.977] (-922.895) (-926.760) (-922.654) * [-925.547] (-923.830) (-925.867) (-924.124) -- 0:00:31
501000 -- [-923.364] (-923.404) (-922.203) (-922.965) * (-926.950) (-922.233) (-925.826) [-922.564] -- 0:00:31
501500 -- [-922.610] (-924.778) (-923.395) (-924.347) * (-924.195) [-922.569] (-924.117) (-923.359) -- 0:00:31
502000 -- (-924.387) (-924.942) [-924.110] (-925.423) * (-923.309) [-923.377] (-922.838) (-924.000) -- 0:00:31
502500 -- (-925.719) (-925.371) [-925.622] (-931.025) * (-925.170) (-924.993) [-922.330] (-926.113) -- 0:00:31
503000 -- [-924.883] (-922.746) (-922.564) (-924.119) * (-925.628) [-926.993] (-922.889) (-923.054) -- 0:00:31
503500 -- (-925.783) (-922.868) [-922.364] (-923.292) * (-927.101) (-924.384) (-925.827) [-922.172] -- 0:00:31
504000 -- (-925.769) (-922.834) [-924.532] (-922.611) * [-924.315] (-930.540) (-926.197) (-922.159) -- 0:00:31
504500 -- (-923.017) (-925.257) (-927.727) [-923.143] * (-924.155) (-928.524) [-925.084] (-922.322) -- 0:00:31
505000 -- [-922.992] (-924.388) (-924.507) (-923.862) * (-927.272) [-925.889] (-923.226) (-926.187) -- 0:00:31
Average standard deviation of split frequencies: 0.009523
505500 -- (-924.555) (-925.659) [-922.746] (-924.146) * (-927.683) (-929.180) [-926.074] (-923.933) -- 0:00:31
506000 -- [-922.622] (-923.522) (-922.735) (-925.873) * [-923.603] (-926.060) (-924.462) (-922.969) -- 0:00:32
506500 -- (-922.466) [-921.979] (-922.031) (-923.935) * (-928.707) (-924.045) (-924.492) [-922.122] -- 0:00:32
507000 -- (-925.953) (-922.253) [-924.908] (-922.725) * (-925.659) (-926.112) [-922.470] (-927.972) -- 0:00:32
507500 -- (-924.623) (-922.313) (-922.912) [-927.091] * (-924.802) (-922.963) (-924.577) [-922.482] -- 0:00:32
508000 -- (-927.156) [-923.250] (-922.934) (-923.440) * (-923.832) [-923.974] (-927.740) (-923.528) -- 0:00:31
508500 -- (-924.614) (-926.373) [-926.228] (-925.313) * [-926.153] (-922.404) (-924.372) (-926.885) -- 0:00:31
509000 -- [-923.332] (-923.667) (-923.574) (-924.635) * (-922.057) (-924.931) (-922.449) [-926.309] -- 0:00:31
509500 -- (-924.594) (-922.974) [-925.302] (-923.503) * (-924.306) (-925.315) [-926.426] (-923.622) -- 0:00:31
510000 -- (-922.413) (-923.148) (-928.094) [-922.673] * [-925.635] (-923.098) (-926.501) (-922.261) -- 0:00:31
Average standard deviation of split frequencies: 0.009231
510500 -- (-925.154) [-922.967] (-924.240) (-923.245) * (-928.280) (-926.149) [-925.193] (-923.604) -- 0:00:31
511000 -- (-924.033) (-923.784) (-924.617) [-924.780] * (-926.740) [-922.860] (-925.678) (-923.819) -- 0:00:31
511500 -- [-923.040] (-922.578) (-923.891) (-923.059) * (-926.645) (-925.102) [-923.324] (-935.423) -- 0:00:31
512000 -- (-925.323) (-926.110) (-923.853) [-924.082] * (-927.043) (-923.477) [-924.670] (-926.184) -- 0:00:31
512500 -- (-924.677) [-923.664] (-924.315) (-923.313) * (-922.750) (-924.352) [-923.102] (-925.978) -- 0:00:31
513000 -- [-924.609] (-932.999) (-924.424) (-924.084) * (-929.735) (-925.054) (-923.205) [-925.944] -- 0:00:31
513500 -- (-923.077) [-925.738] (-924.827) (-922.597) * (-923.822) (-926.469) [-922.528] (-929.757) -- 0:00:31
514000 -- (-925.265) (-924.165) (-924.194) [-922.704] * [-926.257] (-924.920) (-924.058) (-926.104) -- 0:00:31
514500 -- (-923.525) (-922.664) [-923.115] (-925.747) * (-925.125) (-922.775) (-922.237) [-922.413] -- 0:00:31
515000 -- (-923.837) [-924.710] (-922.615) (-926.387) * [-926.133] (-923.911) (-924.303) (-922.862) -- 0:00:31
Average standard deviation of split frequencies: 0.008933
515500 -- [-922.513] (-925.407) (-922.686) (-923.980) * [-923.046] (-926.944) (-925.176) (-923.891) -- 0:00:31
516000 -- [-922.548] (-924.110) (-923.943) (-923.511) * (-924.583) (-924.453) (-922.328) [-923.540] -- 0:00:30
516500 -- (-922.538) (-923.574) (-922.616) [-922.816] * [-925.387] (-924.942) (-923.817) (-923.160) -- 0:00:30
517000 -- (-924.391) (-923.677) (-924.274) [-924.088] * [-922.682] (-923.275) (-926.989) (-924.253) -- 0:00:30
517500 -- (-925.833) (-926.047) [-922.231] (-924.231) * [-924.739] (-922.189) (-923.379) (-922.790) -- 0:00:30
518000 -- (-922.492) (-924.920) (-923.464) [-924.358] * (-926.163) (-923.732) [-923.074] (-923.649) -- 0:00:30
518500 -- [-922.709] (-924.118) (-924.185) (-924.683) * [-924.002] (-922.348) (-922.676) (-922.337) -- 0:00:30
519000 -- [-923.290] (-923.598) (-924.706) (-925.064) * (-926.390) (-923.120) [-923.079] (-924.149) -- 0:00:30
519500 -- (-925.475) (-927.138) [-925.132] (-923.455) * (-929.325) (-923.472) (-925.048) [-922.187] -- 0:00:30
520000 -- [-923.036] (-923.194) (-926.351) (-924.930) * (-926.879) (-923.250) (-923.436) [-925.390] -- 0:00:30
Average standard deviation of split frequencies: 0.008894
520500 -- (-923.147) (-923.223) (-925.224) [-923.199] * [-928.936] (-922.565) (-925.114) (-924.177) -- 0:00:30
521000 -- (-923.039) (-924.820) (-925.314) [-923.245] * (-923.182) [-923.417] (-925.115) (-922.716) -- 0:00:30
521500 -- (-921.824) (-927.604) [-922.682] (-924.102) * (-923.844) [-924.026] (-924.927) (-922.116) -- 0:00:30
522000 -- (-925.167) (-924.846) [-922.180] (-924.442) * (-923.113) [-925.997] (-925.195) (-923.114) -- 0:00:30
522500 -- (-924.783) (-924.575) (-923.015) [-922.708] * [-923.544] (-926.484) (-923.291) (-925.841) -- 0:00:31
523000 -- (-925.000) (-924.527) [-924.287] (-922.058) * (-923.718) (-925.246) [-925.710] (-922.649) -- 0:00:31
523500 -- (-923.211) (-923.413) (-923.572) [-922.024] * (-923.244) (-926.772) (-922.544) [-922.665] -- 0:00:30
524000 -- (-924.333) (-922.960) (-922.352) [-923.042] * (-922.590) (-925.007) (-923.643) [-924.787] -- 0:00:30
524500 -- (-924.869) (-923.050) [-926.824] (-921.993) * (-922.797) (-922.542) [-922.798] (-921.964) -- 0:00:30
525000 -- (-923.742) [-928.064] (-926.659) (-924.745) * (-923.721) (-923.786) (-922.254) [-925.184] -- 0:00:30
Average standard deviation of split frequencies: 0.008962
525500 -- (-924.139) (-926.863) [-924.320] (-923.981) * [-922.642] (-923.361) (-923.199) (-928.698) -- 0:00:30
526000 -- (-928.812) (-925.465) (-924.010) [-924.543] * (-923.869) (-921.974) (-924.844) [-922.699] -- 0:00:30
526500 -- [-924.138] (-925.190) (-927.866) (-922.441) * (-925.048) [-923.508] (-924.294) (-922.699) -- 0:00:30
527000 -- (-925.052) [-925.681] (-927.963) (-922.195) * (-923.772) (-923.347) [-922.004] (-923.440) -- 0:00:30
527500 -- (-925.053) (-923.004) (-923.267) [-922.480] * (-923.943) [-926.567] (-927.437) (-923.406) -- 0:00:30
528000 -- [-926.649] (-922.051) (-927.019) (-923.801) * (-925.380) (-922.931) [-925.852] (-923.082) -- 0:00:30
528500 -- (-925.361) (-922.611) (-922.650) [-928.781] * (-923.428) (-924.410) (-925.422) [-924.538] -- 0:00:30
529000 -- (-922.383) (-924.237) (-923.114) [-924.102] * (-923.164) (-924.347) (-924.284) [-929.942] -- 0:00:30
529500 -- (-924.395) (-925.193) (-924.565) [-924.067] * (-924.788) (-924.067) (-925.326) [-923.740] -- 0:00:30
530000 -- (-926.661) [-925.907] (-925.522) (-924.053) * (-926.069) (-925.926) (-930.106) [-923.819] -- 0:00:30
Average standard deviation of split frequencies: 0.008988
530500 -- (-923.410) (-923.574) [-927.898] (-925.511) * [-923.662] (-926.961) (-923.340) (-923.266) -- 0:00:30
531000 -- [-922.944] (-924.177) (-922.788) (-925.862) * (-922.482) (-924.507) (-922.939) [-922.119] -- 0:00:30
531500 -- [-922.774] (-926.381) (-925.266) (-925.733) * (-924.490) (-923.769) (-923.095) [-923.740] -- 0:00:29
532000 -- (-924.709) (-925.216) [-923.012] (-925.893) * (-924.335) [-926.106] (-924.498) (-925.629) -- 0:00:29
532500 -- [-925.474] (-922.347) (-922.878) (-924.208) * [-924.509] (-924.236) (-928.352) (-923.659) -- 0:00:29
533000 -- (-924.390) [-923.164] (-924.073) (-926.735) * (-923.135) (-926.189) [-924.226] (-924.516) -- 0:00:29
533500 -- (-923.428) (-922.774) (-923.352) [-923.033] * (-922.085) [-923.106] (-922.775) (-927.311) -- 0:00:29
534000 -- (-923.588) [-925.534] (-924.761) (-923.369) * (-925.149) [-925.373] (-923.168) (-926.470) -- 0:00:29
534500 -- (-928.161) (-923.745) [-922.978] (-922.897) * (-924.365) [-925.373] (-923.431) (-923.103) -- 0:00:29
535000 -- [-931.398] (-925.132) (-922.484) (-925.843) * [-923.038] (-922.150) (-923.711) (-924.468) -- 0:00:29
Average standard deviation of split frequencies: 0.008551
535500 -- (-923.568) [-923.017] (-923.850) (-925.481) * (-925.787) [-927.302] (-924.995) (-929.910) -- 0:00:29
536000 -- (-923.971) (-923.186) [-921.919] (-927.804) * (-922.515) (-924.056) (-925.366) [-923.573] -- 0:00:29
536500 -- (-922.654) (-927.151) [-925.993] (-926.410) * (-923.098) [-924.313] (-923.491) (-926.729) -- 0:00:29
537000 -- (-925.920) (-924.703) (-924.323) [-924.925] * (-924.912) [-923.569] (-923.625) (-923.164) -- 0:00:29
537500 -- [-922.646] (-926.319) (-924.534) (-922.096) * [-930.219] (-928.769) (-923.827) (-926.068) -- 0:00:29
538000 -- (-926.279) (-923.169) [-928.293] (-923.990) * [-923.332] (-924.679) (-924.316) (-926.934) -- 0:00:29
538500 -- (-926.110) [-922.728] (-923.137) (-923.546) * (-924.696) (-923.363) [-923.518] (-922.740) -- 0:00:29
539000 -- (-923.670) (-923.898) [-923.325] (-923.245) * (-926.641) (-923.821) (-924.872) [-922.594] -- 0:00:29
539500 -- (-925.378) (-925.035) [-924.112] (-921.897) * (-922.944) (-924.231) (-924.419) [-924.763] -- 0:00:29
540000 -- (-926.842) (-925.539) (-929.150) [-922.444] * (-927.919) (-926.755) [-922.243] (-924.482) -- 0:00:29
Average standard deviation of split frequencies: 0.008913
540500 -- [-925.684] (-926.119) (-925.422) (-924.575) * (-925.556) (-930.467) (-923.532) [-922.332] -- 0:00:29
541000 -- (-926.607) (-928.064) (-925.585) [-922.461] * (-924.343) (-925.101) (-923.794) [-923.305] -- 0:00:29
541500 -- (-929.637) (-924.419) (-924.371) [-925.142] * (-927.678) (-923.065) (-922.464) [-924.722] -- 0:00:29
542000 -- (-928.552) (-925.223) (-928.051) [-924.145] * (-926.057) (-922.419) [-927.945] (-924.734) -- 0:00:29
542500 -- (-922.642) (-924.461) (-925.253) [-924.418] * (-925.638) [-922.529] (-923.507) (-926.144) -- 0:00:29
543000 -- (-923.036) (-922.014) [-925.263] (-929.532) * (-923.897) [-923.532] (-925.189) (-924.723) -- 0:00:29
543500 -- (-924.451) (-926.931) [-922.457] (-922.823) * (-926.554) [-923.029] (-923.418) (-926.086) -- 0:00:29
544000 -- (-926.762) [-925.389] (-923.088) (-923.117) * [-923.704] (-924.180) (-925.284) (-923.208) -- 0:00:29
544500 -- (-927.232) (-923.172) (-926.490) [-922.010] * (-923.923) (-924.334) (-924.447) [-923.150] -- 0:00:29
545000 -- (-923.976) (-922.943) [-925.874] (-923.464) * [-923.974] (-923.693) (-926.515) (-924.668) -- 0:00:29
Average standard deviation of split frequencies: 0.009305
545500 -- (-924.550) (-923.233) (-927.571) [-925.549] * (-926.649) (-922.985) (-927.182) [-927.961] -- 0:00:29
546000 -- (-923.247) (-922.170) (-925.987) [-923.574] * (-923.042) (-925.777) (-924.492) [-924.655] -- 0:00:29
546500 -- (-923.352) (-923.238) (-922.676) [-922.816] * (-925.760) [-922.555] (-924.325) (-923.772) -- 0:00:29
547000 -- (-927.057) (-922.315) (-922.542) [-924.721] * (-923.936) [-930.238] (-924.528) (-924.145) -- 0:00:28
547500 -- (-923.426) (-924.151) [-922.544] (-924.125) * (-923.288) (-924.708) (-923.322) [-922.717] -- 0:00:28
548000 -- [-925.531] (-925.250) (-922.461) (-923.011) * (-922.862) (-924.697) (-924.092) [-923.196] -- 0:00:28
548500 -- (-922.913) (-923.634) [-924.208] (-923.229) * (-925.222) [-923.568] (-923.749) (-924.920) -- 0:00:28
549000 -- [-922.799] (-923.327) (-923.883) (-923.916) * (-925.788) [-923.435] (-925.603) (-923.588) -- 0:00:28
549500 -- (-924.438) (-923.517) [-922.941] (-926.647) * [-922.222] (-924.304) (-925.829) (-923.872) -- 0:00:28
550000 -- (-925.417) [-922.005] (-922.446) (-925.226) * (-922.513) (-923.202) [-923.020] (-926.277) -- 0:00:28
Average standard deviation of split frequencies: 0.008661
550500 -- (-923.963) [-922.333] (-924.022) (-927.093) * (-922.833) (-924.768) (-924.947) [-923.662] -- 0:00:28
551000 -- (-924.379) (-923.292) [-925.737] (-923.078) * [-924.951] (-923.109) (-925.910) (-922.394) -- 0:00:28
551500 -- (-924.290) (-923.200) [-924.170] (-923.409) * [-926.388] (-923.958) (-924.005) (-926.947) -- 0:00:28
552000 -- [-926.048] (-925.887) (-927.125) (-922.813) * [-925.815] (-923.047) (-923.082) (-925.043) -- 0:00:28
552500 -- [-925.076] (-929.978) (-922.834) (-924.097) * [-925.181] (-924.557) (-923.650) (-922.817) -- 0:00:28
553000 -- (-925.756) [-924.065] (-924.513) (-929.223) * (-923.106) (-924.773) [-922.355] (-923.934) -- 0:00:28
553500 -- (-923.155) (-924.925) (-923.691) [-921.923] * (-923.618) (-922.902) (-922.361) [-923.361] -- 0:00:28
554000 -- (-925.303) (-931.305) [-923.783] (-923.591) * (-922.676) [-922.329] (-927.946) (-926.321) -- 0:00:28
554500 -- (-924.846) [-925.028] (-925.667) (-924.073) * (-930.419) [-922.742] (-923.404) (-922.219) -- 0:00:28
555000 -- (-928.067) (-924.356) (-925.973) [-925.771] * (-930.971) [-923.410] (-924.480) (-922.483) -- 0:00:28
Average standard deviation of split frequencies: 0.008678
555500 -- (-923.677) [-924.875] (-924.620) (-923.419) * (-923.878) (-924.620) (-926.349) [-922.316] -- 0:00:28
556000 -- [-922.672] (-926.672) (-923.413) (-922.446) * [-925.078] (-923.904) (-926.508) (-922.168) -- 0:00:28
556500 -- (-923.128) (-926.522) [-923.322] (-924.481) * (-922.653) [-926.297] (-926.380) (-923.346) -- 0:00:28
557000 -- [-925.949] (-924.652) (-923.501) (-923.524) * (-922.823) (-922.196) (-924.165) [-923.457] -- 0:00:28
557500 -- (-927.346) (-924.915) (-925.652) [-921.939] * (-922.935) (-922.462) (-922.815) [-923.111] -- 0:00:28
558000 -- [-925.075] (-926.448) (-924.974) (-923.256) * [-925.666] (-924.966) (-922.986) (-925.130) -- 0:00:28
558500 -- (-923.570) [-924.623] (-922.417) (-925.908) * (-924.004) (-924.038) [-923.228] (-923.182) -- 0:00:28
559000 -- (-925.011) (-923.938) (-923.236) [-923.220] * (-924.857) (-925.904) (-927.144) [-925.007] -- 0:00:28
559500 -- [-924.597] (-925.468) (-926.344) (-927.362) * (-925.084) (-927.172) [-926.865] (-927.223) -- 0:00:28
560000 -- (-922.021) (-923.404) (-923.791) [-923.119] * (-925.390) [-928.337] (-925.016) (-922.746) -- 0:00:28
Average standard deviation of split frequencies: 0.008754
560500 -- (-924.446) (-925.684) (-922.773) [-923.882] * (-924.890) (-925.033) [-923.480] (-923.112) -- 0:00:28
561000 -- (-922.868) (-924.684) (-924.766) [-924.756] * (-926.762) [-929.838] (-926.201) (-922.344) -- 0:00:28
561500 -- (-924.071) (-923.394) [-924.493] (-926.073) * (-925.536) (-928.276) [-922.997] (-923.752) -- 0:00:28
562000 -- (-924.955) (-923.433) [-923.296] (-924.049) * (-922.325) (-929.895) (-924.744) [-924.013] -- 0:00:28
562500 -- [-924.460] (-931.853) (-928.294) (-922.036) * (-923.480) (-922.806) (-929.995) [-924.803] -- 0:00:28
563000 -- (-928.055) (-926.063) (-925.949) [-922.854] * (-925.955) [-922.761] (-923.731) (-925.828) -- 0:00:27
563500 -- (-924.078) (-925.260) [-929.580] (-926.208) * (-923.586) [-929.036] (-926.416) (-926.037) -- 0:00:27
564000 -- (-922.418) [-924.387] (-922.580) (-922.282) * (-923.442) [-923.763] (-926.454) (-926.663) -- 0:00:27
564500 -- (-924.035) (-923.848) (-927.696) [-922.803] * (-922.180) (-924.246) [-926.280] (-926.513) -- 0:00:27
565000 -- (-925.136) [-922.594] (-923.205) (-923.130) * (-923.468) [-924.070] (-926.819) (-925.209) -- 0:00:27
Average standard deviation of split frequencies: 0.008819
565500 -- (-925.402) (-924.408) (-928.087) [-925.390] * (-922.668) (-924.263) [-924.055] (-924.902) -- 0:00:27
566000 -- (-923.466) [-923.708] (-926.335) (-926.065) * (-922.576) [-923.381] (-925.410) (-924.366) -- 0:00:27
566500 -- (-925.034) (-923.857) (-923.134) [-924.334] * (-922.937) [-922.304] (-923.787) (-923.472) -- 0:00:27
567000 -- (-927.906) (-924.576) (-926.672) [-922.428] * [-923.828] (-923.028) (-922.575) (-926.972) -- 0:00:27
567500 -- (-928.908) (-927.452) (-922.463) [-922.930] * (-924.376) [-922.383] (-922.560) (-923.321) -- 0:00:27
568000 -- (-925.045) (-923.174) (-922.309) [-923.563] * (-929.517) (-922.465) [-924.772] (-924.900) -- 0:00:27
568500 -- [-923.062] (-923.903) (-923.948) (-926.039) * (-930.449) (-927.506) (-923.575) [-922.347] -- 0:00:27
569000 -- (-922.952) (-923.903) (-923.712) [-926.548] * [-923.331] (-923.752) (-922.329) (-923.118) -- 0:00:27
569500 -- (-922.939) (-924.704) (-922.548) [-924.275] * (-922.066) [-922.161] (-922.802) (-923.020) -- 0:00:27
570000 -- [-922.473] (-924.300) (-923.536) (-926.399) * (-923.099) (-923.623) [-924.275] (-924.466) -- 0:00:27
Average standard deviation of split frequencies: 0.008261
570500 -- (-924.285) (-922.753) (-923.969) [-923.240] * (-927.754) (-923.254) (-927.250) [-922.767] -- 0:00:27
571000 -- (-924.027) (-923.548) [-923.200] (-927.138) * [-926.855] (-923.483) (-923.836) (-924.937) -- 0:00:27
571500 -- (-925.121) [-923.452] (-925.716) (-924.832) * (-926.415) (-922.857) (-923.742) [-922.331] -- 0:00:26
572000 -- (-927.848) (-924.150) [-921.946] (-929.105) * (-926.352) (-923.447) [-923.382] (-923.095) -- 0:00:27
572500 -- (-923.857) (-924.983) (-926.386) [-925.027] * (-923.342) [-927.935] (-924.808) (-923.249) -- 0:00:27
573000 -- [-922.738] (-923.505) (-923.158) (-927.893) * (-923.630) (-927.332) [-922.866] (-923.358) -- 0:00:27
573500 -- (-925.373) [-922.535] (-924.103) (-922.793) * (-927.782) (-926.517) [-923.443] (-923.699) -- 0:00:27
574000 -- (-923.509) (-923.561) (-923.433) [-922.129] * [-928.168] (-924.194) (-923.732) (-924.185) -- 0:00:27
574500 -- [-922.673] (-924.032) (-922.109) (-922.906) * (-926.157) (-923.614) [-924.395] (-926.781) -- 0:00:27
575000 -- [-922.671] (-923.984) (-922.576) (-922.207) * (-923.592) [-924.595] (-922.021) (-923.203) -- 0:00:27
Average standard deviation of split frequencies: 0.008232
575500 -- (-922.710) (-925.074) [-924.827] (-922.816) * (-925.767) (-923.487) [-921.989] (-925.165) -- 0:00:27
