--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:00:40 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2155/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -308.38 -311.15
2 -308.40 -312.58
--------------------------------------
TOTAL -308.39 -312.10
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885931 0.090625 0.380769 1.508894 0.850759 702.69 726.85 1.000
r(A<->C){all} 0.166357 0.020241 0.000521 0.442132 0.127278 63.85 110.62 1.004
r(A<->G){all} 0.155798 0.016190 0.000006 0.399550 0.122229 52.93 106.05 1.008
r(A<->T){all} 0.166821 0.019351 0.000401 0.462733 0.130261 116.00 119.93 1.015
r(C<->G){all} 0.166465 0.019220 0.000141 0.437338 0.133497 105.46 144.44 1.003
r(C<->T){all} 0.195185 0.021309 0.000047 0.488666 0.166595 59.46 94.28 1.001
r(G<->T){all} 0.149374 0.016711 0.000120 0.411998 0.113781 87.88 105.01 1.000
pi(A){all} 0.230133 0.000764 0.178248 0.284969 0.228372 528.48 559.75 1.000
pi(C){all} 0.274402 0.000866 0.216810 0.329046 0.273752 498.70 571.10 1.000
pi(G){all} 0.274359 0.000887 0.216742 0.329853 0.273962 543.25 587.65 1.002
pi(T){all} 0.221106 0.000798 0.168479 0.279196 0.220694 673.97 712.48 1.000
alpha{1,2} 0.398940 0.207939 0.000409 1.363686 0.235392 487.34 526.48 1.001
alpha{3} 0.463759 0.241861 0.000113 1.470444 0.289739 553.80 594.88 0.999
pinvar{all} 0.992392 0.000096 0.975042 0.999986 0.995602 596.81 673.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -293.080038
Model 2: PositiveSelection -293.080059
Model 0: one-ratio -293.080036
Model 3: discrete -293.079996
Model 7: beta -293.080059
Model 8: beta&w>1 -293.080024
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 4.200000000764703E-5
Model 8 vs 7 7.000000005064066E-5
>C1
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
>C2
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
>C3
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
>C4
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
>C5
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
>C6
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=74
C1 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
C2 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
C3 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
C4 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
C5 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
C6 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
**************************************************
C1 FGDLVFPVPADDLPYVHPVTVVNR
C2 FGDLVFPVPADDLPYVHPVTVVNR
C3 FGDLVFPVPADDLPYVHPVTVVNR
C4 FGDLVFPVPADDLPYVHPVTVVNR
C5 FGDLVFPVPADDLPYVHPVTVVNR
C6 FGDLVFPVPADDLPYVHPVTVVNR
************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 74 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 74 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2220]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2220]--->[2220]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.447 Mb, Max= 30.594 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
C2 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
C3 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
C4 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
C5 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
C6 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
**************************************************
C1 FGDLVFPVPADDLPYVHPVTVVNR
C2 FGDLVFPVPADDLPYVHPVTVVNR
C3 FGDLVFPVPADDLPYVHPVTVVNR
C4 FGDLVFPVPADDLPYVHPVTVVNR
C5 FGDLVFPVPADDLPYVHPVTVVNR
C6 FGDLVFPVPADDLPYVHPVTVVNR
************************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
C2 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
C3 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
C4 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
C5 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
C6 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
**************************************************
C1 GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
C2 GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
C3 GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
C4 GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
C5 GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
C6 GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
**************************************************
C1 ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
C2 ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
C3 ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
C4 ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
C5 ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
C6 ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
**************************************************
C1 TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
C2 TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
C3 TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
C4 TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
C5 TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
C6 TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
**************************************************
C1 CCCGGTTACTGTTGTTAACCGG
C2 CCCGGTTACTGTTGTTAACCGG
C3 CCCGGTTACTGTTGTTAACCGG
C4 CCCGGTTACTGTTGTTAACCGG
C5 CCCGGTTACTGTTGTTAACCGG
C6 CCCGGTTACTGTTGTTAACCGG
**********************
>C1
ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
CCCGGTTACTGTTGTTAACCGG
>C2
ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
CCCGGTTACTGTTGTTAACCGG
>C3
ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
CCCGGTTACTGTTGTTAACCGG
>C4
ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
CCCGGTTACTGTTGTTAACCGG
>C5
ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
CCCGGTTACTGTTGTTAACCGG
>C6
ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC
GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC
ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA
TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA
CCCGGTTACTGTTGTTAACCGG
>C1
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
>C2
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
>C3
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
>C4
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
>C5
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
>C6
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
FGDLVFPVPADDLPYVHPVTVVNR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 222 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856397
Setting output file names to "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 425216273
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5089128628
Seed = 1039362489
Swapseed = 1579856397
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -496.846568 -- -24.965149
Chain 2 -- -496.846615 -- -24.965149
Chain 3 -- -496.846615 -- -24.965149
Chain 4 -- -496.846643 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -496.846568 -- -24.965149
Chain 2 -- -496.846643 -- -24.965149
Chain 3 -- -496.846615 -- -24.965149
Chain 4 -- -496.846568 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-