576000 -- (-922.702) (-924.781) (-926.530) [-922.969] * (-927.141) (-926.550) [-923.451] (-922.689) -- 0:00:27
576500 -- [-923.218] (-922.773) (-922.859) (-924.769) * (-926.628) (-921.799) [-923.251] (-922.382) -- 0:00:27
577000 -- (-923.030) (-923.114) (-926.338) [-924.118] * (-924.929) (-922.830) [-923.625] (-927.852) -- 0:00:27
577500 -- (-924.057) [-923.011] (-925.676) (-922.880) * (-927.340) [-923.059] (-925.322) (-924.112) -- 0:00:27
578000 -- (-925.077) [-926.517] (-927.363) (-922.520) * (-923.342) (-922.813) (-923.424) [-922.857] -- 0:00:27
578500 -- (-924.244) (-923.279) [-927.489] (-922.685) * (-926.644) (-924.203) [-922.585] (-923.106) -- 0:00:26
579000 -- (-923.846) (-924.029) (-923.405) [-923.405] * [-924.554] (-923.600) (-922.542) (-927.778) -- 0:00:26
579500 -- (-925.386) [-924.324] (-922.451) (-923.862) * (-923.947) [-924.115] (-922.328) (-924.079) -- 0:00:26
580000 -- (-923.318) (-926.698) (-924.870) [-925.677] * (-924.042) (-925.835) (-925.944) [-923.445] -- 0:00:26
Average standard deviation of split frequencies: 0.007020
580500 -- (-928.933) (-926.719) [-924.736] (-926.052) * [-925.286] (-926.103) (-925.259) (-926.380) -- 0:00:26
581000 -- [-926.912] (-923.495) (-930.792) (-925.596) * [-922.565] (-925.159) (-922.923) (-925.521) -- 0:00:26
581500 -- (-925.776) (-922.587) [-928.006] (-925.136) * (-923.984) [-924.684] (-926.698) (-923.560) -- 0:00:26
582000 -- (-932.457) (-922.972) [-926.921] (-925.867) * (-926.847) (-923.813) [-923.288] (-923.457) -- 0:00:26
582500 -- (-924.098) [-923.298] (-931.063) (-922.455) * (-927.092) [-923.921] (-923.864) (-922.525) -- 0:00:26
583000 -- (-922.737) (-924.304) (-923.199) [-925.257] * (-923.694) (-924.169) (-923.351) [-922.766] -- 0:00:26
583500 -- (-924.893) (-924.513) [-925.251] (-924.793) * (-923.336) [-922.474] (-923.644) (-922.123) -- 0:00:26
584000 -- (-924.919) [-923.276] (-927.506) (-926.653) * (-924.113) [-922.762] (-922.895) (-926.294) -- 0:00:26
584500 -- (-926.112) [-923.730] (-925.111) (-924.102) * (-924.578) (-924.892) (-926.095) [-925.570] -- 0:00:26
585000 -- [-923.745] (-923.649) (-925.670) (-922.953) * (-925.448) (-923.233) (-925.490) [-924.655] -- 0:00:26
Average standard deviation of split frequencies: 0.006578
585500 -- (-926.903) (-923.209) [-924.402] (-924.853) * (-927.815) (-924.572) (-923.352) [-925.285] -- 0:00:26
586000 -- (-923.142) (-923.191) (-922.939) [-923.826] * [-922.883] (-924.275) (-924.306) (-926.447) -- 0:00:26
586500 -- (-924.646) [-930.071] (-924.085) (-922.637) * (-924.543) (-925.004) (-923.509) [-925.833] -- 0:00:26
587000 -- (-922.106) (-929.376) (-924.408) [-922.478] * (-925.531) [-923.106] (-922.819) (-927.211) -- 0:00:26
587500 -- (-922.053) (-932.211) [-926.802] (-928.869) * (-924.397) [-923.034] (-923.659) (-923.343) -- 0:00:25
588000 -- (-926.006) [-929.364] (-924.774) (-925.050) * [-922.633] (-924.624) (-923.294) (-927.425) -- 0:00:25
588500 -- (-924.910) [-925.556] (-927.917) (-922.712) * [-923.233] (-923.403) (-926.646) (-926.675) -- 0:00:26
589000 -- [-923.706] (-923.714) (-929.452) (-922.136) * (-922.486) (-922.436) (-922.656) [-924.483] -- 0:00:26
589500 -- (-926.404) [-924.091] (-925.913) (-923.314) * (-923.035) [-925.827] (-925.156) (-923.548) -- 0:00:26
590000 -- [-924.245] (-924.398) (-922.254) (-923.448) * (-922.461) (-926.299) [-922.954] (-923.621) -- 0:00:26
Average standard deviation of split frequencies: 0.006619
590500 -- (-923.290) (-926.126) (-923.472) [-924.663] * [-922.268] (-923.718) (-927.311) (-924.799) -- 0:00:26
591000 -- [-924.538] (-927.143) (-926.960) (-928.623) * (-922.375) [-924.448] (-925.532) (-924.580) -- 0:00:26
591500 -- (-925.958) [-925.341] (-922.755) (-926.252) * [-924.366] (-926.364) (-928.002) (-925.332) -- 0:00:26
592000 -- (-924.532) (-929.814) (-925.344) [-924.299] * (-921.741) (-923.618) (-926.638) [-925.723] -- 0:00:26
592500 -- (-928.609) (-928.937) [-927.452] (-924.256) * (-927.716) (-923.211) (-924.742) [-925.949] -- 0:00:26
593000 -- (-923.086) [-923.723] (-922.917) (-924.602) * [-923.881] (-923.093) (-923.915) (-925.208) -- 0:00:26
593500 -- (-924.260) (-927.720) (-924.375) [-923.373] * (-924.369) [-922.473] (-925.603) (-923.250) -- 0:00:26
594000 -- [-923.236] (-925.989) (-924.681) (-923.676) * (-922.280) [-925.093] (-922.429) (-926.816) -- 0:00:25
594500 -- (-926.648) (-923.978) [-922.686] (-923.532) * (-922.110) (-924.866) [-928.450] (-924.076) -- 0:00:25
595000 -- (-926.615) [-922.571] (-924.675) (-923.655) * (-925.242) (-922.819) [-925.550] (-924.211) -- 0:00:25
Average standard deviation of split frequencies: 0.006653
595500 -- (-925.357) [-924.742] (-925.007) (-923.760) * (-923.467) (-928.702) (-922.756) [-924.433] -- 0:00:25
596000 -- (-925.219) (-924.260) (-924.145) [-922.368] * (-923.188) (-924.437) [-925.261] (-922.980) -- 0:00:25
596500 -- (-923.342) (-923.318) (-922.775) [-922.609] * [-922.342] (-923.571) (-924.275) (-923.464) -- 0:00:25
597000 -- (-925.756) (-924.637) [-923.203] (-922.911) * [-922.458] (-924.202) (-922.625) (-929.763) -- 0:00:25
597500 -- (-923.997) (-922.666) [-923.777] (-923.663) * (-922.606) [-923.053] (-924.964) (-925.344) -- 0:00:25
598000 -- [-924.356] (-924.819) (-923.023) (-922.137) * (-924.093) (-922.207) [-927.108] (-923.714) -- 0:00:25
598500 -- (-923.702) (-922.910) (-923.023) [-926.031] * [-922.447] (-922.385) (-924.509) (-924.191) -- 0:00:25
599000 -- [-925.987] (-926.890) (-923.094) (-924.880) * (-922.465) [-922.114] (-923.164) (-923.952) -- 0:00:25
599500 -- [-924.336] (-930.544) (-923.078) (-923.456) * [-922.043] (-922.339) (-924.655) (-923.626) -- 0:00:25
600000 -- (-923.082) (-929.060) [-922.989] (-924.751) * (-922.530) (-922.264) [-928.678] (-922.362) -- 0:00:25
Average standard deviation of split frequencies: 0.006602
600500 -- (-923.828) [-923.380] (-925.380) (-930.647) * (-922.397) (-922.338) (-926.203) [-923.163] -- 0:00:25
601000 -- (-922.750) (-923.802) (-924.704) [-922.966] * [-925.057] (-922.916) (-922.712) (-924.529) -- 0:00:25
601500 -- (-922.860) (-922.938) (-923.360) [-923.539] * (-925.894) (-925.715) (-924.840) [-922.834] -- 0:00:25
602000 -- (-924.659) (-926.330) (-924.552) [-926.311] * [-922.992] (-922.927) (-924.847) (-923.325) -- 0:00:25
602500 -- (-924.788) [-923.288] (-925.599) (-924.004) * (-923.621) (-923.911) [-925.077] (-922.882) -- 0:00:25
603000 -- (-930.216) (-922.112) (-924.882) [-924.669] * (-925.051) [-922.932] (-924.026) (-924.794) -- 0:00:25
603500 -- (-927.924) (-923.055) (-924.105) [-924.946] * (-928.751) (-923.631) [-922.882] (-927.411) -- 0:00:24
604000 -- (-932.624) (-924.673) [-923.684] (-925.501) * [-927.199] (-923.867) (-924.679) (-921.757) -- 0:00:24
604500 -- (-930.020) [-922.496] (-928.278) (-923.876) * (-922.774) (-923.176) (-924.134) [-922.284] -- 0:00:24
605000 -- (-928.302) (-923.119) [-926.681] (-922.988) * (-926.325) [-923.130] (-922.776) (-925.068) -- 0:00:25
Average standard deviation of split frequencies: 0.006818
605500 -- (-923.844) [-926.491] (-923.817) (-923.488) * (-923.487) (-922.901) (-923.075) [-923.315] -- 0:00:25
606000 -- (-927.719) [-924.572] (-922.460) (-925.287) * (-930.409) (-923.254) (-924.533) [-922.573] -- 0:00:25
606500 -- (-925.067) (-926.293) (-924.726) [-923.213] * (-925.170) (-925.380) [-924.126] (-922.621) -- 0:00:25
607000 -- (-927.779) (-923.256) [-922.597] (-925.652) * (-925.072) [-922.597] (-923.200) (-923.952) -- 0:00:25
607500 -- (-925.216) [-927.008] (-922.846) (-922.524) * (-925.106) (-927.560) (-922.787) [-923.914] -- 0:00:25
608000 -- (-927.434) (-926.410) [-922.460] (-922.583) * (-923.204) (-926.919) (-922.260) [-923.130] -- 0:00:25
608500 -- (-926.339) (-930.129) [-923.791] (-921.973) * (-924.393) [-923.494] (-927.044) (-924.442) -- 0:00:25
609000 -- (-925.729) (-925.699) (-923.156) [-921.850] * (-927.333) [-923.398] (-926.357) (-925.877) -- 0:00:25
609500 -- (-922.256) [-924.886] (-922.766) (-924.888) * (-930.276) [-923.621] (-927.470) (-926.612) -- 0:00:24
610000 -- (-923.355) [-922.896] (-922.093) (-923.769) * (-926.484) [-922.580] (-924.407) (-928.847) -- 0:00:24
Average standard deviation of split frequencies: 0.006990
610500 -- [-924.180] (-930.063) (-922.221) (-921.940) * (-926.946) (-923.864) [-922.206] (-924.783) -- 0:00:24
611000 -- [-922.774] (-929.369) (-924.304) (-923.762) * [-923.640] (-923.416) (-922.965) (-923.466) -- 0:00:24
611500 -- (-923.650) (-924.199) [-928.725] (-924.965) * (-922.017) (-922.828) (-924.573) [-923.729] -- 0:00:24
612000 -- (-923.328) (-922.823) (-928.558) [-926.737] * (-921.999) (-927.582) [-924.021] (-924.803) -- 0:00:24
612500 -- (-925.637) [-923.910] (-922.863) (-922.815) * [-925.181] (-923.836) (-924.002) (-923.855) -- 0:00:24
613000 -- (-921.882) (-923.025) (-924.836) [-924.464] * (-924.325) (-924.515) (-924.886) [-924.366] -- 0:00:24
613500 -- (-921.882) [-922.587] (-922.681) (-922.046) * (-925.528) [-923.938] (-926.131) (-924.717) -- 0:00:24
614000 -- (-923.477) [-932.035] (-923.894) (-924.353) * (-924.148) (-924.405) (-926.236) [-923.918] -- 0:00:24
614500 -- (-923.929) [-922.315] (-923.951) (-922.547) * [-924.362] (-935.660) (-925.477) (-926.600) -- 0:00:24
615000 -- (-925.605) (-922.254) [-922.920] (-924.034) * [-923.422] (-924.153) (-923.132) (-926.950) -- 0:00:24
Average standard deviation of split frequencies: 0.007313
615500 -- (-926.717) (-924.277) (-922.216) [-925.567] * [-923.182] (-922.917) (-923.098) (-930.941) -- 0:00:24
616000 -- (-925.376) [-925.345] (-924.126) (-925.936) * [-923.220] (-925.352) (-923.449) (-925.762) -- 0:00:24
616500 -- [-924.038] (-926.518) (-923.104) (-925.090) * (-924.165) (-927.547) (-925.361) [-925.524] -- 0:00:24
617000 -- (-924.588) (-927.863) (-922.847) [-924.060] * (-926.160) [-928.736] (-925.043) (-923.288) -- 0:00:24
617500 -- (-923.834) (-922.497) [-924.197] (-923.299) * (-924.890) (-923.897) [-925.508] (-927.922) -- 0:00:24
618000 -- (-926.114) (-923.481) [-926.058] (-923.299) * (-923.492) (-924.661) [-925.225] (-929.117) -- 0:00:24
618500 -- [-923.531] (-922.633) (-926.078) (-922.982) * [-924.986] (-923.492) (-925.001) (-924.683) -- 0:00:24
619000 -- [-925.562] (-927.820) (-924.758) (-923.475) * (-926.468) [-922.736] (-922.252) (-925.407) -- 0:00:24
619500 -- (-923.893) [-923.290] (-922.368) (-924.849) * (-923.650) (-926.011) [-929.287] (-924.048) -- 0:00:23
620000 -- (-924.209) [-923.133] (-925.052) (-923.941) * (-926.895) [-923.445] (-924.079) (-925.976) -- 0:00:23
Average standard deviation of split frequencies: 0.007469
620500 -- (-924.960) [-922.181] (-923.365) (-922.603) * (-922.813) [-922.042] (-924.139) (-925.400) -- 0:00:23
621000 -- (-924.092) [-924.823] (-924.709) (-924.703) * (-925.397) (-922.387) (-927.433) [-926.430] -- 0:00:23
621500 -- (-922.907) (-925.397) [-924.717] (-927.219) * (-921.980) (-922.630) [-923.642] (-926.770) -- 0:00:23
622000 -- [-922.644] (-924.812) (-932.217) (-926.562) * (-923.671) [-924.196] (-925.414) (-925.726) -- 0:00:24
622500 -- [-923.719] (-925.202) (-924.795) (-924.904) * (-922.715) [-923.643] (-925.768) (-925.150) -- 0:00:24
623000 -- [-924.034] (-924.731) (-923.921) (-925.859) * [-922.747] (-924.729) (-924.735) (-926.564) -- 0:00:24
623500 -- (-922.796) (-924.779) (-922.413) [-925.446] * (-923.115) (-924.594) (-923.466) [-923.885] -- 0:00:24
624000 -- [-925.786] (-925.466) (-924.322) (-922.238) * (-924.355) (-924.266) (-922.999) [-925.204] -- 0:00:24
624500 -- (-924.045) (-922.894) (-926.667) [-922.153] * (-925.386) (-925.979) (-922.820) [-925.883] -- 0:00:24
625000 -- [-922.030] (-924.317) (-923.158) (-922.329) * [-922.640] (-926.357) (-923.253) (-924.251) -- 0:00:24
Average standard deviation of split frequencies: 0.007363
625500 -- (-927.273) (-927.283) (-924.771) [-922.975] * (-924.418) [-922.692] (-922.115) (-923.435) -- 0:00:23
626000 -- (-927.909) (-924.453) [-924.335] (-922.692) * (-928.667) (-923.388) [-923.159] (-922.156) -- 0:00:23
626500 -- (-927.730) (-924.343) (-923.215) [-922.832] * [-925.542] (-922.807) (-924.085) (-922.734) -- 0:00:23
627000 -- (-922.771) (-923.056) (-922.998) [-923.362] * (-924.985) [-923.792] (-923.647) (-924.011) -- 0:00:23
627500 -- (-922.681) (-924.070) (-923.433) [-923.694] * (-928.916) [-922.631] (-927.613) (-922.393) -- 0:00:23
628000 -- (-925.719) [-922.289] (-923.080) (-922.812) * [-922.276] (-925.991) (-922.485) (-922.582) -- 0:00:23
628500 -- (-925.423) [-925.617] (-923.786) (-925.945) * (-922.314) [-924.586] (-924.041) (-923.153) -- 0:00:23
629000 -- (-924.483) (-931.992) [-923.361] (-928.622) * (-925.686) (-925.877) [-922.872] (-921.917) -- 0:00:23
629500 -- (-923.358) (-923.541) [-926.814] (-928.385) * (-921.938) (-924.195) [-924.272] (-921.917) -- 0:00:23
630000 -- [-927.483] (-926.207) (-925.041) (-925.088) * [-923.076] (-923.006) (-924.579) (-922.621) -- 0:00:23
Average standard deviation of split frequencies: 0.007255
630500 -- [-924.790] (-924.780) (-923.187) (-930.550) * (-927.437) (-924.882) (-922.735) [-924.862] -- 0:00:23
631000 -- [-922.727] (-922.501) (-922.556) (-924.790) * (-925.172) (-922.556) (-922.357) [-923.252] -- 0:00:23
631500 -- (-922.558) (-922.704) (-924.833) [-924.655] * (-924.124) [-925.225] (-925.310) (-923.649) -- 0:00:23
632000 -- (-926.591) [-923.527] (-924.579) (-927.229) * (-925.035) [-922.989] (-926.337) (-922.698) -- 0:00:23
632500 -- (-924.635) (-924.095) [-925.222] (-925.535) * (-924.543) [-929.219] (-929.209) (-924.442) -- 0:00:23
633000 -- (-922.937) (-925.375) (-924.696) [-924.216] * [-923.489] (-923.622) (-922.758) (-925.562) -- 0:00:23
633500 -- (-922.350) (-922.951) [-922.370] (-923.165) * (-923.173) [-924.553] (-925.055) (-926.845) -- 0:00:23
634000 -- (-925.081) [-923.473] (-923.344) (-923.089) * (-925.340) [-923.986] (-924.866) (-923.158) -- 0:00:23
634500 -- (-929.339) (-927.409) [-924.618] (-925.356) * (-924.281) (-925.314) [-921.937] (-926.321) -- 0:00:23
635000 -- [-925.707] (-924.256) (-925.759) (-925.356) * (-922.764) (-924.992) (-922.605) [-923.429] -- 0:00:22
Average standard deviation of split frequencies: 0.007150
635500 -- [-926.241] (-923.692) (-923.046) (-923.957) * (-922.516) (-923.856) [-924.089] (-922.304) -- 0:00:22
636000 -- (-928.468) (-922.849) [-923.678] (-925.225) * (-924.939) (-922.387) [-923.271] (-924.961) -- 0:00:22
636500 -- (-925.156) (-923.187) (-925.153) [-924.735] * [-923.167] (-922.835) (-925.536) (-922.674) -- 0:00:22
637000 -- (-925.465) (-925.927) [-925.110] (-923.466) * [-924.876] (-924.066) (-925.916) (-923.739) -- 0:00:22
637500 -- (-924.682) [-922.525] (-924.551) (-924.664) * (-922.127) (-924.184) (-922.650) [-927.763] -- 0:00:22
638000 -- (-923.504) (-922.531) [-924.269] (-924.086) * (-921.898) (-928.484) (-927.053) [-921.976] -- 0:00:22
638500 -- [-923.257] (-924.341) (-927.336) (-927.543) * (-922.953) (-923.390) (-922.848) [-924.887] -- 0:00:23
639000 -- (-924.227) (-924.999) (-925.037) [-924.608] * [-922.718] (-923.923) (-922.887) (-923.840) -- 0:00:23
639500 -- (-924.406) (-925.935) [-925.751] (-925.053) * (-923.981) (-923.364) [-922.116] (-922.514) -- 0:00:23
640000 -- (-925.812) [-923.661] (-928.183) (-924.361) * (-926.587) [-924.075] (-924.133) (-923.631) -- 0:00:23
Average standard deviation of split frequencies: 0.006968
640500 -- [-922.285] (-926.891) (-926.554) (-923.240) * (-924.010) (-923.461) [-923.106] (-923.076) -- 0:00:23
641000 -- [-922.738] (-927.247) (-922.061) (-923.161) * (-924.098) (-923.461) [-923.191] (-925.556) -- 0:00:22
641500 -- (-922.065) (-924.384) [-924.135] (-921.968) * (-925.034) (-923.911) (-922.587) [-923.144] -- 0:00:22
642000 -- (-922.096) (-924.210) [-922.754] (-922.004) * (-924.919) [-922.298] (-922.363) (-923.564) -- 0:00:22
642500 -- (-923.825) (-928.927) [-922.213] (-924.638) * [-925.586] (-922.384) (-923.047) (-925.912) -- 0:00:22
643000 -- [-924.867] (-927.071) (-927.086) (-922.507) * [-923.580] (-922.308) (-929.845) (-924.324) -- 0:00:22
643500 -- (-927.427) [-924.068] (-931.105) (-922.255) * [-923.060] (-923.422) (-923.103) (-923.500) -- 0:00:22
644000 -- (-924.217) [-927.664] (-926.911) (-923.853) * (-922.813) (-922.773) [-923.756] (-923.474) -- 0:00:22
644500 -- (-922.706) [-926.922] (-923.659) (-924.733) * (-924.247) (-929.859) (-924.882) [-926.536] -- 0:00:22
645000 -- [-924.185] (-925.682) (-922.282) (-923.060) * (-922.905) (-924.162) [-922.541] (-923.690) -- 0:00:22
Average standard deviation of split frequencies: 0.006954
645500 -- [-925.193] (-926.288) (-923.755) (-922.328) * (-922.682) (-926.771) [-923.401] (-925.462) -- 0:00:22
646000 -- (-922.555) (-923.697) (-922.530) [-927.486] * (-922.871) (-928.180) (-923.540) [-923.734] -- 0:00:22
646500 -- [-926.039] (-923.409) (-922.484) (-924.765) * (-925.103) (-922.876) (-923.739) [-923.172] -- 0:00:22
647000 -- (-926.395) (-924.800) (-925.001) [-924.230] * [-922.664] (-923.094) (-922.611) (-922.131) -- 0:00:22
647500 -- (-928.677) (-924.136) [-926.442] (-924.146) * (-927.665) [-922.054] (-930.935) (-922.835) -- 0:00:22
648000 -- (-925.820) (-924.684) (-924.742) [-922.877] * [-923.539] (-924.708) (-923.874) (-924.594) -- 0:00:22
648500 -- (-924.105) [-923.267] (-926.226) (-922.790) * (-925.566) (-926.674) (-923.550) [-923.326] -- 0:00:22
649000 -- (-923.151) (-923.851) [-923.086] (-925.412) * (-926.520) [-923.301] (-923.103) (-923.347) -- 0:00:22
649500 -- (-928.266) [-923.645] (-923.086) (-928.731) * (-924.085) [-922.968] (-922.350) (-927.944) -- 0:00:22
650000 -- (-924.389) (-925.343) (-925.914) [-926.658] * (-924.415) [-924.183] (-922.489) (-927.085) -- 0:00:22
Average standard deviation of split frequencies: 0.007202
650500 -- (-923.535) (-931.890) (-925.396) [-923.021] * (-926.441) (-924.906) (-925.903) [-925.520] -- 0:00:22
651000 -- (-923.553) (-927.543) [-923.358] (-924.685) * (-923.662) (-924.214) (-921.861) [-923.578] -- 0:00:21
651500 -- (-924.353) (-925.238) (-928.923) [-924.876] * [-923.468] (-926.390) (-922.063) (-928.869) -- 0:00:21
652000 -- (-924.157) [-923.783] (-930.439) (-924.673) * (-923.160) [-925.205] (-922.685) (-927.239) -- 0:00:21
652500 -- (-931.355) (-924.902) [-922.773] (-926.782) * (-922.975) (-923.676) [-924.097] (-926.413) -- 0:00:21
653000 -- [-924.961] (-928.382) (-924.920) (-923.275) * [-927.236] (-923.307) (-925.243) (-926.437) -- 0:00:21
653500 -- (-929.518) (-925.988) (-924.913) [-922.718] * (-927.816) [-923.506] (-925.089) (-925.411) -- 0:00:21
654000 -- (-927.104) [-926.914] (-924.050) (-924.205) * [-923.736] (-925.666) (-925.725) (-925.757) -- 0:00:21
654500 -- (-924.505) (-924.307) [-924.431] (-923.983) * (-923.184) [-922.661] (-925.589) (-926.221) -- 0:00:21
655000 -- [-924.377] (-923.735) (-927.075) (-922.399) * [-923.358] (-924.636) (-922.325) (-924.423) -- 0:00:22
Average standard deviation of split frequencies: 0.007186
655500 -- [-923.338] (-933.709) (-924.466) (-924.774) * [-925.878] (-924.394) (-923.105) (-929.354) -- 0:00:22
656000 -- [-923.366] (-922.781) (-923.813) (-926.373) * [-926.877] (-926.124) (-924.052) (-928.046) -- 0:00:22
656500 -- (-924.944) (-925.587) [-923.354] (-923.341) * (-928.469) [-924.961] (-925.219) (-926.788) -- 0:00:21
657000 -- (-922.466) [-927.175] (-925.364) (-922.148) * (-926.541) (-929.758) [-922.620] (-924.895) -- 0:00:21
657500 -- (-925.003) [-925.969] (-923.956) (-926.788) * [-923.678] (-922.723) (-922.394) (-926.377) -- 0:00:21
658000 -- [-923.663] (-924.583) (-925.511) (-922.260) * (-924.027) (-923.555) (-926.122) [-924.138] -- 0:00:21
658500 -- (-923.546) [-924.867] (-923.899) (-922.518) * (-923.955) (-924.259) (-925.797) [-923.676] -- 0:00:21
659000 -- (-923.533) (-925.868) (-924.339) [-922.393] * (-923.201) [-923.299] (-925.431) (-922.346) -- 0:00:21
659500 -- (-923.162) [-929.072] (-926.232) (-925.665) * (-927.435) (-923.018) (-925.524) [-922.285] -- 0:00:21
660000 -- (-923.118) (-928.572) [-923.295] (-928.092) * (-923.320) (-929.974) (-926.244) [-924.614] -- 0:00:21
Average standard deviation of split frequencies: 0.007345
660500 -- (-925.299) (-925.197) [-924.929] (-923.003) * (-923.442) (-922.044) (-928.790) [-923.636] -- 0:00:21
661000 -- (-931.458) (-923.901) (-924.837) [-925.590] * (-925.292) [-922.271] (-923.713) (-923.103) -- 0:00:21
661500 -- (-929.189) [-924.490] (-924.191) (-929.858) * (-925.620) [-924.961] (-923.359) (-927.151) -- 0:00:21
662000 -- (-925.023) (-929.886) [-922.506] (-923.722) * [-923.645] (-927.956) (-924.207) (-923.920) -- 0:00:21
662500 -- (-931.347) (-923.570) (-923.023) [-923.444] * (-924.834) (-926.667) [-925.074] (-925.955) -- 0:00:21
663000 -- (-928.018) (-924.583) (-923.465) [-925.046] * (-923.086) (-925.518) (-924.448) [-924.686] -- 0:00:21
663500 -- [-926.260] (-923.795) (-925.029) (-926.310) * (-925.018) (-924.400) [-925.142] (-922.743) -- 0:00:21
664000 -- (-928.000) (-924.332) (-926.997) [-924.007] * (-923.781) (-924.419) [-926.366] (-923.562) -- 0:00:21
664500 -- (-924.983) [-923.030] (-926.492) (-924.146) * (-922.437) (-922.591) [-923.229] (-922.244) -- 0:00:21
665000 -- (-925.351) (-925.096) (-926.410) [-923.929] * (-924.346) (-923.347) [-922.141] (-923.106) -- 0:00:21
Average standard deviation of split frequencies: 0.007578
665500 -- (-925.959) [-923.439] (-928.680) (-923.245) * (-922.913) (-924.031) [-923.808] (-933.759) -- 0:00:21
666000 -- (-923.318) [-923.849] (-925.169) (-922.199) * [-923.866] (-924.259) (-925.536) (-925.922) -- 0:00:21
666500 -- (-922.805) (-924.585) (-926.588) [-924.397] * (-923.385) (-925.484) [-923.493] (-924.835) -- 0:00:21
667000 -- [-930.008] (-923.493) (-922.404) (-923.024) * (-926.965) [-924.861] (-924.082) (-925.275) -- 0:00:20
667500 -- (-926.253) [-922.449] (-923.768) (-925.765) * [-924.700] (-924.510) (-923.319) (-925.619) -- 0:00:20
668000 -- [-925.420] (-926.517) (-924.878) (-927.844) * (-922.489) [-922.278] (-924.961) (-923.983) -- 0:00:20
668500 -- (-924.290) [-925.551] (-927.247) (-924.254) * [-922.670] (-926.252) (-925.431) (-923.227) -- 0:00:20
669000 -- (-923.211) (-925.338) [-923.301] (-929.063) * (-922.793) (-923.665) [-925.320] (-922.760) -- 0:00:20
669500 -- (-924.608) (-925.052) (-926.299) [-923.404] * (-923.429) [-923.458] (-925.446) (-923.400) -- 0:00:20
670000 -- (-924.366) (-924.630) [-924.329] (-924.462) * (-922.145) (-925.666) (-927.563) [-922.283] -- 0:00:20
Average standard deviation of split frequencies: 0.007773
670500 -- [-925.730] (-924.907) (-922.926) (-924.223) * (-924.384) (-927.877) (-927.740) [-924.504] -- 0:00:20
671000 -- (-927.371) (-923.785) (-925.870) [-921.976] * (-923.911) [-928.069] (-924.233) (-922.548) -- 0:00:20
671500 -- (-922.343) [-923.057] (-925.917) (-922.021) * (-928.676) [-926.139] (-921.960) (-922.516) -- 0:00:21
672000 -- (-923.914) [-924.177] (-924.202) (-922.021) * [-923.020] (-923.508) (-924.195) (-922.606) -- 0:00:20
672500 -- (-928.399) (-923.953) [-926.112] (-929.765) * (-923.334) (-922.628) [-923.318] (-922.330) -- 0:00:20
673000 -- (-924.229) [-925.185] (-924.835) (-925.929) * (-928.912) [-923.837] (-924.585) (-923.047) -- 0:00:20
673500 -- (-922.835) (-923.403) [-924.387] (-923.235) * (-922.394) (-926.168) (-926.484) [-923.939] -- 0:00:20
674000 -- (-922.688) (-923.475) [-922.330] (-922.315) * (-922.068) [-924.567] (-926.718) (-924.701) -- 0:00:20
674500 -- (-922.173) (-922.486) (-923.418) [-925.376] * (-923.964) (-923.369) [-925.194] (-924.813) -- 0:00:20
675000 -- (-922.812) (-922.161) (-922.213) [-923.191] * (-926.903) (-924.414) (-923.687) [-924.741] -- 0:00:20
Average standard deviation of split frequencies: 0.007835
675500 -- (-922.628) (-922.374) (-925.871) [-928.316] * (-922.346) [-922.868] (-924.043) (-922.895) -- 0:00:20
676000 -- (-923.615) (-924.326) [-924.512] (-925.825) * [-922.316] (-927.522) (-925.350) (-923.588) -- 0:00:20
676500 -- (-927.005) (-925.502) (-924.791) [-924.875] * (-922.634) (-926.347) (-925.350) [-923.489] -- 0:00:20
677000 -- (-923.797) (-923.481) (-924.470) [-923.777] * [-922.757] (-927.563) (-922.427) (-923.887) -- 0:00:20
677500 -- [-924.338] (-923.979) (-924.266) (-924.961) * (-925.148) (-922.831) [-926.946] (-923.223) -- 0:00:20
678000 -- (-928.592) (-922.888) [-924.617] (-923.782) * (-924.125) (-925.119) [-924.071] (-923.802) -- 0:00:20
678500 -- [-925.205] (-924.318) (-928.158) (-927.739) * (-925.340) (-926.726) [-924.906] (-923.636) -- 0:00:20
679000 -- (-922.532) (-925.804) (-922.561) [-928.610] * (-922.238) (-923.985) (-925.112) [-925.087] -- 0:00:20
679500 -- [-927.154] (-927.860) (-922.584) (-928.080) * (-924.261) [-922.816] (-923.053) (-925.466) -- 0:00:20
680000 -- (-926.057) (-922.503) [-923.746] (-926.843) * (-924.062) [-921.920] (-928.287) (-926.270) -- 0:00:20
Average standard deviation of split frequencies: 0.008026
680500 -- [-924.424] (-923.901) (-923.581) (-927.110) * (-924.135) [-923.298] (-923.757) (-926.162) -- 0:00:20
681000 -- [-923.246] (-924.323) (-923.187) (-931.173) * (-921.955) (-923.955) (-923.449) [-923.742] -- 0:00:20
681500 -- [-924.289] (-930.409) (-927.251) (-923.332) * (-921.893) (-931.338) [-926.926] (-923.928) -- 0:00:20
682000 -- (-924.825) [-928.943] (-924.241) (-926.869) * (-923.778) (-928.906) (-925.448) [-923.097] -- 0:00:20
682500 -- [-923.445] (-924.504) (-925.905) (-922.192) * (-923.843) (-924.448) (-924.726) [-923.025] -- 0:00:20
683000 -- (-923.929) [-924.223] (-923.831) (-923.972) * [-923.273] (-922.743) (-924.606) (-924.499) -- 0:00:19
683500 -- [-923.518] (-924.498) (-923.837) (-922.104) * (-925.267) (-924.868) [-923.522] (-924.705) -- 0:00:19
684000 -- (-922.620) (-923.312) [-922.744] (-922.626) * [-923.652] (-923.896) (-922.620) (-924.397) -- 0:00:19
684500 -- (-923.825) [-922.178] (-923.077) (-923.041) * (-926.112) (-923.074) [-924.481] (-925.562) -- 0:00:19
685000 -- (-924.113) [-923.104] (-922.388) (-923.906) * [-924.023] (-925.181) (-923.807) (-925.806) -- 0:00:19
Average standard deviation of split frequencies: 0.007761
685500 -- [-924.726] (-929.520) (-922.883) (-923.254) * (-926.400) [-924.872] (-924.277) (-923.608) -- 0:00:19
686000 -- (-926.161) (-924.001) [-923.228] (-922.668) * (-922.093) (-923.120) [-924.367] (-922.684) -- 0:00:19
686500 -- (-924.746) (-925.510) [-923.041] (-925.082) * [-922.842] (-926.046) (-924.050) (-925.477) -- 0:00:19
687000 -- (-926.375) (-925.994) [-923.842] (-923.014) * (-922.643) (-924.123) [-924.586] (-924.739) -- 0:00:19
687500 -- [-925.277] (-926.957) (-923.737) (-928.477) * (-929.015) (-923.334) (-924.057) [-922.864] -- 0:00:20
688000 -- (-930.135) [-925.689] (-927.264) (-929.211) * (-927.255) [-923.657] (-923.879) (-922.785) -- 0:00:19
688500 -- [-928.385] (-922.106) (-926.137) (-923.798) * (-928.362) (-922.510) [-927.363] (-927.526) -- 0:00:19
689000 -- (-924.798) (-923.166) [-922.776] (-923.331) * (-929.708) [-922.904] (-923.555) (-924.495) -- 0:00:19
689500 -- (-923.270) (-922.830) (-923.757) [-924.095] * [-924.849] (-922.297) (-925.877) (-925.619) -- 0:00:19
690000 -- (-922.691) [-923.543] (-924.036) (-925.056) * (-922.616) (-923.442) (-927.575) [-923.054] -- 0:00:19
Average standard deviation of split frequencies: 0.007508
690500 -- (-923.806) (-924.639) (-925.651) [-922.867] * (-924.016) [-922.870] (-930.390) (-925.616) -- 0:00:19
691000 -- (-924.966) (-925.143) [-925.455] (-925.526) * [-925.037] (-922.286) (-931.397) (-923.576) -- 0:00:19
691500 -- (-924.935) (-923.145) [-925.504] (-924.662) * (-924.552) [-921.978] (-922.762) (-924.275) -- 0:00:19
692000 -- (-924.277) (-924.460) (-923.737) [-925.101] * (-925.650) (-922.124) (-923.723) [-922.923] -- 0:00:19
692500 -- [-923.033] (-924.751) (-922.675) (-924.387) * (-929.702) (-925.623) (-924.977) [-924.647] -- 0:00:19
693000 -- (-927.262) (-928.819) [-923.073] (-924.320) * (-925.543) (-923.148) [-930.681] (-925.788) -- 0:00:19
693500 -- [-925.851] (-925.837) (-924.220) (-923.767) * (-924.417) (-929.228) [-924.257] (-928.351) -- 0:00:19
694000 -- (-923.675) [-925.533] (-924.256) (-924.093) * (-929.045) (-923.121) (-923.640) [-927.204] -- 0:00:19
694500 -- [-923.631] (-923.268) (-922.379) (-926.751) * [-924.178] (-924.866) (-924.725) (-923.184) -- 0:00:19
695000 -- (-923.574) (-922.791) (-923.314) [-923.786] * (-923.278) (-924.869) (-925.321) [-923.082] -- 0:00:19
Average standard deviation of split frequencies: 0.007689
695500 -- [-925.505] (-925.639) (-924.073) (-926.649) * [-923.329] (-922.427) (-924.743) (-924.434) -- 0:00:19
696000 -- [-926.496] (-923.910) (-922.242) (-926.830) * (-924.611) (-923.922) [-923.811] (-923.831) -- 0:00:19
696500 -- [-922.122] (-922.306) (-923.396) (-925.359) * (-922.731) [-923.042] (-924.377) (-925.462) -- 0:00:19
697000 -- (-923.540) (-929.003) (-923.428) [-923.225] * (-923.779) (-922.628) (-927.661) [-923.073] -- 0:00:19
697500 -- (-924.353) [-923.822] (-924.486) (-923.683) * (-922.535) (-924.117) [-923.379] (-922.249) -- 0:00:19
698000 -- [-923.589] (-923.030) (-922.809) (-924.273) * (-924.583) (-922.417) (-923.278) [-923.731] -- 0:00:19
698500 -- [-925.246] (-923.640) (-922.428) (-925.214) * (-925.821) (-924.988) [-922.570] (-926.954) -- 0:00:18
699000 -- (-924.756) (-923.982) [-924.677] (-926.704) * (-928.499) (-923.560) [-923.788] (-924.443) -- 0:00:18
699500 -- (-923.891) [-922.069] (-925.245) (-925.351) * (-926.054) (-923.769) (-923.149) [-925.091] -- 0:00:18
700000 -- (-924.317) (-922.481) (-923.520) [-922.142] * [-926.026] (-924.246) (-924.552) (-924.898) -- 0:00:18
Average standard deviation of split frequencies: 0.007443
700500 -- (-925.105) (-923.092) [-923.140] (-924.193) * (-926.026) [-923.808] (-922.250) (-923.601) -- 0:00:18
701000 -- (-924.368) (-922.704) [-922.135] (-924.211) * (-926.249) (-922.401) [-922.768] (-923.985) -- 0:00:18
701500 -- [-924.713] (-924.323) (-922.107) (-925.075) * (-924.518) (-922.523) [-922.978] (-926.208) -- 0:00:18
702000 -- (-924.433) (-924.842) [-926.354] (-923.437) * (-923.347) (-924.235) (-924.886) [-926.429] -- 0:00:18
702500 -- (-923.799) [-926.246] (-925.356) (-923.498) * (-924.397) (-923.716) (-923.066) [-924.202] -- 0:00:18
703000 -- (-924.314) [-927.492] (-923.198) (-923.238) * (-923.436) (-921.859) [-924.806] (-925.138) -- 0:00:18
703500 -- (-922.531) [-925.596] (-923.282) (-923.631) * (-925.857) [-923.467] (-928.151) (-923.517) -- 0:00:18
704000 -- (-923.333) [-923.218] (-924.374) (-922.675) * (-924.877) (-923.170) [-927.616] (-926.287) -- 0:00:18
704500 -- (-926.240) (-923.211) [-925.170] (-923.620) * (-923.482) (-924.878) (-924.720) [-923.307] -- 0:00:18
705000 -- (-922.257) (-926.005) [-923.930] (-925.748) * (-925.748) [-923.705] (-927.490) (-924.426) -- 0:00:18
Average standard deviation of split frequencies: 0.007423
705500 -- [-922.152] (-924.249) (-924.175) (-924.761) * (-924.132) (-923.840) (-926.459) [-924.833] -- 0:00:18
706000 -- (-921.893) (-925.007) (-925.259) [-923.097] * (-924.664) [-922.913] (-925.999) (-928.799) -- 0:00:18
706500 -- (-922.306) (-931.201) [-921.810] (-927.827) * (-925.442) [-922.122] (-928.101) (-922.747) -- 0:00:18
707000 -- (-922.439) (-926.125) [-926.411] (-924.920) * (-924.221) (-923.317) [-923.498] (-924.324) -- 0:00:18
707500 -- (-923.141) [-924.715] (-925.046) (-926.137) * (-924.266) [-924.374] (-923.970) (-925.632) -- 0:00:18
708000 -- (-923.894) (-926.651) (-930.204) [-923.318] * (-922.393) [-922.909] (-922.963) (-923.549) -- 0:00:18
708500 -- (-923.306) (-927.051) [-922.259] (-922.995) * (-923.965) (-922.565) [-922.566] (-923.342) -- 0:00:18
709000 -- (-924.763) (-923.045) (-924.590) [-923.329] * [-921.950] (-926.205) (-924.392) (-923.661) -- 0:00:18
709500 -- (-925.169) (-923.459) (-923.502) [-923.299] * (-923.436) (-924.747) (-927.818) [-924.340] -- 0:00:18
710000 -- (-923.722) (-922.314) [-923.713] (-923.044) * (-925.216) (-923.525) [-925.913] (-922.887) -- 0:00:18
Average standard deviation of split frequencies: 0.008181
710500 -- (-923.261) (-923.826) [-925.821] (-922.778) * (-924.429) (-922.722) (-925.834) [-921.993] -- 0:00:18
711000 -- (-922.575) (-923.815) [-925.672] (-922.456) * [-922.778] (-926.423) (-924.545) (-926.033) -- 0:00:18
711500 -- [-923.525] (-923.303) (-926.807) (-923.475) * (-923.520) [-927.039] (-924.044) (-923.284) -- 0:00:18
712000 -- [-922.728] (-922.350) (-922.968) (-925.260) * (-922.017) (-922.656) (-923.930) [-923.295] -- 0:00:18
712500 -- (-923.747) (-922.415) (-921.868) [-924.529] * (-923.304) (-924.994) (-924.890) [-925.877] -- 0:00:18
713000 -- (-924.667) (-923.084) (-925.879) [-923.217] * (-927.298) [-925.074] (-927.011) (-924.441) -- 0:00:18
713500 -- (-924.195) (-922.826) (-924.040) [-924.161] * (-923.899) (-922.003) (-924.985) [-924.373] -- 0:00:18
714000 -- (-924.893) (-922.903) (-922.990) [-924.193] * (-926.255) [-922.378] (-924.855) (-926.885) -- 0:00:18
714500 -- (-928.228) [-922.628] (-926.393) (-922.546) * (-925.118) (-922.890) [-926.272] (-924.102) -- 0:00:17
715000 -- [-924.884] (-926.149) (-926.627) (-924.735) * [-925.557] (-924.412) (-924.971) (-923.044) -- 0:00:17
Average standard deviation of split frequencies: 0.008120
715500 -- (-925.909) (-926.724) (-922.132) [-923.873] * (-924.363) [-924.337] (-923.876) (-923.027) -- 0:00:17
716000 -- (-926.723) (-924.161) [-923.367] (-926.000) * (-926.734) (-923.836) [-923.662] (-923.829) -- 0:00:17
716500 -- (-924.299) (-924.621) (-922.402) [-923.949] * (-926.166) [-926.357] (-926.047) (-924.825) -- 0:00:17
717000 -- (-922.610) (-929.767) [-924.372] (-925.325) * (-928.949) (-932.588) (-923.902) [-924.876] -- 0:00:17
717500 -- [-923.221] (-929.905) (-922.697) (-929.014) * [-926.398] (-924.019) (-923.041) (-926.468) -- 0:00:17
718000 -- (-922.225) (-929.602) [-923.872] (-925.482) * (-924.866) (-924.618) [-922.127] (-925.591) -- 0:00:17
718500 -- (-924.359) [-923.150] (-922.339) (-925.450) * (-924.285) (-925.854) [-922.977] (-928.650) -- 0:00:17
719000 -- (-922.668) (-923.331) [-923.830] (-924.327) * (-924.036) [-922.917] (-921.715) (-922.766) -- 0:00:17
719500 -- [-923.060] (-923.386) (-924.305) (-925.849) * [-928.527] (-928.600) (-922.567) (-923.919) -- 0:00:17
720000 -- [-931.295] (-923.191) (-924.163) (-928.976) * (-926.688) (-927.089) [-922.812] (-924.899) -- 0:00:17
Average standard deviation of split frequencies: 0.007522
720500 -- (-924.754) (-923.345) (-923.502) [-923.845] * (-922.492) (-929.564) (-922.848) [-923.361] -- 0:00:17
721000 -- (-923.690) (-922.593) [-925.774] (-926.246) * [-922.864] (-931.144) (-925.302) (-922.978) -- 0:00:17
721500 -- [-923.846] (-924.496) (-923.392) (-924.423) * (-923.292) [-922.878] (-926.257) (-925.092) -- 0:00:17
722000 -- [-923.108] (-925.146) (-922.665) (-927.720) * (-922.890) [-926.420] (-926.497) (-925.053) -- 0:00:17
722500 -- (-923.516) [-923.908] (-927.265) (-925.274) * (-924.718) [-927.429] (-924.468) (-922.028) -- 0:00:17
723000 -- (-923.828) (-925.992) (-932.852) [-924.179] * (-925.834) [-923.092] (-922.665) (-923.068) -- 0:00:17
723500 -- [-922.529] (-928.958) (-923.276) (-928.491) * (-923.217) (-925.852) (-923.578) [-922.041] -- 0:00:17
724000 -- (-924.890) (-924.816) (-923.464) [-922.406] * (-927.345) (-923.870) (-922.326) [-922.027] -- 0:00:17
724500 -- (-925.544) (-925.605) [-923.714] (-923.235) * (-922.945) [-923.779] (-924.086) (-922.413) -- 0:00:17
725000 -- (-926.220) (-924.677) (-922.174) [-922.015] * (-921.951) (-925.572) (-922.843) [-923.879] -- 0:00:17
Average standard deviation of split frequencies: 0.007323
725500 -- (-926.711) (-925.262) (-922.646) [-922.263] * (-922.910) (-929.670) (-922.836) [-928.031] -- 0:00:17
726000 -- [-925.692] (-924.191) (-922.453) (-923.360) * (-926.497) (-922.262) (-923.116) [-922.744] -- 0:00:17
726500 -- (-925.243) (-925.486) (-922.934) [-923.225] * (-924.164) (-922.265) [-926.910] (-921.966) -- 0:00:17
727000 -- (-925.271) (-923.851) (-930.404) [-923.280] * (-924.349) (-922.940) [-922.971] (-929.899) -- 0:00:17
727500 -- (-923.602) [-922.918] (-923.621) (-923.680) * (-924.522) (-923.961) (-927.443) [-927.494] -- 0:00:17
728000 -- (-924.370) (-925.083) [-924.928] (-923.780) * (-926.073) [-922.908] (-925.123) (-923.803) -- 0:00:17
728500 -- [-922.167] (-926.174) (-924.744) (-927.318) * (-923.892) [-922.718] (-925.983) (-927.210) -- 0:00:17
729000 -- (-922.225) (-925.782) (-923.735) [-925.332] * (-922.636) [-923.234] (-925.430) (-922.632) -- 0:00:17
729500 -- (-922.210) [-929.216] (-927.318) (-931.108) * (-924.946) (-923.282) [-923.993] (-924.012) -- 0:00:17
730000 -- (-923.214) (-926.126) [-927.166] (-925.467) * [-927.813] (-924.350) (-922.041) (-922.972) -- 0:00:17
Average standard deviation of split frequencies: 0.007258
730500 -- (-924.730) (-924.756) (-924.056) [-922.369] * (-926.208) [-923.704] (-927.158) (-922.430) -- 0:00:16
731000 -- (-922.601) (-923.262) (-923.871) [-923.497] * (-927.624) (-925.426) (-925.854) [-922.083] -- 0:00:16
731500 -- (-926.371) (-924.404) [-922.851] (-923.255) * [-924.056] (-922.213) (-927.413) (-923.246) -- 0:00:16
732000 -- (-923.598) (-926.520) (-926.011) [-922.633] * (-921.925) [-923.045] (-923.653) (-924.585) -- 0:00:16
732500 -- (-922.507) (-925.393) [-927.195] (-923.997) * (-922.721) [-925.796] (-922.310) (-923.940) -- 0:00:16
733000 -- (-925.794) (-923.664) (-924.568) [-922.710] * (-922.580) (-922.574) (-926.611) [-922.363] -- 0:00:16
733500 -- [-922.872] (-923.664) (-922.801) (-924.127) * (-925.659) [-923.001] (-925.031) (-924.675) -- 0:00:16
734000 -- (-922.257) (-923.289) [-921.714] (-924.063) * (-924.430) [-925.106] (-922.740) (-923.969) -- 0:00:16
734500 -- (-924.576) (-925.118) (-922.859) [-924.160] * (-924.504) (-927.787) [-922.553] (-925.324) -- 0:00:16
735000 -- (-926.472) (-927.258) [-924.392] (-923.893) * [-924.321] (-930.060) (-923.156) (-923.014) -- 0:00:16
Average standard deviation of split frequencies: 0.007406
735500 -- (-932.017) [-925.596] (-927.168) (-927.211) * (-922.940) [-926.288] (-924.651) (-922.846) -- 0:00:16
736000 -- (-924.189) (-926.350) (-924.120) [-922.364] * [-923.657] (-924.913) (-923.485) (-924.942) -- 0:00:16
736500 -- (-923.436) (-923.976) [-924.560] (-923.705) * [-925.853] (-925.253) (-923.295) (-923.018) -- 0:00:16
737000 -- (-923.665) (-923.153) [-923.275] (-924.086) * (-927.777) (-923.516) (-926.698) [-924.897] -- 0:00:16
737500 -- (-924.058) [-923.721] (-925.798) (-923.395) * (-925.319) [-922.915] (-922.253) (-925.093) -- 0:00:16
738000 -- (-923.474) (-922.373) [-929.191] (-929.288) * (-924.461) [-927.515] (-925.334) (-924.658) -- 0:00:16
738500 -- (-924.531) (-922.965) (-924.131) [-923.395] * (-925.386) [-927.863] (-924.479) (-927.762) -- 0:00:16
739000 -- [-922.965] (-922.965) (-928.411) (-923.970) * (-922.680) (-923.181) [-923.872] (-928.034) -- 0:00:16
739500 -- (-929.976) (-922.821) [-923.107] (-925.458) * [-925.244] (-922.388) (-924.851) (-923.224) -- 0:00:16
740000 -- (-927.306) [-921.989] (-922.397) (-923.625) * (-924.121) [-925.546] (-925.380) (-926.062) -- 0:00:16
Average standard deviation of split frequencies: 0.007200
740500 -- [-923.225] (-925.696) (-923.057) (-923.206) * [-924.645] (-924.808) (-922.690) (-923.287) -- 0:00:16
741000 -- (-925.785) (-926.922) (-925.667) [-928.042] * (-925.707) [-922.925] (-924.954) (-922.985) -- 0:00:16
741500 -- (-926.831) [-924.319] (-922.819) (-927.821) * (-923.118) (-925.474) (-924.657) [-925.089] -- 0:00:16
742000 -- (-928.179) (-925.215) (-922.990) [-929.335] * (-923.208) (-924.603) (-923.109) [-922.804] -- 0:00:16
742500 -- (-923.067) (-925.456) (-922.670) [-922.320] * (-922.836) (-923.384) (-924.836) [-924.419] -- 0:00:16
743000 -- (-923.473) [-924.648] (-924.729) (-923.333) * (-922.666) (-925.852) (-925.708) [-923.686] -- 0:00:16
743500 -- (-922.327) (-924.116) [-923.015] (-924.302) * (-922.485) [-925.012] (-924.742) (-922.788) -- 0:00:16
744000 -- (-922.418) (-925.950) [-922.712] (-921.992) * (-927.145) (-923.137) (-924.082) [-924.764] -- 0:00:16
744500 -- (-924.461) (-923.226) (-923.032) [-927.719] * (-922.412) (-923.142) [-922.538] (-925.478) -- 0:00:16
745000 -- (-923.858) (-922.315) [-926.389] (-924.654) * (-922.101) (-926.016) (-921.976) [-922.970] -- 0:00:16
Average standard deviation of split frequencies: 0.007188
745500 -- [-925.337] (-922.589) (-925.320) (-926.559) * [-923.749] (-933.890) (-924.097) (-924.066) -- 0:00:16
746000 -- (-925.442) (-925.386) (-924.593) [-926.221] * (-923.062) [-923.799] (-924.188) (-926.321) -- 0:00:16
746500 -- (-923.012) [-924.015] (-923.927) (-922.256) * (-925.195) [-922.037] (-925.003) (-924.301) -- 0:00:15
747000 -- (-922.177) (-922.800) (-923.317) [-923.826] * (-923.639) (-924.175) [-927.461] (-923.790) -- 0:00:15
747500 -- (-926.212) (-924.014) [-926.249] (-923.519) * (-925.459) (-925.943) [-926.435] (-926.017) -- 0:00:15
748000 -- [-923.553] (-927.021) (-925.522) (-923.820) * (-923.921) [-922.664] (-924.735) (-925.327) -- 0:00:15
748500 -- (-923.503) (-922.638) (-924.368) [-928.267] * (-922.156) [-922.484] (-924.836) (-926.685) -- 0:00:15
749000 -- (-924.278) (-923.739) [-923.381] (-927.684) * (-922.805) [-922.747] (-923.083) (-925.625) -- 0:00:15
749500 -- (-924.400) [-922.076] (-925.860) (-926.942) * (-922.820) (-924.949) [-924.117] (-924.740) -- 0:00:15
750000 -- (-923.516) [-924.011] (-924.107) (-926.082) * (-923.979) (-922.586) (-923.111) [-925.840] -- 0:00:15
Average standard deviation of split frequencies: 0.007497
750500 -- (-926.951) [-923.952] (-924.427) (-926.069) * (-925.033) (-923.413) (-922.630) [-927.569] -- 0:00:15
751000 -- [-923.816] (-926.034) (-923.004) (-925.292) * (-923.110) (-926.028) (-923.272) [-923.591] -- 0:00:15
751500 -- [-924.041] (-924.244) (-923.468) (-929.738) * [-925.789] (-927.157) (-923.998) (-933.142) -- 0:00:15
752000 -- [-924.525] (-924.092) (-923.209) (-925.802) * (-922.563) (-922.958) [-926.647] (-925.195) -- 0:00:15
752500 -- (-923.990) [-924.002] (-925.559) (-924.035) * [-922.810] (-922.944) (-927.646) (-928.174) -- 0:00:15
753000 -- (-925.411) (-926.115) [-921.968] (-922.977) * [-923.024] (-926.234) (-927.168) (-924.793) -- 0:00:15
753500 -- (-930.303) [-923.043] (-922.801) (-924.466) * (-923.747) (-924.516) [-922.767] (-924.035) -- 0:00:15
754000 -- (-925.214) (-925.425) (-923.540) [-922.333] * (-922.754) (-923.789) (-924.536) [-923.564] -- 0:00:15
754500 -- (-924.020) (-927.537) [-923.439] (-927.462) * (-929.407) (-926.944) (-925.497) [-927.410] -- 0:00:15
755000 -- (-922.824) (-922.627) [-923.851] (-923.692) * (-924.051) (-923.530) [-925.565] (-928.360) -- 0:00:15
Average standard deviation of split frequencies: 0.007849
755500 -- [-923.471] (-923.163) (-922.534) (-921.924) * (-923.358) [-926.346] (-924.303) (-925.028) -- 0:00:15
756000 -- [-924.065] (-923.399) (-927.160) (-922.934) * (-924.265) [-924.190] (-924.954) (-922.249) -- 0:00:15
756500 -- (-923.855) [-922.778] (-922.552) (-929.021) * (-925.838) (-922.441) (-924.245) [-924.140] -- 0:00:15
757000 -- (-923.992) (-923.843) [-922.301] (-923.230) * (-928.156) [-923.754] (-924.326) (-927.232) -- 0:00:15
757500 -- (-922.370) [-925.018] (-922.911) (-923.283) * [-923.870] (-922.967) (-924.695) (-927.305) -- 0:00:15
758000 -- (-923.283) [-924.442] (-922.447) (-922.360) * (-922.525) [-923.570] (-924.921) (-923.817) -- 0:00:15
758500 -- (-923.983) (-922.282) [-924.712] (-924.966) * (-922.887) (-925.162) [-923.999] (-922.132) -- 0:00:15
759000 -- [-924.668] (-922.170) (-923.013) (-926.185) * (-923.201) (-925.069) [-923.893] (-925.248) -- 0:00:15
759500 -- [-924.665] (-923.675) (-922.918) (-925.636) * (-922.636) (-925.167) [-926.581] (-923.842) -- 0:00:15
760000 -- [-924.816] (-922.645) (-924.637) (-924.329) * [-923.747] (-925.176) (-928.471) (-927.038) -- 0:00:15
Average standard deviation of split frequencies: 0.007984
760500 -- (-923.608) (-924.209) [-922.968] (-927.696) * (-923.210) (-927.137) (-924.000) [-922.506] -- 0:00:15
761000 -- (-925.056) (-922.855) [-924.175] (-923.386) * (-923.542) (-923.561) [-922.962] (-923.674) -- 0:00:15
761500 -- (-924.033) (-925.629) [-925.311] (-923.864) * [-923.212] (-923.843) (-925.857) (-922.703) -- 0:00:15
762000 -- (-927.264) [-925.620] (-923.665) (-923.378) * (-927.464) (-926.060) [-924.025] (-924.263) -- 0:00:14
762500 -- (-924.925) (-923.818) (-924.680) [-924.536] * (-922.074) (-923.145) [-921.935] (-925.497) -- 0:00:14
763000 -- (-922.735) (-923.983) (-926.678) [-924.958] * [-922.735] (-924.120) (-921.764) (-923.548) -- 0:00:14
763500 -- (-922.859) (-922.615) (-926.830) [-923.699] * (-922.350) (-923.545) [-923.385] (-923.971) -- 0:00:14
764000 -- (-922.957) [-922.433] (-929.976) (-923.206) * [-923.876] (-923.641) (-923.340) (-926.391) -- 0:00:14
764500 -- [-922.952] (-923.254) (-923.594) (-923.108) * [-923.180] (-924.133) (-922.250) (-926.648) -- 0:00:14
765000 -- [-926.699] (-925.087) (-923.735) (-923.344) * (-923.655) (-923.555) [-923.292] (-925.226) -- 0:00:14
Average standard deviation of split frequencies: 0.008037
765500 -- (-925.440) (-928.832) (-923.452) [-923.981] * (-924.267) (-924.453) [-923.789] (-924.738) -- 0:00:14
766000 -- (-924.929) (-922.636) (-922.196) [-925.289] * [-926.241] (-922.905) (-923.322) (-925.631) -- 0:00:14
766500 -- (-923.601) [-924.312] (-922.170) (-923.718) * [-922.414] (-922.996) (-923.329) (-924.450) -- 0:00:14
767000 -- (-924.092) [-925.296] (-926.957) (-924.062) * (-923.802) (-922.908) [-924.137] (-925.117) -- 0:00:14
767500 -- (-925.793) (-922.987) [-922.266] (-926.745) * [-926.808] (-923.805) (-925.523) (-922.783) -- 0:00:14
768000 -- [-922.715] (-926.737) (-923.757) (-926.342) * (-922.389) [-923.131] (-925.548) (-923.519) -- 0:00:14
768500 -- [-925.365] (-921.882) (-924.128) (-925.670) * (-923.236) (-926.152) (-924.469) [-922.608] -- 0:00:14
769000 -- [-922.745] (-923.337) (-927.862) (-924.478) * [-923.018] (-924.110) (-923.117) (-924.935) -- 0:00:14
769500 -- (-926.449) [-922.737] (-923.008) (-924.336) * (-922.598) (-924.937) [-923.077] (-923.018) -- 0:00:14
770000 -- (-926.446) [-924.619] (-928.610) (-926.701) * (-922.718) [-922.207] (-924.566) (-923.019) -- 0:00:14
Average standard deviation of split frequencies: 0.008132
770500 -- (-922.600) [-924.868] (-923.245) (-923.551) * (-923.036) (-923.215) (-924.361) [-923.875] -- 0:00:14
771000 -- (-922.639) [-923.329] (-925.611) (-922.683) * (-925.012) (-923.191) (-923.896) [-922.333] -- 0:00:14
771500 -- (-925.026) (-925.026) (-924.820) [-926.154] * (-925.517) (-922.288) (-929.044) [-922.307] -- 0:00:14
772000 -- [-923.210] (-925.443) (-922.467) (-924.508) * (-925.419) [-921.995] (-924.667) (-925.250) -- 0:00:14
772500 -- [-925.028] (-927.571) (-926.283) (-926.007) * (-925.247) (-923.417) [-922.402] (-926.383) -- 0:00:14
773000 -- [-924.810] (-925.821) (-924.330) (-923.867) * (-923.138) (-922.987) [-922.101] (-924.812) -- 0:00:14
773500 -- (-925.013) (-925.329) (-923.776) [-924.395] * (-928.408) [-927.017] (-925.654) (-924.251) -- 0:00:14
774000 -- (-925.773) (-926.599) [-922.442] (-926.925) * (-924.761) (-926.554) (-922.155) [-922.568] -- 0:00:14
774500 -- [-923.243] (-927.952) (-928.990) (-925.916) * (-926.439) [-929.255] (-923.855) (-925.513) -- 0:00:14
775000 -- [-921.783] (-924.330) (-924.650) (-926.285) * (-925.581) (-925.644) (-924.402) [-929.026] -- 0:00:14
Average standard deviation of split frequencies: 0.007683
775500 -- (-925.105) (-923.850) (-927.901) [-922.895] * (-929.160) (-926.434) (-922.133) [-924.536] -- 0:00:14
776000 -- (-923.003) (-922.837) (-926.648) [-926.472] * (-923.706) (-923.606) (-922.558) [-925.487] -- 0:00:14
776500 -- (-925.996) [-923.339] (-923.041) (-925.873) * (-924.559) (-922.114) [-924.632] (-927.226) -- 0:00:14
777000 -- (-924.835) [-922.969] (-926.324) (-925.077) * [-922.769] (-931.433) (-922.017) (-925.817) -- 0:00:14
777500 -- (-927.876) [-922.688] (-923.642) (-929.359) * (-923.645) (-923.286) [-923.379] (-924.669) -- 0:00:14
778000 -- [-923.414] (-922.423) (-928.289) (-923.233) * [-927.801] (-922.397) (-922.378) (-928.752) -- 0:00:13
778500 -- (-924.650) [-924.215] (-922.963) (-921.945) * (-927.331) (-923.494) [-924.313] (-924.052) -- 0:00:13
779000 -- [-923.777] (-924.523) (-923.154) (-922.713) * (-923.405) [-924.279] (-924.749) (-923.421) -- 0:00:13
779500 -- (-923.927) (-923.738) (-922.421) [-923.489] * (-923.403) [-923.193] (-924.712) (-923.393) -- 0:00:13
780000 -- (-922.983) (-922.720) [-926.147] (-923.367) * (-922.564) (-924.643) [-923.785] (-925.159) -- 0:00:13
Average standard deviation of split frequencies: 0.007637
780500 -- (-922.806) (-924.608) (-923.632) [-925.157] * (-924.397) (-924.143) (-924.460) [-924.499] -- 0:00:13
781000 -- (-925.797) (-923.957) (-922.837) [-922.375] * (-922.438) (-924.070) (-926.391) [-923.537] -- 0:00:13
781500 -- (-922.518) [-923.600] (-922.583) (-927.564) * (-923.650) (-923.980) (-923.776) [-922.872] -- 0:00:13
782000 -- (-924.133) [-924.474] (-923.891) (-922.895) * (-922.855) (-924.052) [-922.215] (-924.459) -- 0:00:13
782500 -- (-924.755) (-923.886) [-922.773] (-924.833) * (-923.290) [-923.611] (-923.763) (-923.315) -- 0:00:13
783000 -- (-925.354) (-923.201) [-926.902] (-925.852) * (-923.413) (-923.965) [-925.436] (-923.907) -- 0:00:13
783500 -- (-926.453) [-925.235] (-927.033) (-929.870) * [-927.772] (-924.957) (-924.215) (-923.187) -- 0:00:13
784000 -- (-924.437) (-923.344) (-924.246) [-921.954] * (-925.356) [-923.037] (-923.489) (-925.187) -- 0:00:13
784500 -- (-929.232) (-924.966) (-924.496) [-922.533] * (-923.092) [-923.467] (-924.556) (-923.186) -- 0:00:13
785000 -- [-925.389] (-924.438) (-926.361) (-924.182) * (-930.152) [-924.173] (-925.735) (-927.318) -- 0:00:13
Average standard deviation of split frequencies: 0.007444
785500 -- (-925.157) [-923.444] (-922.405) (-922.036) * [-922.522] (-925.534) (-925.474) (-924.433) -- 0:00:13
786000 -- (-925.083) (-926.890) (-923.604) [-923.358] * (-922.344) (-925.515) [-923.922] (-922.083) -- 0:00:13
786500 -- (-925.437) (-923.617) [-926.836] (-925.117) * (-924.354) (-922.715) (-922.530) [-923.728] -- 0:00:13
787000 -- [-926.221] (-923.392) (-923.894) (-922.328) * [-924.020] (-923.212) (-923.133) (-924.504) -- 0:00:13
787500 -- (-924.154) (-922.981) [-925.345] (-924.532) * (-924.686) [-923.825] (-925.723) (-922.828) -- 0:00:13
788000 -- (-925.666) (-923.680) (-923.456) [-925.372] * [-924.141] (-926.868) (-926.691) (-925.467) -- 0:00:13
788500 -- (-931.095) [-925.161] (-924.796) (-922.264) * (-923.610) (-927.137) (-923.461) [-922.664] -- 0:00:13
789000 -- [-925.886] (-927.070) (-923.999) (-925.165) * (-923.615) [-923.403] (-923.591) (-925.144) -- 0:00:13
789500 -- [-924.612] (-922.847) (-924.274) (-924.560) * (-922.617) [-922.703] (-923.261) (-928.824) -- 0:00:13
790000 -- (-924.928) [-923.011] (-923.978) (-923.283) * (-922.099) (-922.983) [-927.807] (-926.150) -- 0:00:13
Average standard deviation of split frequencies: 0.007646
790500 -- (-923.772) (-923.033) (-922.545) [-923.651] * [-923.322] (-925.695) (-932.439) (-923.567) -- 0:00:13
791000 -- (-924.088) [-926.818] (-922.646) (-924.986) * (-922.872) (-925.776) [-923.304] (-922.940) -- 0:00:13
791500 -- (-924.955) [-922.469] (-924.341) (-927.598) * [-923.808] (-924.537) (-924.133) (-924.053) -- 0:00:13
792000 -- (-922.837) [-921.759] (-924.172) (-921.924) * [-923.132] (-923.243) (-923.065) (-924.034) -- 0:00:13
792500 -- (-923.888) (-922.209) (-926.320) [-922.735] * (-923.233) [-924.212] (-922.212) (-923.314) -- 0:00:13
793000 -- (-923.671) (-923.307) (-923.310) [-923.201] * (-923.838) (-924.176) (-922.369) [-922.042] -- 0:00:13
793500 -- (-924.998) (-930.071) [-923.711] (-923.382) * [-926.767] (-923.324) (-922.375) (-922.059) -- 0:00:13
794000 -- (-922.551) (-925.531) (-927.125) [-922.917] * [-929.412] (-927.488) (-923.826) (-926.477) -- 0:00:12
794500 -- (-922.175) (-922.477) [-922.427] (-923.969) * (-926.867) [-924.168] (-923.696) (-924.687) -- 0:00:12
795000 -- (-922.347) [-921.990] (-922.321) (-928.700) * (-924.408) (-923.978) [-924.516] (-925.568) -- 0:00:12
Average standard deviation of split frequencies: 0.007490
795500 -- (-925.594) (-922.624) (-926.014) [-928.185] * (-923.587) [-924.856] (-926.078) (-925.863) -- 0:00:12
796000 -- (-922.706) (-924.297) [-922.998] (-925.094) * (-923.008) [-922.138] (-927.795) (-926.322) -- 0:00:12
796500 -- (-923.560) [-925.693] (-925.333) (-928.390) * (-924.282) (-923.067) (-923.002) [-926.528] -- 0:00:12
797000 -- (-923.203) [-923.601] (-929.079) (-929.754) * (-923.198) (-922.572) [-921.908] (-923.545) -- 0:00:12
797500 -- (-922.411) (-923.085) (-923.854) [-925.060] * (-922.728) [-922.784] (-921.901) (-926.381) -- 0:00:12
798000 -- (-922.408) (-931.205) [-923.141] (-927.355) * (-924.570) [-922.323] (-922.348) (-923.779) -- 0:00:12
798500 -- (-923.399) (-922.237) [-927.019] (-924.746) * (-927.889) (-926.510) [-923.954] (-926.560) -- 0:00:12
799000 -- (-922.621) [-922.415] (-923.649) (-922.945) * (-925.418) (-924.439) [-924.597] (-924.312) -- 0:00:12
799500 -- (-923.175) [-922.299] (-926.255) (-923.286) * (-925.024) (-924.657) [-925.305] (-923.216) -- 0:00:12
800000 -- (-923.286) [-923.437] (-924.462) (-922.903) * (-924.267) [-924.194] (-924.824) (-924.890) -- 0:00:12
Average standard deviation of split frequencies: 0.007792
800500 -- [-924.564] (-924.603) (-926.386) (-926.218) * (-925.878) (-924.249) [-929.364] (-925.413) -- 0:00:12
801000 -- (-924.856) (-925.584) [-928.729] (-926.119) * (-925.543) (-924.151) (-928.731) [-924.378] -- 0:00:12
801500 -- (-924.166) (-925.038) [-923.389] (-927.610) * (-925.718) [-925.906] (-924.521) (-926.975) -- 0:00:12
802000 -- (-926.680) [-930.447] (-922.931) (-925.573) * (-925.380) [-924.840] (-925.005) (-925.224) -- 0:00:12
802500 -- (-924.317) (-930.267) (-924.281) [-924.216] * (-923.373) (-924.333) (-923.509) [-922.774] -- 0:00:12
803000 -- (-924.118) (-922.823) [-924.704] (-922.510) * (-922.866) [-924.481] (-923.190) (-924.727) -- 0:00:12
803500 -- (-925.932) [-923.756] (-925.733) (-923.274) * [-922.843] (-924.271) (-922.884) (-923.328) -- 0:00:12
804000 -- [-923.031] (-923.865) (-925.861) (-927.792) * (-925.637) (-927.802) (-925.355) [-924.038] -- 0:00:12
804500 -- (-927.063) (-927.493) (-926.794) [-923.920] * (-928.846) (-928.123) [-924.882] (-927.567) -- 0:00:12
805000 -- [-923.200] (-926.227) (-923.537) (-926.543) * [-923.339] (-925.647) (-929.700) (-924.785) -- 0:00:12
Average standard deviation of split frequencies: 0.008016
805500 -- (-923.095) (-923.039) (-925.771) [-922.840] * [-923.823] (-924.780) (-925.154) (-929.050) -- 0:00:12
806000 -- [-924.056] (-923.434) (-922.490) (-927.095) * (-924.038) (-925.014) [-921.919] (-928.993) -- 0:00:12
806500 -- (-925.088) [-923.309] (-928.523) (-923.699) * (-928.427) [-924.726] (-924.799) (-922.233) -- 0:00:12
807000 -- (-922.009) (-931.669) (-924.646) [-925.118] * (-925.683) (-924.227) (-926.336) [-922.313] -- 0:00:12
807500 -- [-924.473] (-924.314) (-924.385) (-924.233) * [-926.331] (-922.824) (-930.796) (-926.476) -- 0:00:12
808000 -- (-922.184) (-924.044) [-923.924] (-924.235) * (-924.383) (-924.801) (-926.173) [-924.189] -- 0:00:12
808500 -- (-922.518) [-922.349] (-924.439) (-925.018) * (-923.222) (-927.331) [-921.943] (-925.326) -- 0:00:12
809000 -- (-923.088) (-922.749) (-921.703) [-922.432] * (-923.220) [-922.803] (-926.409) (-923.934) -- 0:00:12
809500 -- (-926.230) [-923.540] (-923.099) (-930.366) * (-924.983) (-924.468) (-925.989) [-923.902] -- 0:00:12
810000 -- [-926.742] (-923.485) (-924.062) (-924.295) * [-924.102] (-923.851) (-923.939) (-922.767) -- 0:00:11
Average standard deviation of split frequencies: 0.007936
810500 -- (-922.535) (-924.852) (-924.471) [-926.014] * (-924.364) (-922.081) [-921.826] (-925.517) -- 0:00:11
811000 -- (-928.286) [-923.076] (-922.196) (-924.667) * (-926.208) (-924.389) [-921.746] (-924.417) -- 0:00:11
811500 -- [-922.551] (-924.253) (-922.073) (-924.699) * (-925.036) (-925.671) [-923.536] (-925.000) -- 0:00:11
812000 -- (-923.489) [-922.089] (-922.199) (-924.747) * [-923.347] (-922.510) (-926.418) (-924.978) -- 0:00:11
812500 -- (-924.110) (-923.214) [-925.292] (-926.779) * [-923.295] (-925.513) (-925.525) (-924.036) -- 0:00:11
813000 -- (-924.749) [-923.383] (-923.690) (-924.648) * (-923.259) [-926.013] (-922.131) (-923.019) -- 0:00:11
813500 -- (-923.240) (-929.543) (-923.898) [-925.263] * (-925.621) [-924.596] (-922.733) (-923.832) -- 0:00:11
814000 -- [-923.008] (-927.836) (-924.408) (-922.276) * (-927.069) [-924.249] (-925.125) (-930.187) -- 0:00:11
814500 -- [-926.077] (-929.439) (-924.494) (-923.234) * (-928.100) (-927.105) [-923.601] (-925.985) -- 0:00:11
815000 -- (-923.415) (-924.374) (-923.771) [-923.190] * (-925.620) (-924.580) (-923.908) [-923.841] -- 0:00:11
Average standard deviation of split frequencies: 0.007918
815500 -- [-924.366] (-923.386) (-925.318) (-929.087) * (-922.222) (-923.727) (-925.662) [-923.515] -- 0:00:11
816000 -- [-923.616] (-923.405) (-922.687) (-925.599) * (-923.634) [-923.633] (-927.295) (-925.927) -- 0:00:11
816500 -- [-922.041] (-923.370) (-923.857) (-924.932) * (-923.364) (-922.987) [-922.639] (-925.555) -- 0:00:11
817000 -- (-922.182) (-924.569) [-922.168] (-925.449) * [-925.237] (-924.829) (-922.772) (-924.325) -- 0:00:11
817500 -- (-923.203) (-924.204) [-928.284] (-926.633) * [-923.686] (-923.948) (-925.702) (-924.427) -- 0:00:11
818000 -- (-923.316) [-924.453] (-926.222) (-925.662) * (-925.459) (-925.841) [-924.309] (-924.613) -- 0:00:11
818500 -- (-922.991) (-923.998) [-924.792] (-922.988) * (-924.006) [-921.939] (-924.951) (-924.241) -- 0:00:11
819000 -- [-922.235] (-927.287) (-926.388) (-922.477) * (-925.814) (-922.654) [-922.518] (-923.711) -- 0:00:11
819500 -- (-922.337) (-924.118) [-925.374] (-923.035) * (-926.784) (-923.379) (-923.867) [-924.075] -- 0:00:11
820000 -- (-925.395) [-925.726] (-928.816) (-924.050) * [-922.702] (-922.710) (-925.210) (-923.459) -- 0:00:11
Average standard deviation of split frequencies: 0.007974
820500 -- (-924.487) (-924.953) (-922.590) [-924.805] * (-930.635) (-928.802) (-926.076) [-925.909] -- 0:00:11
821000 -- (-924.925) (-924.605) [-924.486] (-924.587) * (-927.138) (-925.361) [-923.118] (-924.934) -- 0:00:11
821500 -- (-923.269) (-922.023) [-923.683] (-924.454) * (-925.681) (-924.725) [-924.260] (-924.147) -- 0:00:11
822000 -- (-927.977) (-922.084) (-925.608) [-923.399] * (-923.101) [-922.920] (-924.015) (-926.655) -- 0:00:11
822500 -- [-923.361] (-922.552) (-924.063) (-923.155) * [-923.990] (-923.283) (-925.116) (-924.092) -- 0:00:11
823000 -- (-926.538) (-925.747) [-923.124] (-924.310) * (-930.714) (-925.089) [-922.503] (-924.487) -- 0:00:11
823500 -- (-924.687) (-927.242) [-924.480] (-925.203) * (-924.830) [-924.870] (-923.021) (-924.145) -- 0:00:11
824000 -- (-923.465) (-922.772) (-922.038) [-923.085] * (-924.460) (-926.688) (-923.742) [-925.205] -- 0:00:11
824500 -- (-924.968) (-922.788) [-925.455] (-924.677) * (-925.004) (-925.215) [-922.863] (-923.693) -- 0:00:11
825000 -- (-925.127) [-926.379] (-927.210) (-924.783) * (-925.747) [-926.371] (-924.654) (-925.916) -- 0:00:11
Average standard deviation of split frequencies: 0.008225
825500 -- (-928.195) (-923.300) [-926.440] (-926.319) * (-928.183) [-923.842] (-922.388) (-923.823) -- 0:00:10
826000 -- [-923.047] (-924.801) (-926.990) (-923.753) * (-927.490) [-922.987] (-925.503) (-922.823) -- 0:00:10
826500 -- (-922.193) [-924.138] (-925.208) (-922.192) * [-925.677] (-922.614) (-922.346) (-931.656) -- 0:00:10
827000 -- (-926.727) [-924.226] (-924.335) (-923.235) * (-922.144) [-925.813] (-924.682) (-925.783) -- 0:00:10
827500 -- (-926.414) (-924.601) [-923.682] (-927.076) * (-922.019) (-925.283) [-924.435] (-922.490) -- 0:00:10
828000 -- (-926.428) [-924.580] (-922.911) (-923.309) * (-924.522) (-923.112) (-924.139) [-923.423] -- 0:00:10
828500 -- (-925.528) (-923.917) [-922.631] (-923.876) * (-926.481) (-924.359) [-922.571] (-925.599) -- 0:00:10
829000 -- (-927.733) (-926.741) [-924.772] (-924.074) * (-927.577) (-925.249) [-926.156] (-927.955) -- 0:00:10
829500 -- (-923.805) [-923.123] (-925.479) (-922.644) * (-926.034) [-923.124] (-923.503) (-922.305) -- 0:00:10
830000 -- (-923.384) (-923.085) (-925.763) [-923.090] * (-925.685) [-924.960] (-922.989) (-925.116) -- 0:00:10
Average standard deviation of split frequencies: 0.008045
830500 -- (-922.536) (-924.263) [-924.595] (-923.076) * (-926.879) (-929.053) (-922.310) [-924.743] -- 0:00:10
831000 -- [-922.893] (-927.142) (-922.524) (-922.619) * [-924.690] (-925.844) (-922.491) (-922.661) -- 0:00:10
831500 -- (-926.598) [-922.905] (-924.822) (-923.683) * (-924.070) (-926.532) (-927.584) [-924.243] -- 0:00:10
832000 -- (-922.840) (-929.989) [-922.257] (-925.502) * [-930.309] (-926.812) (-922.975) (-925.130) -- 0:00:10
832500 -- (-922.664) [-925.880] (-922.162) (-926.885) * (-923.889) (-923.993) [-924.038] (-926.461) -- 0:00:10
833000 -- [-924.426] (-922.709) (-925.214) (-925.823) * (-922.723) [-923.838] (-925.020) (-924.712) -- 0:00:10
833500 -- [-924.556] (-923.402) (-927.322) (-923.036) * (-921.820) (-923.257) (-927.144) [-925.334] -- 0:00:10
834000 -- (-923.782) [-925.651] (-923.118) (-924.138) * [-922.900] (-925.282) (-925.577) (-923.781) -- 0:00:10
834500 -- (-923.429) (-925.796) [-926.069] (-924.804) * (-923.373) (-930.076) (-922.907) [-923.989] -- 0:00:10
835000 -- [-922.766] (-922.648) (-925.186) (-926.081) * (-922.766) (-923.863) [-926.239] (-924.378) -- 0:00:10
Average standard deviation of split frequencies: 0.008226
835500 -- (-924.411) [-922.392] (-924.255) (-927.384) * (-925.498) (-922.841) [-926.718] (-929.362) -- 0:00:10
836000 -- (-925.497) (-925.345) [-927.353] (-924.035) * (-924.256) [-924.743] (-929.720) (-925.341) -- 0:00:10
836500 -- (-925.446) (-925.129) [-923.254] (-923.197) * (-924.236) (-922.456) [-924.505] (-928.483) -- 0:00:10
837000 -- (-924.800) (-922.554) [-924.766] (-923.792) * [-922.801] (-922.810) (-923.797) (-925.135) -- 0:00:10
837500 -- (-928.642) [-924.769] (-923.081) (-922.810) * (-926.039) [-925.498] (-923.162) (-922.535) -- 0:00:10
838000 -- (-923.717) (-922.852) [-923.344] (-923.848) * [-926.386] (-925.722) (-924.370) (-926.078) -- 0:00:10
838500 -- [-922.690] (-924.989) (-922.779) (-926.100) * (-926.310) [-922.485] (-923.993) (-924.598) -- 0:00:10
839000 -- (-922.963) [-925.301] (-925.067) (-925.880) * (-923.416) (-925.787) (-923.865) [-923.505] -- 0:00:10
839500 -- [-922.314] (-927.600) (-923.692) (-925.995) * (-925.507) (-924.571) [-924.482] (-923.691) -- 0:00:10
840000 -- [-921.956] (-922.765) (-924.942) (-924.703) * (-922.982) (-924.067) [-925.003] (-925.594) -- 0:00:10
Average standard deviation of split frequencies: 0.008096
840500 -- [-922.235] (-923.176) (-925.696) (-927.328) * (-922.682) (-925.308) [-922.616] (-925.016) -- 0:00:10
841000 -- (-923.133) (-924.222) [-927.051] (-928.122) * (-926.412) (-922.257) [-922.638] (-928.258) -- 0:00:10
841500 -- [-922.842] (-925.832) (-923.246) (-926.106) * (-930.554) (-923.181) [-923.830] (-925.730) -- 0:00:09
842000 -- [-924.916] (-925.272) (-927.550) (-923.068) * (-924.539) [-923.766] (-924.769) (-925.205) -- 0:00:09
842500 -- (-922.701) (-922.712) [-928.051] (-925.114) * (-923.108) (-923.906) (-924.937) [-925.125] -- 0:00:09
843000 -- (-923.275) (-922.708) [-924.630] (-924.748) * (-922.673) (-922.404) [-925.622] (-925.082) -- 0:00:09
843500 -- [-923.833] (-925.005) (-922.380) (-926.026) * [-923.413] (-924.828) (-922.677) (-927.109) -- 0:00:09
844000 -- (-924.305) (-926.737) [-923.001] (-924.563) * (-923.406) (-922.792) [-924.691] (-923.902) -- 0:00:09
844500 -- [-925.714] (-925.330) (-924.006) (-924.914) * [-922.305] (-924.007) (-925.577) (-924.842) -- 0:00:09
845000 -- [-923.809] (-923.002) (-922.653) (-923.123) * [-922.138] (-924.793) (-924.486) (-924.288) -- 0:00:09
Average standard deviation of split frequencies: 0.007867
845500 -- (-923.689) (-924.459) [-923.209] (-926.025) * [-924.875] (-924.187) (-926.094) (-922.229) -- 0:00:09
846000 -- (-923.790) [-926.209] (-922.920) (-923.430) * (-923.383) [-923.301] (-926.137) (-922.682) -- 0:00:09
846500 -- (-922.728) (-931.461) (-922.119) [-924.949] * (-924.160) (-924.711) [-929.460] (-922.678) -- 0:00:09
847000 -- [-921.971] (-927.383) (-923.028) (-922.747) * (-924.144) (-924.009) [-927.264] (-922.661) -- 0:00:09
847500 -- (-927.696) (-924.661) [-925.032] (-921.969) * (-924.419) [-925.448] (-925.038) (-923.878) -- 0:00:09
848000 -- (-923.253) (-928.689) [-922.935] (-921.935) * (-925.629) [-928.980] (-923.372) (-922.824) -- 0:00:09
848500 -- (-923.549) (-926.333) (-926.648) [-923.919] * (-923.900) (-923.391) (-924.950) [-923.245] -- 0:00:09
849000 -- [-925.645] (-924.703) (-926.604) (-923.180) * (-927.275) (-930.107) (-924.446) [-922.230] -- 0:00:09
849500 -- [-923.394] (-923.780) (-925.145) (-923.641) * (-926.641) [-924.587] (-924.144) (-924.650) -- 0:00:09
850000 -- [-922.854] (-925.752) (-922.911) (-924.682) * (-925.741) [-926.491] (-929.519) (-923.847) -- 0:00:09
Average standard deviation of split frequencies: 0.007966
850500 -- (-922.974) [-923.528] (-922.730) (-925.167) * (-927.340) [-923.889] (-925.291) (-923.772) -- 0:00:09
851000 -- (-924.278) (-922.472) [-923.455] (-926.415) * (-927.435) (-922.374) (-926.676) [-925.043] -- 0:00:09
851500 -- (-922.946) [-922.418] (-923.370) (-925.444) * [-927.630] (-924.557) (-923.084) (-925.273) -- 0:00:09
852000 -- (-923.445) (-923.078) [-923.097] (-922.636) * (-927.922) (-923.938) (-923.560) [-925.529] -- 0:00:09
852500 -- (-923.869) (-922.141) (-922.576) [-923.832] * (-926.125) [-926.519] (-922.774) (-925.734) -- 0:00:09
853000 -- (-924.544) (-923.066) (-926.115) [-924.540] * [-924.488] (-924.532) (-922.876) (-922.657) -- 0:00:09
853500 -- (-925.476) [-924.646] (-929.061) (-923.706) * (-928.264) (-927.719) (-923.179) [-923.232] -- 0:00:09
854000 -- [-923.610] (-924.809) (-922.793) (-926.405) * (-925.305) (-925.960) [-925.135] (-925.667) -- 0:00:09
854500 -- (-924.170) (-925.265) [-925.139] (-924.452) * [-923.338] (-927.918) (-923.278) (-926.356) -- 0:00:09
855000 -- (-922.554) [-922.377] (-926.897) (-924.497) * [-921.926] (-926.678) (-924.796) (-926.630) -- 0:00:09
Average standard deviation of split frequencies: 0.008088
855500 -- [-925.336] (-924.169) (-922.573) (-922.814) * [-923.830] (-928.367) (-924.195) (-924.528) -- 0:00:09
856000 -- (-923.346) (-927.415) (-921.976) [-922.504] * (-922.658) (-928.835) [-927.404] (-924.252) -- 0:00:09
856500 -- (-925.966) (-922.434) (-924.410) [-926.765] * [-922.655] (-923.781) (-927.111) (-928.029) -- 0:00:09
857000 -- (-925.184) [-925.994] (-926.484) (-923.069) * (-923.596) (-923.953) [-922.987] (-926.013) -- 0:00:09
857500 -- (-927.152) (-926.382) (-924.444) [-926.234] * (-924.066) (-924.301) [-924.593] (-927.887) -- 0:00:08
858000 -- (-923.661) (-923.514) [-922.493] (-922.592) * (-923.186) (-926.056) (-923.657) [-922.540] -- 0:00:08
858500 -- [-924.312] (-922.853) (-928.899) (-931.011) * [-922.940] (-928.324) (-926.413) (-922.356) -- 0:00:08
859000 -- (-924.087) (-924.054) [-924.310] (-923.526) * (-924.354) [-924.670] (-925.359) (-922.590) -- 0:00:08
859500 -- [-923.914] (-925.585) (-923.286) (-923.983) * (-923.965) [-924.053] (-923.860) (-923.103) -- 0:00:08
860000 -- [-923.010] (-924.678) (-924.978) (-924.441) * (-922.780) [-923.448] (-926.824) (-923.259) -- 0:00:08
Average standard deviation of split frequencies: 0.008319
860500 -- [-928.352] (-922.001) (-924.948) (-924.516) * (-922.764) (-925.647) (-926.042) [-922.402] -- 0:00:08
861000 -- [-925.913] (-929.479) (-923.843) (-925.792) * (-924.351) (-922.984) [-923.497] (-923.875) -- 0:00:08
861500 -- (-924.751) (-924.242) [-929.396] (-924.648) * (-922.237) [-922.753] (-925.085) (-923.117) -- 0:00:08
862000 -- (-924.352) (-921.911) (-933.703) [-922.860] * (-922.542) (-922.690) [-924.375] (-923.351) -- 0:00:08
862500 -- (-924.991) [-921.735] (-927.698) (-922.718) * (-928.920) (-923.404) [-924.107] (-924.432) -- 0:00:08
863000 -- (-922.000) (-926.340) [-924.693] (-924.012) * (-929.609) [-923.009] (-922.862) (-922.432) -- 0:00:08
863500 -- [-924.453] (-927.772) (-928.367) (-924.753) * (-935.724) (-923.621) [-922.883] (-922.756) -- 0:00:08
864000 -- (-928.283) [-924.563] (-926.220) (-924.262) * (-924.959) (-924.964) (-922.489) [-924.008] -- 0:00:08
864500 -- (-923.339) (-923.123) (-924.838) [-924.072] * (-925.945) (-922.934) [-922.334] (-923.352) -- 0:00:08
865000 -- (-927.207) [-932.993] (-925.205) (-925.940) * [-923.688] (-926.282) (-922.863) (-924.042) -- 0:00:08
Average standard deviation of split frequencies: 0.008199
865500 -- (-922.461) (-926.238) [-924.405] (-924.406) * (-925.389) (-928.242) (-928.301) [-925.854] -- 0:00:08
866000 -- (-925.491) (-927.210) (-929.150) [-924.044] * [-923.633] (-923.449) (-922.638) (-925.584) -- 0:00:08
866500 -- (-925.447) (-924.552) [-922.854] (-924.554) * (-925.336) (-926.131) (-923.403) [-922.332] -- 0:00:08
867000 -- (-924.301) (-925.055) [-924.544] (-924.507) * [-923.134] (-927.069) (-927.820) (-925.844) -- 0:00:08
867500 -- [-927.199] (-925.098) (-925.724) (-927.034) * [-923.386] (-928.913) (-928.014) (-925.629) -- 0:00:08
868000 -- (-924.740) (-922.759) (-923.407) [-923.050] * (-924.619) (-928.621) (-924.590) [-925.123] -- 0:00:08
868500 -- (-926.350) (-926.061) (-924.332) [-924.057] * (-924.424) [-924.052] (-924.080) (-922.961) -- 0:00:08
869000 -- [-926.562] (-925.045) (-923.718) (-926.273) * (-922.490) (-923.677) [-922.136] (-923.393) -- 0:00:08
869500 -- [-925.407] (-923.870) (-922.652) (-923.670) * (-922.745) (-925.119) [-921.942] (-922.670) -- 0:00:08
870000 -- (-925.891) (-923.013) (-923.965) [-923.448] * (-923.148) (-930.048) [-924.799] (-924.058) -- 0:00:08
Average standard deviation of split frequencies: 0.008257
870500 -- (-923.708) (-923.338) [-922.758] (-923.824) * (-922.993) (-926.355) [-924.000] (-923.675) -- 0:00:08
871000 -- (-929.086) [-923.448] (-922.871) (-925.664) * (-922.568) [-922.805] (-929.649) (-925.323) -- 0:00:08
871500 -- (-923.365) [-927.308] (-925.085) (-923.175) * (-924.335) (-922.748) [-924.104] (-924.965) -- 0:00:08
872000 -- (-926.624) (-927.218) [-924.681] (-923.643) * [-924.235] (-923.888) (-926.817) (-922.919) -- 0:00:08
872500 -- (-923.568) (-927.418) [-925.475] (-926.437) * (-924.440) (-921.891) (-924.095) [-924.065] -- 0:00:08
873000 -- (-926.143) [-923.775] (-923.320) (-922.382) * (-930.379) (-923.641) (-922.586) [-924.371] -- 0:00:08
873500 -- (-923.440) [-924.069] (-923.503) (-923.453) * (-926.422) (-924.038) [-922.643] (-925.043) -- 0:00:07
874000 -- [-923.827] (-925.078) (-927.634) (-923.119) * (-929.721) [-925.350] (-922.548) (-924.839) -- 0:00:07
874500 -- (-926.175) (-923.651) [-923.394] (-924.986) * (-933.053) (-922.892) [-926.080] (-926.742) -- 0:00:07
875000 -- (-925.546) (-923.263) (-927.182) [-923.617] * (-933.263) (-924.527) (-927.143) [-925.515] -- 0:00:07
Average standard deviation of split frequencies: 0.007870
875500 -- [-923.010] (-922.826) (-922.993) (-923.546) * (-923.426) (-922.736) [-924.471] (-924.101) -- 0:00:07
876000 -- [-922.364] (-924.212) (-925.055) (-924.060) * (-929.550) (-922.725) (-923.515) [-923.784] -- 0:00:07
876500 -- [-922.642] (-923.231) (-924.070) (-924.382) * (-929.089) (-922.238) [-923.632] (-924.003) -- 0:00:07
877000 -- (-922.711) [-926.068] (-925.851) (-923.905) * (-925.336) [-922.285] (-925.080) (-921.954) -- 0:00:07
877500 -- [-923.422] (-925.011) (-929.777) (-923.555) * (-927.901) (-922.638) (-927.772) [-926.916] -- 0:00:07
878000 -- (-925.632) (-923.403) [-922.678] (-925.581) * [-923.679] (-922.294) (-924.113) (-926.217) -- 0:00:07
878500 -- [-923.028] (-926.763) (-927.616) (-926.863) * [-922.597] (-923.260) (-927.173) (-924.857) -- 0:00:07
879000 -- (-924.107) (-936.245) (-926.297) [-925.038] * (-923.341) [-925.285] (-926.405) (-922.660) -- 0:00:07
879500 -- [-922.590] (-924.499) (-924.390) (-923.891) * (-922.830) (-924.294) [-923.724] (-925.789) -- 0:00:07
880000 -- (-924.342) (-924.808) (-924.374) [-922.601] * [-923.175] (-925.642) (-923.166) (-924.816) -- 0:00:07
Average standard deviation of split frequencies: 0.008196
880500 -- (-923.916) [-922.451] (-924.254) (-929.023) * (-924.781) (-923.065) [-922.452] (-922.436) -- 0:00:07
881000 -- (-924.587) (-922.393) [-929.376] (-923.341) * (-928.103) (-927.009) (-921.913) [-925.101] -- 0:00:07
881500 -- (-925.976) (-923.639) [-925.276] (-923.331) * (-922.793) (-924.053) [-922.868] (-925.557) -- 0:00:07
882000 -- (-924.975) (-923.308) [-924.204] (-923.447) * (-923.319) (-925.414) [-921.689] (-923.907) -- 0:00:07
882500 -- (-924.369) [-923.831] (-922.153) (-930.874) * [-922.899] (-924.228) (-926.984) (-922.152) -- 0:00:07
883000 -- [-922.790] (-926.435) (-922.658) (-925.886) * (-926.217) (-922.804) [-921.956] (-922.152) -- 0:00:07
883500 -- (-924.037) (-927.485) [-922.159] (-926.703) * [-924.703] (-927.408) (-923.001) (-927.883) -- 0:00:07
884000 -- [-924.218] (-927.788) (-923.618) (-926.906) * [-921.922] (-926.985) (-925.977) (-924.743) -- 0:00:07
884500 -- (-923.496) (-925.718) [-922.168] (-923.659) * (-923.549) (-923.965) [-926.625] (-928.784) -- 0:00:07
885000 -- (-926.273) (-922.176) [-923.318] (-928.412) * (-925.770) (-923.903) [-927.735] (-927.011) -- 0:00:07
Average standard deviation of split frequencies: 0.008047
885500 -- [-922.163] (-922.883) (-923.349) (-923.856) * (-925.937) (-924.872) [-923.828] (-924.073) -- 0:00:07
886000 -- (-922.099) [-925.500] (-924.065) (-924.417) * (-927.693) (-922.976) (-925.694) [-925.555] -- 0:00:07
886500 -- (-928.220) (-924.699) (-923.356) [-923.081] * (-924.448) (-926.762) (-924.249) [-925.692] -- 0:00:07
887000 -- [-923.097] (-923.017) (-923.949) (-922.979) * [-922.444] (-922.562) (-926.622) (-926.844) -- 0:00:07
887500 -- (-925.665) (-925.008) [-926.610] (-927.383) * (-923.470) (-922.349) [-923.689] (-924.496) -- 0:00:07
888000 -- (-925.178) [-925.291] (-924.540) (-922.701) * (-925.355) (-932.359) [-922.200] (-924.127) -- 0:00:07
888500 -- [-925.242] (-924.994) (-923.778) (-924.238) * (-924.471) (-926.663) [-924.362] (-923.987) -- 0:00:07
889000 -- (-923.138) [-922.212] (-923.970) (-923.131) * (-922.253) (-925.772) (-923.208) [-922.569] -- 0:00:06
889500 -- (-924.371) [-922.489] (-925.098) (-923.083) * [-923.801] (-924.088) (-926.021) (-923.039) -- 0:00:06
890000 -- [-923.104] (-922.500) (-924.560) (-924.224) * (-924.246) (-925.582) [-924.476] (-926.311) -- 0:00:06
Average standard deviation of split frequencies: 0.008038
890500 -- (-923.924) (-924.042) (-924.902) [-924.833] * (-923.765) (-924.684) [-922.188] (-925.363) -- 0:00:06
891000 -- (-924.806) [-922.854] (-922.755) (-923.160) * (-923.387) (-924.756) [-922.984] (-924.357) -- 0:00:06
891500 -- (-923.247) (-922.766) (-922.748) [-924.783] * (-922.510) [-922.049] (-922.070) (-923.582) -- 0:00:06
892000 -- (-922.673) (-925.731) (-923.072) [-925.436] * (-923.236) (-923.809) (-926.327) [-924.048] -- 0:00:06
892500 -- (-923.849) [-925.582] (-924.172) (-923.224) * [-924.984] (-922.916) (-925.964) (-923.892) -- 0:00:06
893000 -- (-922.567) (-924.224) [-926.909] (-924.239) * (-923.491) (-921.933) [-923.199] (-927.137) -- 0:00:06
893500 -- (-925.739) (-925.954) [-927.800] (-923.508) * (-927.902) [-923.803] (-923.570) (-922.142) -- 0:00:06
894000 -- (-924.960) (-924.666) (-923.890) [-926.026] * (-925.268) [-923.902] (-925.173) (-925.865) -- 0:00:06
894500 -- (-924.349) (-923.019) (-925.177) [-927.807] * (-924.964) (-923.909) [-925.091] (-924.185) -- 0:00:06
895000 -- (-929.386) (-924.619) (-922.986) [-924.167] * (-924.608) (-923.859) (-923.580) [-926.843] -- 0:00:06
Average standard deviation of split frequencies: 0.008319
895500 -- (-926.306) (-923.996) [-922.838] (-922.680) * (-922.857) (-922.954) [-923.017] (-927.730) -- 0:00:06
896000 -- (-923.779) (-924.585) (-928.640) [-923.916] * [-923.117] (-922.645) (-925.913) (-922.924) -- 0:00:06
896500 -- [-925.688] (-924.599) (-924.560) (-922.457) * (-924.122) (-923.757) [-924.404] (-922.145) -- 0:00:06
897000 -- (-927.872) [-922.569] (-928.038) (-922.229) * [-924.499] (-923.697) (-922.744) (-922.133) -- 0:00:06
897500 -- (-926.258) (-924.717) [-927.341] (-924.556) * [-926.884] (-924.021) (-923.276) (-924.400) -- 0:00:06
898000 -- (-922.051) (-922.901) [-926.094] (-924.700) * (-925.015) (-925.007) [-925.675] (-924.847) -- 0:00:06
898500 -- [-925.668] (-924.494) (-927.307) (-923.610) * (-926.567) [-925.658] (-924.559) (-923.565) -- 0:00:06
899000 -- (-925.404) [-925.785] (-925.490) (-924.074) * (-928.808) [-927.423] (-928.659) (-924.459) -- 0:00:06
899500 -- [-926.155] (-924.063) (-924.563) (-923.159) * (-924.523) (-927.166) (-922.502) [-922.114] -- 0:00:06
900000 -- (-923.503) (-923.224) (-923.865) [-924.855] * (-925.218) (-923.198) [-922.620] (-924.015) -- 0:00:06
Average standard deviation of split frequencies: 0.008080
900500 -- (-922.011) (-922.732) (-922.056) [-929.151] * (-922.512) (-922.514) [-925.669] (-925.046) -- 0:00:06
901000 -- (-923.188) (-923.842) (-923.437) [-924.615] * [-922.425] (-922.920) (-923.364) (-929.258) -- 0:00:06
901500 -- (-927.194) (-922.006) [-923.966] (-925.986) * (-921.943) (-922.977) [-923.162] (-927.247) -- 0:00:06
902000 -- (-928.194) (-924.580) [-922.689] (-928.640) * (-922.286) [-924.001] (-922.493) (-925.330) -- 0:00:06
902500 -- (-926.082) (-924.400) [-922.692] (-923.476) * (-922.093) (-925.378) (-924.187) [-930.683] -- 0:00:06
903000 -- (-925.763) (-923.959) (-926.161) [-922.419] * (-922.278) [-922.848] (-925.832) (-924.511) -- 0:00:06
903500 -- (-923.103) [-925.623] (-929.718) (-922.089) * (-924.985) [-924.371] (-925.934) (-927.683) -- 0:00:06
904000 -- [-923.491] (-924.733) (-929.739) (-922.089) * [-924.292] (-924.335) (-926.809) (-926.615) -- 0:00:06
904500 -- (-924.853) (-923.222) (-925.800) [-925.900] * (-922.666) [-922.851] (-924.379) (-925.574) -- 0:00:06
905000 -- [-924.108] (-923.443) (-923.201) (-923.076) * (-923.359) (-922.103) (-929.143) [-922.050] -- 0:00:05
Average standard deviation of split frequencies: 0.008000
905500 -- (-924.288) [-924.220] (-926.300) (-925.749) * (-924.914) (-929.076) (-925.526) [-923.325] -- 0:00:05
906000 -- [-924.211] (-923.939) (-924.010) (-926.551) * (-924.400) [-922.362] (-926.172) (-922.542) -- 0:00:05
906500 -- [-924.181] (-924.277) (-925.046) (-923.539) * (-923.489) [-926.083] (-923.653) (-923.657) -- 0:00:05
907000 -- (-925.947) [-923.632] (-923.581) (-924.532) * [-924.065] (-924.147) (-928.075) (-924.398) -- 0:00:05
907500 -- (-924.564) (-923.958) (-924.735) [-923.228] * (-929.919) (-923.445) [-924.384] (-926.256) -- 0:00:05
908000 -- (-922.430) (-925.549) [-923.053] (-925.082) * (-930.102) [-922.318] (-923.339) (-923.947) -- 0:00:05
908500 -- (-922.848) (-923.090) (-924.553) [-924.520] * (-930.152) (-924.475) (-931.217) [-922.115] -- 0:00:05
909000 -- [-925.330] (-923.673) (-924.579) (-922.559) * (-922.900) (-923.589) [-925.088] (-924.195) -- 0:00:05
909500 -- (-923.468) [-923.004] (-925.822) (-923.006) * (-924.551) [-923.629] (-926.133) (-922.963) -- 0:00:05
910000 -- (-927.335) (-923.077) (-926.017) [-923.871] * (-923.056) (-925.207) (-922.838) [-924.175] -- 0:00:05
Average standard deviation of split frequencies: 0.007700
910500 -- (-925.361) [-925.288] (-924.457) (-923.721) * [-923.278] (-923.103) (-923.671) (-923.683) -- 0:00:05
911000 -- (-921.921) (-922.635) [-922.446] (-922.224) * (-924.031) (-922.877) (-925.380) [-925.132] -- 0:00:05
911500 -- (-922.641) (-922.827) (-924.584) [-924.751] * (-923.702) [-923.305] (-927.386) (-925.405) -- 0:00:05
912000 -- [-925.101] (-924.028) (-929.245) (-930.875) * (-923.080) (-922.863) [-924.288] (-922.551) -- 0:00:05
912500 -- (-924.805) (-923.907) [-923.615] (-929.123) * (-923.819) [-923.520] (-923.090) (-922.550) -- 0:00:05
913000 -- (-923.896) [-924.061] (-924.046) (-923.112) * [-923.297] (-926.345) (-923.434) (-924.691) -- 0:00:05
913500 -- (-922.912) (-923.417) [-923.122] (-923.393) * (-923.846) (-924.308) [-922.502] (-930.246) -- 0:00:05
914000 -- (-922.342) [-923.143] (-923.493) (-926.843) * (-928.605) (-924.666) [-923.560] (-928.559) -- 0:00:05
914500 -- [-922.110] (-926.165) (-925.259) (-927.774) * (-924.534) [-923.097] (-922.562) (-923.134) -- 0:00:05
915000 -- [-924.409] (-924.669) (-926.932) (-922.618) * (-923.970) (-922.792) (-924.247) [-922.531] -- 0:00:05
Average standard deviation of split frequencies: 0.007720
915500 -- (-924.094) (-925.508) [-922.704] (-928.059) * (-923.916) (-922.488) [-923.695] (-922.483) -- 0:00:05
916000 -- (-924.029) (-923.194) (-924.695) [-926.104] * (-926.362) [-922.039] (-924.428) (-922.140) -- 0:00:05
916500 -- (-922.953) [-924.370] (-925.348) (-925.523) * (-923.290) (-922.366) [-925.360] (-922.396) -- 0:00:05
917000 -- (-924.168) [-923.007] (-923.033) (-923.286) * (-923.640) [-927.083] (-925.536) (-922.561) -- 0:00:05
917500 -- (-925.452) [-923.941] (-922.562) (-925.253) * [-923.972] (-926.735) (-924.966) (-925.296) -- 0:00:05
918000 -- (-924.884) (-926.430) [-922.922] (-925.296) * (-922.273) (-922.740) (-923.636) [-925.401] -- 0:00:05
918500 -- [-922.912] (-925.340) (-925.906) (-926.920) * (-925.490) [-922.502] (-924.525) (-928.724) -- 0:00:05
919000 -- (-922.805) [-927.497] (-922.298) (-922.315) * (-924.858) [-923.068] (-923.436) (-924.251) -- 0:00:05
919500 -- (-922.735) (-922.502) [-922.435] (-922.877) * [-923.104] (-922.850) (-923.914) (-923.308) -- 0:00:05
920000 -- (-923.432) [-924.208] (-924.318) (-922.834) * (-923.650) [-924.759] (-923.852) (-923.536) -- 0:00:05
Average standard deviation of split frequencies: 0.007456
920500 -- (-923.919) (-923.244) [-923.794] (-923.054) * [-923.112] (-923.151) (-924.964) (-923.894) -- 0:00:05
921000 -- (-923.141) (-923.524) [-923.835] (-924.908) * (-923.525) (-924.291) [-924.623] (-926.899) -- 0:00:04
921500 -- (-922.123) (-921.983) [-925.354] (-927.254) * (-924.657) (-927.728) [-922.627] (-927.125) -- 0:00:04
922000 -- (-924.450) (-922.437) [-926.589] (-925.313) * (-925.383) (-927.236) [-923.274] (-922.236) -- 0:00:04
922500 -- (-923.666) (-923.277) (-923.987) [-923.430] * [-923.835] (-926.295) (-923.249) (-922.261) -- 0:00:04
923000 -- (-928.029) [-926.823] (-922.430) (-924.191) * (-923.493) [-924.386] (-922.717) (-924.390) -- 0:00:04
923500 -- (-924.607) [-921.934] (-926.116) (-924.019) * (-923.545) (-924.509) (-923.844) [-923.165] -- 0:00:04
924000 -- (-922.532) [-922.863] (-927.953) (-924.375) * (-924.648) (-926.128) [-923.251] (-925.147) -- 0:00:04
924500 -- (-929.841) (-923.091) [-924.897] (-922.643) * (-924.228) (-927.356) (-923.377) [-923.693] -- 0:00:04
925000 -- [-921.909] (-925.265) (-925.080) (-924.916) * [-921.880] (-925.784) (-925.212) (-925.300) -- 0:00:04
Average standard deviation of split frequencies: 0.007095
925500 -- (-924.318) [-924.791] (-923.196) (-924.610) * (-922.037) [-922.553] (-926.283) (-925.920) -- 0:00:04
926000 -- (-922.608) (-926.243) (-925.017) [-924.796] * [-923.024] (-922.581) (-925.434) (-924.653) -- 0:00:04
926500 -- (-923.039) (-923.584) [-924.301] (-924.246) * (-925.529) (-922.651) (-924.277) [-923.686] -- 0:00:04
927000 -- (-925.439) [-922.657] (-925.141) (-923.921) * (-924.969) (-927.266) (-925.681) [-924.333] -- 0:00:04
927500 -- (-926.146) (-925.074) (-927.334) [-925.254] * (-922.858) [-925.763] (-927.039) (-926.596) -- 0:00:04
928000 -- (-924.444) (-924.814) (-922.717) [-921.876] * (-924.199) (-926.030) (-924.400) [-930.128] -- 0:00:04
928500 -- (-926.661) (-922.850) (-924.545) [-923.766] * (-928.303) (-926.155) [-923.460] (-927.876) -- 0:00:04
929000 -- (-922.497) [-922.902] (-927.408) (-925.832) * (-925.808) (-925.113) (-922.399) [-924.466] -- 0:00:04
929500 -- [-922.826] (-926.519) (-926.551) (-926.121) * (-923.721) (-925.374) (-923.680) [-926.422] -- 0:00:04
930000 -- (-924.679) (-924.827) (-922.801) [-926.252] * (-923.346) (-924.712) [-926.103] (-927.769) -- 0:00:04
Average standard deviation of split frequencies: 0.007376
930500 -- [-925.946] (-923.997) (-923.623) (-924.192) * (-922.884) (-924.013) (-923.945) [-924.310] -- 0:00:04
931000 -- (-922.747) [-930.904] (-922.770) (-923.265) * (-923.392) (-923.680) [-924.928] (-924.542) -- 0:00:04
931500 -- [-923.401] (-926.402) (-924.574) (-925.050) * (-923.885) [-923.135] (-926.865) (-923.336) -- 0:00:04
932000 -- [-922.378] (-930.039) (-922.621) (-924.991) * (-924.049) (-926.873) [-922.369] (-926.245) -- 0:00:04
932500 -- [-924.544] (-925.677) (-922.793) (-924.817) * (-924.119) [-926.018] (-923.496) (-923.103) -- 0:00:04
933000 -- (-924.381) [-927.395] (-923.028) (-926.710) * [-926.231] (-925.170) (-922.814) (-927.010) -- 0:00:04
933500 -- [-927.723] (-926.289) (-922.111) (-925.960) * (-927.571) (-925.815) (-923.723) [-924.317] -- 0:00:04
934000 -- (-926.838) (-925.571) [-924.893] (-928.113) * (-929.271) (-922.551) [-922.525] (-923.095) -- 0:00:04
934500 -- (-924.820) [-926.619] (-924.250) (-933.249) * [-924.346] (-922.693) (-925.345) (-928.238) -- 0:00:04
935000 -- [-922.191] (-923.484) (-924.722) (-929.345) * (-924.222) [-922.550] (-930.065) (-925.063) -- 0:00:04
Average standard deviation of split frequencies: 0.007208
935500 -- (-922.377) (-924.370) (-925.640) [-922.809] * (-924.720) [-924.246] (-929.304) (-924.524) -- 0:00:04
936000 -- (-924.506) (-922.090) (-924.403) [-923.731] * [-924.231] (-925.164) (-923.124) (-923.187) -- 0:00:04
936500 -- (-925.581) (-924.768) (-925.180) [-924.193] * [-924.073] (-923.523) (-924.351) (-924.618) -- 0:00:04
937000 -- (-922.252) (-922.968) [-925.637] (-923.360) * [-922.376] (-922.924) (-926.206) (-923.331) -- 0:00:03
937500 -- (-924.497) (-923.064) [-923.720] (-923.258) * [-923.378] (-925.171) (-922.721) (-923.363) -- 0:00:03
938000 -- (-925.035) (-923.062) [-925.117] (-924.892) * (-924.486) [-922.007] (-923.841) (-924.083) -- 0:00:03
938500 -- [-926.081] (-922.624) (-926.123) (-923.681) * (-926.183) [-924.305] (-923.072) (-924.419) -- 0:00:03
939000 -- (-926.408) (-923.898) [-925.716] (-922.420) * (-923.046) (-922.384) [-923.990] (-924.708) -- 0:00:03
939500 -- (-924.226) (-924.412) (-924.493) [-923.535] * (-922.641) (-923.591) (-925.986) [-926.083] -- 0:00:03
940000 -- (-923.314) (-923.461) [-924.719] (-924.913) * (-923.953) (-928.275) (-925.848) [-923.287] -- 0:00:03
Average standard deviation of split frequencies: 0.007110
940500 -- (-923.885) (-928.617) [-924.264] (-925.178) * [-923.564] (-923.394) (-925.603) (-924.404) -- 0:00:03
941000 -- (-927.369) [-924.386] (-922.507) (-924.613) * [-924.410] (-925.132) (-928.554) (-923.536) -- 0:00:03
941500 -- (-923.436) (-926.119) [-924.408] (-922.137) * (-925.113) (-924.174) (-923.432) [-923.536] -- 0:00:03
942000 -- [-926.142] (-925.148) (-924.977) (-923.782) * [-924.349] (-922.267) (-922.197) (-922.526) -- 0:00:03
942500 -- (-924.979) [-924.309] (-924.573) (-924.085) * (-925.010) (-922.860) [-925.069] (-923.678) -- 0:00:03
943000 -- [-923.406] (-924.379) (-924.119) (-926.128) * [-926.948] (-922.501) (-924.850) (-922.404) -- 0:00:03
943500 -- [-923.705] (-924.870) (-923.070) (-924.032) * (-923.969) [-924.222] (-924.527) (-924.710) -- 0:00:03
944000 -- (-923.341) (-925.264) [-923.273] (-925.528) * [-922.320] (-924.698) (-924.204) (-925.378) -- 0:00:03
944500 -- (-923.559) (-924.668) (-923.567) [-924.718] * (-923.393) [-923.431] (-923.224) (-923.206) -- 0:00:03
945000 -- (-924.999) [-924.294] (-922.968) (-924.583) * (-924.446) (-922.459) (-924.432) [-924.386] -- 0:00:03
Average standard deviation of split frequencies: 0.007008
945500 -- [-923.567] (-924.271) (-922.518) (-925.058) * (-925.174) (-922.504) [-924.184] (-924.428) -- 0:00:03
946000 -- (-923.984) (-924.262) [-923.911] (-924.342) * (-924.440) (-923.864) (-924.282) [-923.998] -- 0:00:03
946500 -- (-927.346) (-926.757) (-924.398) [-922.984] * (-925.893) [-922.404] (-922.739) (-924.565) -- 0:00:03
947000 -- [-922.939] (-923.744) (-923.868) (-925.780) * (-922.278) (-924.664) [-925.623] (-922.943) -- 0:00:03
947500 -- (-923.873) (-924.303) [-926.359] (-928.402) * (-923.627) [-926.298] (-924.000) (-925.932) -- 0:00:03
948000 -- (-922.849) (-923.221) (-927.266) [-923.878] * (-922.919) [-923.256] (-924.400) (-923.988) -- 0:00:03
948500 -- [-922.316] (-922.301) (-922.782) (-927.056) * [-923.241] (-925.259) (-924.178) (-924.587) -- 0:00:03
949000 -- (-922.970) (-922.442) [-923.640] (-925.148) * (-924.490) (-923.796) (-923.901) [-927.232] -- 0:00:03
949500 -- (-924.456) (-923.672) (-923.312) [-924.656] * (-927.581) [-924.294] (-926.697) (-925.703) -- 0:00:03
950000 -- (-924.465) [-924.541] (-926.518) (-922.693) * [-924.701] (-922.449) (-923.675) (-923.741) -- 0:00:03
Average standard deviation of split frequencies: 0.007097
950500 -- (-925.089) (-926.500) [-921.938] (-923.592) * (-924.977) (-923.004) (-925.142) [-926.611] -- 0:00:03
951000 -- (-922.934) (-924.796) [-922.458] (-922.710) * (-927.083) (-923.145) [-924.349] (-924.452) -- 0:00:03
951500 -- [-922.721] (-922.825) (-925.169) (-922.466) * (-924.186) (-922.715) (-928.223) [-923.251] -- 0:00:03
952000 -- (-923.338) [-922.374] (-923.218) (-923.867) * (-925.014) (-923.541) (-924.010) [-922.933] -- 0:00:03
952500 -- (-925.087) (-925.460) (-922.861) [-924.494] * (-925.827) [-922.520] (-921.822) (-924.180) -- 0:00:02
953000 -- (-923.365) (-923.286) (-924.762) [-926.464] * [-923.062] (-924.393) (-923.497) (-926.355) -- 0:00:02
953500 -- (-923.082) (-925.442) (-924.533) [-928.161] * (-923.320) (-924.628) [-928.283] (-929.991) -- 0:00:02
954000 -- (-925.534) (-925.269) (-924.363) [-926.770] * (-925.287) [-925.442] (-925.186) (-923.179) -- 0:00:02
954500 -- (-925.521) [-922.652] (-924.343) (-923.426) * (-922.461) (-925.401) (-925.915) [-923.741] -- 0:00:02
955000 -- [-926.382] (-925.545) (-925.076) (-925.800) * (-926.648) (-924.948) (-924.993) [-926.752] -- 0:00:02
Average standard deviation of split frequencies: 0.007150
955500 -- (-928.939) (-924.272) (-927.851) [-922.412] * (-923.411) [-922.902] (-921.917) (-928.607) -- 0:00:02
956000 -- (-928.425) (-926.706) [-922.202] (-922.160) * (-925.459) (-925.913) [-921.696] (-923.555) -- 0:00:02
956500 -- (-926.121) (-927.204) [-921.868] (-922.671) * [-926.158] (-922.310) (-923.265) (-923.402) -- 0:00:02
957000 -- (-924.487) (-925.904) (-923.074) [-922.681] * [-925.296] (-922.410) (-922.714) (-924.297) -- 0:00:02
957500 -- (-925.388) [-923.206] (-922.719) (-924.821) * (-925.316) [-925.399] (-922.962) (-922.691) -- 0:00:02
958000 -- (-922.667) [-922.994] (-923.341) (-924.072) * (-925.316) [-923.125] (-923.753) (-925.559) -- 0:00:02
958500 -- (-925.381) [-923.981] (-923.998) (-925.589) * (-921.840) (-923.598) [-925.027] (-923.604) -- 0:00:02
959000 -- [-923.371] (-922.691) (-923.394) (-925.917) * (-922.165) (-927.962) (-921.968) [-922.904] -- 0:00:02
959500 -- (-922.788) (-924.860) (-922.124) [-924.860] * (-923.643) (-926.829) [-924.582] (-922.748) -- 0:00:02
960000 -- (-923.342) (-922.951) (-923.654) [-925.220] * [-923.072] (-924.050) (-927.452) (-922.968) -- 0:00:02
Average standard deviation of split frequencies: 0.007545
960500 -- (-926.877) [-926.187] (-925.016) (-925.903) * (-924.936) (-922.221) [-924.702] (-923.635) -- 0:00:02
961000 -- (-924.135) [-926.556] (-926.542) (-923.913) * (-926.163) (-924.573) [-922.351] (-924.889) -- 0:00:02
961500 -- (-922.836) (-922.898) (-926.331) [-923.672] * (-926.124) [-923.838] (-923.708) (-924.180) -- 0:00:02
962000 -- (-924.439) [-923.509] (-924.309) (-923.051) * (-922.559) (-922.863) (-924.113) [-923.914] -- 0:00:02
962500 -- (-925.409) (-923.627) (-923.355) [-924.071] * (-926.392) [-923.911] (-923.915) (-929.890) -- 0:00:02
963000 -- [-923.399] (-925.437) (-924.283) (-924.641) * [-925.247] (-924.803) (-928.346) (-931.148) -- 0:00:02
963500 -- (-925.387) (-924.642) [-924.126] (-922.995) * [-923.678] (-921.939) (-924.989) (-923.059) -- 0:00:02
964000 -- (-922.895) (-925.117) [-922.522] (-927.470) * (-923.952) [-922.334] (-926.076) (-923.126) -- 0:00:02
964500 -- [-924.635] (-923.877) (-922.493) (-922.859) * (-922.775) [-924.981] (-927.263) (-922.516) -- 0:00:02
965000 -- [-925.701] (-925.330) (-923.286) (-923.258) * [-923.456] (-930.333) (-925.198) (-922.516) -- 0:00:02
Average standard deviation of split frequencies: 0.007015
965500 -- (-926.753) [-923.375] (-925.003) (-924.233) * [-923.000] (-924.390) (-924.874) (-922.968) -- 0:00:02
966000 -- (-926.892) (-923.636) (-925.838) [-923.973] * (-923.582) [-926.502] (-923.773) (-922.878) -- 0:00:02
966500 -- (-925.783) (-923.929) (-924.527) [-924.852] * (-923.575) (-924.847) [-924.735] (-923.874) -- 0:00:02
967000 -- [-925.219] (-925.034) (-927.167) (-924.846) * [-924.906] (-926.184) (-924.437) (-924.566) -- 0:00:02
967500 -- (-927.204) (-924.799) (-924.111) [-926.978] * [-923.529] (-924.905) (-926.010) (-923.391) -- 0:00:02
968000 -- [-921.899] (-924.278) (-923.783) (-922.181) * (-924.053) [-924.840] (-925.735) (-923.770) -- 0:00:02
968500 -- (-924.672) [-923.407] (-927.868) (-922.941) * (-923.581) [-925.246] (-925.361) (-925.673) -- 0:00:01
969000 -- (-922.689) (-924.431) (-923.894) [-922.907] * (-923.535) [-924.891] (-924.852) (-924.688) -- 0:00:01
969500 -- (-922.680) (-922.975) (-922.920) [-922.648] * [-923.254] (-922.436) (-925.903) (-924.430) -- 0:00:01
970000 -- (-924.374) (-922.298) (-927.074) [-922.270] * (-924.669) (-923.352) (-924.130) [-924.140] -- 0:00:01
Average standard deviation of split frequencies: 0.006981
970500 -- (-924.096) (-922.034) (-924.049) [-922.080] * (-925.438) (-928.359) (-926.046) [-922.102] -- 0:00:01
971000 -- [-924.991] (-923.140) (-925.633) (-922.080) * (-923.596) (-928.175) [-922.457] (-925.430) -- 0:00:01
971500 -- (-922.420) (-924.751) (-925.645) [-923.796] * (-925.447) [-927.738] (-923.558) (-924.511) -- 0:00:01
972000 -- [-923.329] (-922.561) (-923.514) (-922.089) * [-923.605] (-927.286) (-923.773) (-925.068) -- 0:00:01
972500 -- (-922.781) (-922.442) [-924.665] (-922.582) * (-922.249) (-925.433) [-925.571] (-924.796) -- 0:00:01
973000 -- [-926.736] (-923.511) (-922.288) (-923.954) * (-923.677) (-925.106) [-923.678] (-923.025) -- 0:00:01
973500 -- (-925.069) (-923.668) [-922.168] (-929.450) * (-925.125) [-923.076] (-922.449) (-923.174) -- 0:00:01
974000 -- (-930.344) [-924.517] (-923.495) (-926.661) * (-927.937) (-924.126) (-922.891) [-923.714] -- 0:00:01
974500 -- (-928.693) (-922.967) [-925.143] (-923.322) * [-924.198] (-923.208) (-923.118) (-925.026) -- 0:00:01
975000 -- (-925.358) [-923.918] (-924.078) (-927.644) * (-924.126) (-925.633) [-925.599] (-923.612) -- 0:00:01
Average standard deviation of split frequencies: 0.006943
975500 -- (-924.601) (-924.263) [-925.985] (-926.644) * (-922.339) (-922.748) (-925.306) [-922.688] -- 0:00:01
976000 -- (-923.489) (-925.069) [-922.303] (-924.739) * (-924.988) (-923.595) (-925.978) [-925.287] -- 0:00:01
976500 -- (-923.277) [-925.124] (-925.295) (-922.175) * [-924.017] (-923.545) (-925.649) (-925.604) -- 0:00:01
977000 -- (-929.008) (-925.184) (-926.176) [-925.629] * [-924.193] (-924.822) (-926.369) (-924.402) -- 0:00:01
977500 -- (-927.395) [-926.038] (-924.548) (-922.720) * (-924.841) (-927.319) [-924.371] (-926.565) -- 0:00:01
978000 -- (-923.673) (-926.580) [-923.373] (-927.052) * [-925.102] (-922.360) (-923.704) (-923.435) -- 0:00:01
978500 -- (-924.567) (-926.303) (-927.326) [-925.472] * (-922.565) (-923.592) (-922.378) [-922.271] -- 0:00:01
979000 -- (-922.723) [-923.356] (-925.283) (-923.559) * [-924.607] (-922.105) (-922.163) (-926.063) -- 0:00:01
979500 -- (-925.364) [-923.427] (-923.973) (-924.772) * (-927.383) (-923.106) [-923.042] (-923.212) -- 0:00:01
980000 -- [-924.841] (-923.479) (-922.663) (-923.188) * [-926.335] (-923.106) (-924.073) (-923.009) -- 0:00:01
Average standard deviation of split frequencies: 0.007271
980500 -- (-924.446) (-924.207) [-922.524] (-922.772) * (-928.221) (-924.714) [-923.133] (-924.480) -- 0:00:01
981000 -- (-924.198) (-926.318) (-922.312) [-925.967] * (-923.698) (-923.122) [-922.054] (-924.214) -- 0:00:01
981500 -- (-922.696) (-925.907) (-925.877) [-926.071] * (-927.590) [-923.455] (-923.188) (-928.466) -- 0:00:01
982000 -- (-922.864) (-923.044) (-926.991) [-926.847] * (-924.480) (-922.653) [-924.235] (-927.169) -- 0:00:01
982500 -- [-922.759] (-924.409) (-925.786) (-930.352) * (-925.355) (-924.222) [-924.501] (-926.469) -- 0:00:01
983000 -- (-925.967) (-924.466) [-925.372] (-926.422) * (-927.064) [-922.511] (-924.724) (-926.160) -- 0:00:01
983500 -- [-928.747] (-924.181) (-925.520) (-923.890) * (-925.856) [-924.128] (-923.627) (-928.640) -- 0:00:01
984000 -- [-923.574] (-926.405) (-926.263) (-925.591) * (-922.853) [-922.549] (-923.822) (-922.302) -- 0:00:01
984500 -- [-922.687] (-926.692) (-925.934) (-923.839) * (-922.271) (-922.405) (-924.766) [-922.539] -- 0:00:00
985000 -- (-927.296) (-924.235) [-923.132] (-925.492) * (-924.335) (-926.115) (-923.556) [-923.588] -- 0:00:00
Average standard deviation of split frequencies: 0.007500
985500 -- [-924.783] (-923.723) (-922.352) (-925.009) * (-925.979) [-923.467] (-923.909) (-925.705) -- 0:00:00
986000 -- (-922.539) (-924.219) [-923.544] (-923.272) * [-922.154] (-924.015) (-922.462) (-924.999) -- 0:00:00
986500 -- (-927.314) [-926.483] (-925.375) (-924.617) * [-923.852] (-922.106) (-924.668) (-924.695) -- 0:00:00
987000 -- [-926.567] (-923.736) (-927.775) (-928.200) * (-923.372) [-922.127] (-926.463) (-926.902) -- 0:00:00
987500 -- (-926.599) (-923.061) (-926.638) [-923.591] * (-922.479) (-925.986) (-929.533) [-922.771] -- 0:00:00
988000 -- (-927.456) (-927.611) [-925.378] (-925.397) * (-922.646) (-926.533) [-922.504] (-925.375) -- 0:00:00
988500 -- (-923.089) (-923.935) [-926.449] (-925.731) * (-922.951) (-922.408) [-922.610] (-925.301) -- 0:00:00
989000 -- (-928.650) [-923.523] (-924.748) (-923.334) * (-922.840) (-924.018) (-922.518) [-922.539] -- 0:00:00
989500 -- (-925.589) [-923.097] (-922.831) (-922.776) * (-928.820) (-922.826) [-926.084] (-922.577) -- 0:00:00
990000 -- [-924.513] (-922.961) (-923.430) (-930.548) * (-927.326) (-923.041) [-923.375] (-924.318) -- 0:00:00
Average standard deviation of split frequencies: 0.007518
990500 -- (-926.116) [-923.479] (-927.043) (-924.566) * [-925.957] (-922.025) (-923.465) (-928.271) -- 0:00:00
991000 -- (-925.959) (-924.700) (-926.129) [-923.318] * (-929.480) (-922.036) [-923.509] (-924.867) -- 0:00:00
991500 -- (-928.271) [-923.777] (-925.402) (-922.150) * (-926.832) (-923.538) [-923.713] (-922.608) -- 0:00:00
992000 -- (-926.122) [-923.339] (-923.874) (-923.588) * (-926.786) (-926.200) [-921.872] (-925.900) -- 0:00:00
992500 -- (-927.675) [-923.383] (-926.697) (-922.660) * (-924.518) [-925.713] (-925.667) (-923.672) -- 0:00:00
993000 -- (-925.449) (-925.545) (-925.065) [-925.106] * (-923.020) (-923.804) [-927.098] (-924.174) -- 0:00:00
993500 -- [-923.953] (-924.284) (-924.281) (-924.619) * (-922.521) [-924.062] (-925.858) (-928.647) -- 0:00:00
994000 -- (-927.770) (-924.590) (-927.945) [-924.495] * (-922.135) (-925.741) [-924.989] (-923.236) -- 0:00:00
994500 -- (-927.228) (-926.900) (-922.241) [-923.298] * (-924.127) (-923.438) (-925.860) [-925.295] -- 0:00:00
995000 -- [-923.497] (-925.880) (-923.341) (-934.086) * (-924.489) [-923.795] (-924.994) (-925.442) -- 0:00:00
Average standard deviation of split frequencies: 0.007825
995500 -- (-924.018) (-924.335) (-923.294) [-926.349] * (-922.119) [-924.415] (-924.078) (-923.343) -- 0:00:00
996000 -- [-925.392] (-923.651) (-923.897) (-922.356) * (-922.554) (-931.209) [-923.244] (-924.331) -- 0:00:00
996500 -- (-925.745) (-924.612) (-922.230) [-923.086] * (-925.703) [-921.720] (-923.042) (-925.224) -- 0:00:00
997000 -- (-924.102) (-926.235) [-922.790] (-926.530) * (-923.826) (-925.272) (-925.258) [-925.186] -- 0:00:00
997500 -- [-922.734] (-924.296) (-924.159) (-926.510) * (-925.350) [-921.735] (-922.308) (-924.307) -- 0:00:00
998000 -- (-928.588) (-923.276) (-926.608) [-922.408] * (-924.910) (-925.800) [-925.823] (-925.340) -- 0:00:00
998500 -- (-924.656) (-923.786) (-924.716) [-922.229] * [-927.355] (-924.991) (-924.969) (-924.295) -- 0:00:00
999000 -- (-922.273) (-927.056) [-923.612] (-923.019) * (-925.955) (-924.393) (-924.619) [-923.720] -- 0:00:00
999500 -- (-923.795) (-926.235) [-924.274] (-924.435) * (-923.096) (-923.359) (-922.774) [-925.401] -- 0:00:00
1000000 -- (-928.210) [-922.307] (-924.415) (-923.432) * (-926.759) (-922.523) (-927.775) [-923.297] -- 0:00:00
Average standard deviation of split frequencies: 0.007726
Analysis completed in 1 mins 3 seconds
Analysis used 62.59 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -921.66
Likelihood of best state for "cold" chain of run 2 was -921.66
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.9 % ( 22 %) Dirichlet(Pi{all})
30.4 % ( 25 %) Slider(Pi{all})
78.6 % ( 54 %) Multiplier(Alpha{1,2})
77.9 % ( 50 %) Multiplier(Alpha{3})
21.2 % ( 32 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 80 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 59 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.1 % ( 28 %) Dirichlet(Pi{all})
30.5 % ( 28 %) Slider(Pi{all})
78.5 % ( 63 %) Multiplier(Alpha{1,2})
77.6 % ( 52 %) Multiplier(Alpha{3})
20.4 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.2 % ( 83 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.6 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166941 0.82 0.67
3 | 165938 166652 0.84
4 | 166812 166910 166747
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166537 0.82 0.67
3 | 166851 166167 0.84
4 | 166894 166817 166734
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -923.50
| 1 1 2 2 |
| 1 1 12 2 1 2 2 |
| 2 2 2 |
|2 2 2 1 22 1|
| 2 * 1 2 1 2 21 1 |
| 2 1 1 1 * 11 2 2 11 111 2 1 |
| *2 2 1 222 2 2 1 2 2 211112 2 2 2|
| 22 2 11 1 2 2 2 1 212 |
| 112 2 2 1 1 2 1 |
| 2 1 2 2 1 1 1 2 2 1 |
|1 2 1 2 |
| 1 1 1 1 2 1 1 |
| 1 2 1 |
| 1 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -925.09
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -923.42 -927.46
2 -923.36 -927.41
--------------------------------------
TOTAL -923.39 -927.44
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886245 0.091007 0.354042 1.476781 0.856829 1370.23 1435.62 1.000
r(A<->C){all} 0.165023 0.020648 0.000045 0.452090 0.123932 126.59 168.83 1.000
r(A<->G){all} 0.168702 0.021566 0.000028 0.459620 0.124966 194.07 260.24 1.001
r(A<->T){all} 0.168678 0.020616 0.000075 0.447774 0.129642 205.10 221.61 1.000
r(C<->G){all} 0.171336 0.020274 0.000167 0.455112 0.137901 167.63 230.82 1.003
r(C<->T){all} 0.153119 0.017409 0.000066 0.409588 0.116758 235.34 239.04 1.000
r(G<->T){all} 0.173143 0.019989 0.000017 0.451005 0.138652 162.67 266.84 1.000
pi(A){all} 0.212814 0.000255 0.181547 0.242384 0.212645 1010.19 1046.96 1.000
pi(C){all} 0.284723 0.000305 0.252523 0.319864 0.284504 1025.06 1118.36 1.000
pi(G){all} 0.300139 0.000314 0.265258 0.333001 0.300031 976.26 1068.46 1.000
pi(T){all} 0.202324 0.000243 0.172453 0.234383 0.202104 1307.60 1320.27 1.000
alpha{1,2} 0.416738 0.232762 0.000150 1.427186 0.243712 1311.05 1364.88 1.001
alpha{3} 0.458253 0.241201 0.000251 1.447010 0.287248 1163.09 1332.05 1.000
pinvar{all} 0.997606 0.000010 0.992225 0.999999 0.998572 1338.65 1354.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- ..**..
9 -- .*.*..
10 -- ..****
11 -- .*.***
12 -- .****.
13 -- .***.*
14 -- .*...*
15 -- .**.**
16 -- .**...
17 -- ....**
18 -- .*..*.
19 -- ..*..*
20 -- ..*.*.
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 474 0.157895 0.012248 0.149234 0.166556 2
8 454 0.151233 0.010364 0.143904 0.158561 2
9 449 0.149567 0.008951 0.143238 0.155896 2
10 438 0.145903 0.000942 0.145237 0.146569 2
11 436 0.145237 0.008480 0.139241 0.151233 2
12 434 0.144570 0.007537 0.139241 0.149900 2
13 429 0.142905 0.008951 0.136576 0.149234 2
14 427 0.142239 0.008009 0.136576 0.147901 2
15 426 0.141905 0.002827 0.139907 0.143904 2
16 422 0.140573 0.000942 0.139907 0.141239 2
17 421 0.140240 0.013662 0.130580 0.149900 2
18 412 0.137242 0.012248 0.128581 0.145903 2
19 406 0.135243 0.005653 0.131246 0.139241 2
20 394 0.131246 0.007537 0.125916 0.136576 2
21 394 0.131246 0.007537 0.125916 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097684 0.009725 0.000133 0.285853 0.068544 1.000 2
length{all}[2] 0.097544 0.009440 0.000090 0.294236 0.067121 1.000 2
length{all}[3] 0.097561 0.009736 0.000006 0.299353 0.068986 1.000 2
length{all}[4] 0.096504 0.010334 0.000029 0.298878 0.063265 1.000 2
length{all}[5] 0.101238 0.010345 0.000096 0.304868 0.070639 1.000 2
length{all}[6] 0.098387 0.009408 0.000009 0.295110 0.067292 1.000 2
length{all}[7] 0.094396 0.009486 0.000191 0.276896 0.062722 0.999 2
length{all}[8] 0.100308 0.009864 0.000082 0.286241 0.070103 1.000 2
length{all}[9] 0.098352 0.008709 0.000329 0.277827 0.069206 1.007 2
length{all}[10] 0.097769 0.009705 0.000127 0.309583 0.065805 0.999 2
length{all}[11] 0.098083 0.008932 0.000740 0.262561 0.073785 1.008 2
length{all}[12] 0.097795 0.010656 0.000074 0.275263 0.068902 0.998 2
length{all}[13] 0.093348 0.010269 0.000301 0.312824 0.054958 1.002 2
length{all}[14] 0.099344 0.009482 0.000335 0.291552 0.065220 0.998 2
length{all}[15] 0.100761 0.012158 0.000138 0.324232 0.063943 0.999 2
length{all}[16] 0.100014 0.009086 0.000779 0.304510 0.069867 0.998 2
length{all}[17] 0.106101 0.010063 0.000180 0.293901 0.071288 1.002 2
length{all}[18] 0.101215 0.008497 0.000304 0.275800 0.080396 0.998 2
length{all}[19] 0.096689 0.009664 0.000120 0.262135 0.072568 0.999 2
length{all}[20] 0.097095 0.009145 0.000049 0.269711 0.068869 0.999 2
length{all}[21] 0.096876 0.009054 0.000271 0.304450 0.067030 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007726
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 672
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 224 / 224 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 224 / 224 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.041360 0.017516 0.043811 0.013428 0.045067 0.038710 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -928.792830
Iterating by ming2
Initial: fx= 928.792830
x= 0.04136 0.01752 0.04381 0.01343 0.04507 0.03871 0.30000 1.30000
1 h-m-p 0.0000 0.0001 541.0787 ++ 911.043888 m 0.0001 13 | 1/8
2 h-m-p 0.0015 0.0915 20.0935 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 494.7713 ++ 906.523983 m 0.0000 44 | 2/8
4 h-m-p 0.0004 0.1069 18.6495 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 442.4672 ++ 887.685975 m 0.0001 75 | 3/8
6 h-m-p 0.0021 0.1280 17.7393 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 384.5684 ++ 885.908621 m 0.0000 107 | 4/8
8 h-m-p 0.0003 0.1612 16.6242 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 314.0904 ++ 884.811608 m 0.0000 137 | 5/8
10 h-m-p 0.0005 0.2400 11.5489 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 222.1682 ++ 884.530405 m 0.0000 168 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 Y 884.530405 0 0.0160 179 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 Y 884.530405 0 1.6000 192
Out..
lnL = -884.530405
193 lfun, 193 eigenQcodon, 1158 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.073497 0.055913 0.052603 0.035458 0.081919 0.058804 0.300011 0.646153 0.408137
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.687648
np = 9
lnL0 = -961.947736
Iterating by ming2
Initial: fx= 961.947736
x= 0.07350 0.05591 0.05260 0.03546 0.08192 0.05880 0.30001 0.64615 0.40814
1 h-m-p 0.0000 0.0002 517.0035 +++ 916.636035 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0004 242.6604 ++ 897.708376 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0000 1594.2212 ++ 894.564363 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 2977.3407 ++ 892.485955 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 8041.4581 ++ 886.188452 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 9702.7627 ++ 884.530381 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 884.530381 m 8.0000 87 | 6/9
8 h-m-p 0.0075 0.5932 0.1311 ++++ 884.530377 m 0.5932 104 | 7/9
9 h-m-p 0.2507 8.0000 0.0669 -----------Y 884.530377 0 0.0000 130 | 7/9
10 h-m-p 0.0160 8.0000 0.0021 +++++ 884.530376 m 8.0000 147 | 7/9
11 h-m-p 0.0534 2.1192 0.3222 -----------Y 884.530376 0 0.0000 172 | 7/9
12 h-m-p 0.0160 8.0000 0.0002 +++++ 884.530375 m 8.0000 189 | 7/9
13 h-m-p 0.0042 2.1024 0.3267 ----------N 884.530375 0 0.0000 213 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 ----Y 884.530375 0 0.0000 231 | 7/9
15 h-m-p 0.0160 8.0000 0.0000 +++++ 884.530375 m 8.0000 248 | 7/9
16 h-m-p 0.0054 2.7217 0.1257 --------Y 884.530375 0 0.0000 270 | 7/9
17 h-m-p 0.0160 8.0000 0.0000 +++++ 884.530375 m 8.0000 287 | 7/9
18 h-m-p 0.0008 0.3913 1.6486 +++++ 884.530349 m 0.3913 304 | 8/9
19 h-m-p 0.2452 1.2260 0.6855 ++ 884.530304 m 1.2260 316 | 9/9
20 h-m-p 0.0160 8.0000 0.0000 Y 884.530304 0 0.0160 329
Out..
lnL = -884.530304
330 lfun, 990 eigenQcodon, 3960 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.057509 0.079357 0.095926 0.026486 0.078399 0.065090 0.000100 1.193357 0.502492 0.280083 1.396180
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.695003
np = 11
lnL0 = -968.577390
Iterating by ming2
Initial: fx= 968.577390
x= 0.05751 0.07936 0.09593 0.02649 0.07840 0.06509 0.00011 1.19336 0.50249 0.28008 1.39618
1 h-m-p 0.0000 0.0000 482.4827 ++ 967.889154 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 322.4556 +++ 935.287127 m 0.0004 31 | 2/11
3 h-m-p 0.0001 0.0003 255.9425 ++ 905.629549 m 0.0003 45 | 3/11
4 h-m-p 0.0003 0.0017 52.7098 ++ 896.853775 m 0.0017 59 | 4/11
5 h-m-p 0.0000 0.0000 7359.0763 ++ 894.281335 m 0.0000 73 | 5/11
6 h-m-p 0.0160 8.0000 10.6590 -------------.. | 5/11
7 h-m-p 0.0000 0.0000 369.9815 ++ 888.259367 m 0.0000 112 | 6/11
8 h-m-p 0.0160 8.0000 5.6616 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 308.5875 ++ 887.875802 m 0.0000 151 | 7/11
10 h-m-p 0.0160 8.0000 3.2496 -------------.. | 7/11
11 h-m-p 0.0000 0.0001 217.8442 ++ 884.530387 m 0.0001 190 | 8/11
12 h-m-p 0.1637 8.0000 0.0000 +++ 884.530387 m 8.0000 205 | 8/11
13 h-m-p 0.0213 8.0000 0.0045 +++++ 884.530387 m 8.0000 225 | 8/11
14 h-m-p 0.0160 8.0000 3.2330 ----------C 884.530387 0 0.0000 252 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 884.530387 m 8.0000 269 | 8/11
16 h-m-p 0.0037 1.8549 0.2750 +++++ 884.530383 m 1.8549 289 | 9/11
17 h-m-p 1.6000 8.0000 0.0531 Y 884.530383 0 3.1102 306 | 9/11
18 h-m-p 1.6000 8.0000 0.0012 C 884.530383 0 1.6000 322 | 9/11
19 h-m-p 1.6000 8.0000 0.0003 ----N 884.530383 0 0.0016 342 | 9/11
20 h-m-p 0.0160 8.0000 0.0008 N 884.530383 0 0.0160 358 | 9/11
21 h-m-p 0.4056 8.0000 0.0000 --N 884.530383 0 0.0063 376 | 9/11
22 h-m-p 0.1032 8.0000 0.0000 Y 884.530383 0 0.1032 392 | 9/11
23 h-m-p 0.0160 8.0000 0.0001 Y 884.530383 0 0.0040 408 | 9/11
24 h-m-p 0.0160 8.0000 0.0001 +++++ 884.530383 m 8.0000 427 | 9/11
25 h-m-p 0.0160 8.0000 0.1411 +++Y 884.530383 0 0.7593 446 | 9/11
26 h-m-p 1.6000 8.0000 0.0015 ----C 884.530383 0 0.0016 466 | 9/11
27 h-m-p 0.1702 8.0000 0.0000 +++ 884.530382 m 8.0000 483 | 9/11
28 h-m-p 0.0160 8.0000 2.2113 ----------Y 884.530382 0 0.0000 509 | 9/11
29 h-m-p 0.0160 8.0000 0.0077 +++++ 884.530381 m 8.0000 526 | 9/11
30 h-m-p 0.0309 8.0000 1.9847 ------------Y 884.530381 0 0.0000 554 | 9/11
31 h-m-p 0.0160 8.0000 0.0000 -----Y 884.530381 0 0.0000 573 | 9/11
32 h-m-p 0.0160 8.0000 0.0000 ----Y 884.530381 0 0.0000 593
Out..
lnL = -884.530381
594 lfun, 2376 eigenQcodon, 10692 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -884.546726 S = -884.527643 -0.007317
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:04
did 20 / 56 patterns 0:04
did 30 / 56 patterns 0:04
did 40 / 56 patterns 0:04
did 50 / 56 patterns 0:04
did 56 / 56 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.034435 0.077429 0.090960 0.051397 0.056295 0.051193 0.000100 0.517676 1.563922
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 20.950942
np = 9
lnL0 = -960.046542
Iterating by ming2
Initial: fx= 960.046542
x= 0.03443 0.07743 0.09096 0.05140 0.05629 0.05119 0.00011 0.51768 1.56392
1 h-m-p 0.0000 0.0000 485.8323 ++ 959.578529 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0101 51.7994 +++++ 941.276562 m 0.0101 29 | 2/9
3 h-m-p 0.0001 0.0007 208.7733 ++ 925.590537 m 0.0007 41 | 3/9
4 h-m-p 0.0002 0.0008 136.7918 ++ 911.208663 m 0.0008 53 | 4/9
5 h-m-p 0.0167 0.2383 6.4888 -------------.. | 4/9
6 h-m-p 0.0000 0.0001 421.7714 ++ 892.250148 m 0.0001 88 | 5/9
7 h-m-p 0.0231 8.0000 1.6570 -------------.. | 5/9
8 h-m-p 0.0000 0.0000 372.8905 ++ 888.776745 m 0.0000 123 | 6/9
9 h-m-p 0.0160 8.0000 1.3370 -------------.. | 6/9
10 h-m-p 0.0000 0.0000 305.1406 ++ 888.658102 m 0.0000 158 | 7/9
11 h-m-p 0.0160 8.0000 0.9324 -------------.. | 7/9
12 h-m-p 0.0000 0.0001 213.6269 ++ 884.530304 m 0.0001 195 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 N 884.530304 0 0.8000 207 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 Y 884.530304 0 1.6000 220
Out..
lnL = -884.530304
221 lfun, 2431 eigenQcodon, 13260 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.061623 0.040884 0.026400 0.073839 0.011090 0.092435 0.000100 0.900000 0.309922 1.227912 1.299989
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.735315
np = 11
lnL0 = -946.427353
Iterating by ming2
Initial: fx= 946.427353
x= 0.06162 0.04088 0.02640 0.07384 0.01109 0.09244 0.00011 0.90000 0.30992 1.22791 1.29999
1 h-m-p 0.0000 0.0000 458.4889 ++ 946.009926 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 174.7803 +++ 933.052535 m 0.0005 31 | 2/11
3 h-m-p 0.0001 0.0003 210.0757 ++ 917.743417 m 0.0003 45 | 3/11
4 h-m-p 0.0002 0.0008 216.6849 ++ 903.982657 m 0.0008 59 | 4/11
5 h-m-p 0.0000 0.0000 28093.7848 ++ 898.337764 m 0.0000 73 | 5/11
6 h-m-p 0.0007 0.0035 21.0722 ++ 897.688445 m 0.0035 87 | 6/11
7 h-m-p 0.0000 0.0002 190.1071 ++ 893.240878 m 0.0002 101 | 7/11
8 h-m-p 0.0006 0.0273 34.3190 +++ 884.530362 m 0.0273 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 884.530362 m 8.0000 130 | 8/11
10 h-m-p 0.0115 5.7325 0.1685 -------------.. | 8/11
11 h-m-p 0.0160 8.0000 0.0003 +++++ 884.530361 m 8.0000 178 | 8/11
12 h-m-p 0.0250 8.0000 0.1090 -----------Y 884.530361 0 0.0000 206 | 8/11
13 h-m-p 0.0008 0.4127 0.2237 +++++ 884.530304 m 0.4127 226 | 9/11
14 h-m-p 1.6000 8.0000 0.0000 +N 884.530304 0 6.4000 244 | 9/11
15 h-m-p 0.0001 0.0438 31.3909 +++++ 884.530304 m 0.0438 263 | 9/11
16 h-m-p -0.0000 -0.0000 0.0000
h-m-p: -0.00000000e+00 -0.00000000e+00 2.98038306e-06 884.530304
.. | 10/11
17 h-m-p 0.0160 8.0000 0.0000 --Y 884.530304 0 0.0003 292 | 10/11
18 h-m-p 0.7500 8.0000 0.0000 Y 884.530304 0 0.7500 307
Out..
lnL = -884.530304
308 lfun, 3696 eigenQcodon, 20328 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -884.590426 S = -884.531243 -0.026295
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:13
did 20 / 56 patterns 0:13
did 30 / 56 patterns 0:13
did 40 / 56 patterns 0:13
did 50 / 56 patterns 0:14
did 56 / 56 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=224
NC_011896_1_WP_010908992_1_2795_MLBR_RS13300 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
NC_002677_1_NP_302673_1_1545_ML2614 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA
**************************************************
NC_011896_1_WP_010908992_1_2795_MLBR_RS13300 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
NC_002677_1_NP_302673_1_1545_ML2614 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725 STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN
**************************************************
NC_011896_1_WP_010908992_1_2795_MLBR_RS13300 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
NC_002677_1_NP_302673_1_1545_ML2614 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725 TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI
**************************************************
NC_011896_1_WP_010908992_1_2795_MLBR_RS13300 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
NC_002677_1_NP_302673_1_1545_ML2614 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725 ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV
**************************************************
NC_011896_1_WP_010908992_1_2795_MLBR_RS13300 HWSLRLDVSDVDGKLMISHLESIR
NC_002677_1_NP_302673_1_1545_ML2614 HWSLRLDVSDVDGKLMISHLESIR
NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510 HWSLRLDVSDVDGKLMISHLESIR
NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705 HWSLRLDVSDVDGKLMISHLESIR
NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380 HWSLRLDVSDVDGKLMISHLESIR
NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725 HWSLRLDVSDVDGKLMISHLESIR
************************
>NC_011896_1_WP_010908992_1_2795_MLBR_RS13300 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT CTCTCACCTTGAGTCAATCCGA >NC_002677_1_NP_302673_1_1545_ML2614 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT CTCTCACCTTGAGTCAATCCGA >NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT CTCTCACCTTGAGTCAATCCGA >NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT CTCTCACCTTGAGTCAATCCGA >NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT CTCTCACCTTGAGTCAATCCGA >NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725 GTGAACTGGCCTAAGACGCCGGGTACCCTAGCGGCCATGCCTGACGAGGA GCAGACAGAGCTACCGGTCCACAAAGAGTTTGCCGGGATTGCCGACTACT CCGATCCTGGTCTCTCAGACGGTTCCGTCTTCTCGCAGTACGGTATCGCA TCAACCGTTCTTGCGGTGCTGTCGGCGGCCGCAGTTGTGTTCGGCGTCGT CATTTGGCGCGCACACCATGATAACTCGGCTGAACGTGCTTACCTGACTC ATGTGATGCAGACCGCGTTCGACTGGACGGGTGTGCTGATAAATATGAAC ACCAGCAATGTCGATGCCAGTTTGCAGCGGCTGCATGCCGGAACGGTCGG AGAACTTAACACTGATTTCGACGCCGCCGTTCAGCCTTACCGGAAGGTGG TTGAGAAGCTGCAGACACAAAGCAGGGGCCAGATCGAAGCGGTAGCGATC GAGTCAGTGCACCACGACCTGGATACGCAGCCCGGTGTAGCGCATCCCGT GGTGACCACCAAACTGCTACCTCCGGCGGCCCGTACCGACTCGGTGATGC TGGTAGCGACATCGGTCAGCGAGAACGTAGGAGGCAAGCCAACGACGGTG CACTGGAGCTTGCGGCTCGATGTCTCCGATGTCGATGGCAAGCTGATGAT CTCTCACCTTGAGTCAATCCGA
>NC_011896_1_WP_010908992_1_2795_MLBR_RS13300 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV HWSLRLDVSDVDGKLMISHLESIR >NC_002677_1_NP_302673_1_1545_ML2614 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV HWSLRLDVSDVDGKLMISHLESIR >NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV HWSLRLDVSDVDGKLMISHLESIR >NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV HWSLRLDVSDVDGKLMISHLESIR >NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV HWSLRLDVSDVDGKLMISHLESIR >NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725 VNWPKTPGTLAAMPDEEQTELPVHKEFAGIADYSDPGLSDGSVFSQYGIA STVLAVLSAAAVVFGVVIWRAHHDNSAERAYLTHVMQTAFDWTGVLINMN TSNVDASLQRLHAGTVGELNTDFDAAVQPYRKVVEKLQTQSRGQIEAVAI ESVHHDLDTQPGVAHPVVTTKLLPPAARTDSVMLVATSVSENVGGKPTTV HWSLRLDVSDVDGKLMISHLESIR
#NEXUS
[ID: 5743920978]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908992_1_2795_MLBR_RS13300
NC_002677_1_NP_302673_1_1545_ML2614
NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510
NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705
NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380
NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908992_1_2795_MLBR_RS13300,
2 NC_002677_1_NP_302673_1_1545_ML2614,
3 NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510,
4 NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705,
5 NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380,
6 NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06854436,2:0.06712079,3:0.06898621,4:0.06326508,5:0.07063882,6:0.06729193);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06854436,2:0.06712079,3:0.06898621,4:0.06326508,5:0.07063882,6:0.06729193);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -923.42 -927.46
2 -923.36 -927.41
--------------------------------------
TOTAL -923.39 -927.44
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2614/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886245 0.091007 0.354042 1.476781 0.856829 1370.23 1435.62 1.000
r(A<->C){all} 0.165023 0.020648 0.000045 0.452090 0.123932 126.59 168.83 1.000
r(A<->G){all} 0.168702 0.021566 0.000028 0.459620 0.124966 194.07 260.24 1.001
r(A<->T){all} 0.168678 0.020616 0.000075 0.447774 0.129642 205.10 221.61 1.000
r(C<->G){all} 0.171336 0.020274 0.000167 0.455112 0.137901 167.63 230.82 1.003
r(C<->T){all} 0.153119 0.017409 0.000066 0.409588 0.116758 235.34 239.04 1.000
r(G<->T){all} 0.173143 0.019989 0.000017 0.451005 0.138652 162.67 266.84 1.000
pi(A){all} 0.212814 0.000255 0.181547 0.242384 0.212645 1010.19 1046.96 1.000
pi(C){all} 0.284723 0.000305 0.252523 0.319864 0.284504 1025.06 1118.36 1.000
pi(G){all} 0.300139 0.000314 0.265258 0.333001 0.300031 976.26 1068.46 1.000
pi(T){all} 0.202324 0.000243 0.172453 0.234383 0.202104 1307.60 1320.27 1.000
alpha{1,2} 0.416738 0.232762 0.000150 1.427186 0.243712 1311.05 1364.88 1.001
alpha{3} 0.458253 0.241201 0.000251 1.447010 0.287248 1163.09 1332.05 1.000
pinvar{all} 0.997606 0.000010 0.992225 0.999999 0.998572 1338.65 1354.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2614/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 224
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 3 3 3 3 3 3 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 5 5 5 5 5 5 | His CAT 4 4 4 4 4 4 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 6 6 6 6 6 6 | CGC 1 1 1 1 1 1
CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 9 9 9 9 9 9 | CCG 3 3 3 3 3 3 | CAG 8 8 8 8 8 8 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 5 5 5 5 5 5 | ACC 7 7 7 7 7 7 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 4
ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 6 6 6 6 6 6 | AAG 5 5 5 5 5 5 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 2 2 2 2 2 2 | Asp GAT 8 8 8 8 8 8 | Gly GGT 6 6 6 6 6 6
GTC 9 9 9 9 9 9 | GCC 9 9 9 9 9 9 | GAC 7 7 7 7 7 7 | GGC 4 4 4 4 4 4
GTA 4 4 4 4 4 4 | GCA 3 3 3 3 3 3 | Glu GAA 3 3 3 3 3 3 | GGA 3 3 3 3 3 3
GTG 11 11 11 11 11 11 | GCG 9 9 9 9 9 9 | GAG 8 8 8 8 8 8 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908992_1_2795_MLBR_RS13300
position 1: T:0.12500 C:0.24107 A:0.22768 G:0.40625
position 2: T:0.29018 C:0.29018 A:0.28125 G:0.13839
position 3: T:0.19196 C:0.32143 A:0.12946 G:0.35714
Average T:0.20238 C:0.28423 A:0.21280 G:0.30060
#2: NC_002677_1_NP_302673_1_1545_ML2614
position 1: T:0.12500 C:0.24107 A:0.22768 G:0.40625
position 2: T:0.29018 C:0.29018 A:0.28125 G:0.13839
position 3: T:0.19196 C:0.32143 A:0.12946 G:0.35714
Average T:0.20238 C:0.28423 A:0.21280 G:0.30060
#3: NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510
position 1: T:0.12500 C:0.24107 A:0.22768 G:0.40625
position 2: T:0.29018 C:0.29018 A:0.28125 G:0.13839
position 3: T:0.19196 C:0.32143 A:0.12946 G:0.35714
Average T:0.20238 C:0.28423 A:0.21280 G:0.30060
#4: NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705
position 1: T:0.12500 C:0.24107 A:0.22768 G:0.40625
position 2: T:0.29018 C:0.29018 A:0.28125 G:0.13839
position 3: T:0.19196 C:0.32143 A:0.12946 G:0.35714
Average T:0.20238 C:0.28423 A:0.21280 G:0.30060
#5: NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380
position 1: T:0.12500 C:0.24107 A:0.22768 G:0.40625
position 2: T:0.29018 C:0.29018 A:0.28125 G:0.13839
position 3: T:0.19196 C:0.32143 A:0.12946 G:0.35714
Average T:0.20238 C:0.28423 A:0.21280 G:0.30060
#6: NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725
position 1: T:0.12500 C:0.24107 A:0.22768 G:0.40625
position 2: T:0.29018 C:0.29018 A:0.28125 G:0.13839
position 3: T:0.19196 C:0.32143 A:0.12946 G:0.35714
Average T:0.20238 C:0.28423 A:0.21280 G:0.30060
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 24 | TCC 18 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 30 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 30 | His H CAT 24 | Arg R CGT 12
CTC 12 | CCC 12 | CAC 36 | CGC 6
CTA 18 | CCA 6 | Gln Q CAA 6 | CGA 6
CTG 54 | CCG 18 | CAG 48 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 6
ATC 30 | ACC 42 | AAC 30 | AGC 24
ATA 6 | ACA 18 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 30 | ACG 36 | AAG 30 | AGG 6
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 12 | Asp D GAT 48 | Gly G GGT 36
GTC 54 | GCC 54 | GAC 42 | GGC 24
GTA 24 | GCA 18 | Glu E GAA 18 | GGA 18
GTG 66 | GCG 54 | GAG 48 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12500 C:0.24107 A:0.22768 G:0.40625
position 2: T:0.29018 C:0.29018 A:0.28125 G:0.13839
position 3: T:0.19196 C:0.32143 A:0.12946 G:0.35714
Average T:0.20238 C:0.28423 A:0.21280 G:0.30060
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -884.530405 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300011 1.299989
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908992_1_2795_MLBR_RS13300: 0.000004, NC_002677_1_NP_302673_1_1545_ML2614: 0.000004, NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510: 0.000004, NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705: 0.000004, NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380: 0.000004, NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30001
omega (dN/dS) = 1.29999
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 515.2 156.8 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 515.2 156.8 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 515.2 156.8 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 515.2 156.8 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 515.2 156.8 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 515.2 156.8 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -884.530304 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908992_1_2795_MLBR_RS13300: 0.000004, NC_002677_1_NP_302673_1_1545_ML2614: 0.000004, NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510: 0.000004, NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705: 0.000004, NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380: 0.000004, NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -884.530381 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.600150 0.271628 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908992_1_2795_MLBR_RS13300: 0.000004, NC_002677_1_NP_302673_1_1545_ML2614: 0.000004, NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510: 0.000004, NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705: 0.000004, NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380: 0.000004, NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.60015 0.27163 0.12822
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 522.7 149.3 0.3999 0.0000 0.0000 0.0 0.0
7..2 0.000 522.7 149.3 0.3999 0.0000 0.0000 0.0 0.0
7..3 0.000 522.7 149.3 0.3999 0.0000 0.0000 0.0 0.0
7..4 0.000 522.7 149.3 0.3999 0.0000 0.0000 0.0 0.0
7..5 0.000 522.7 149.3 0.3999 0.0000 0.0000 0.0 0.0
7..6 0.000 522.7 149.3 0.3999 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908992_1_2795_MLBR_RS13300)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -884.530304 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.469852
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908992_1_2795_MLBR_RS13300: 0.000004, NC_002677_1_NP_302673_1_1545_ML2614: 0.000004, NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510: 0.000004, NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705: 0.000004, NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380: 0.000004, NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.46985
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -884.530304 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.512541 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908992_1_2795_MLBR_RS13300: 0.000004, NC_002677_1_NP_302673_1_1545_ML2614: 0.000004, NZ_LVXE01000062_1_WP_010908992_1_2408_A3216_RS12510: 0.000004, NZ_LYPH01000041_1_WP_010908992_1_1612_A8144_RS07705: 0.000004, NZ_CP029543_1_WP_010908992_1_2825_DIJ64_RS14380: 0.000004, NZ_AP014567_1_WP_010908992_1_2894_JK2ML_RS14725: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.51254
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 522.7 149.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908992_1_2795_MLBR_RS13300)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.101 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Time used: 0:14
Model 1: NearlyNeutral -884.530304 Model 2: PositiveSelection -884.530381 Model 0: one-ratio -884.530405 Model 7: beta -884.530304 Model 8: beta&w>1 -884.530304 Model 0 vs 1 2.0199999994474638E-4 Model 2 vs 1 1.5400000006593473E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
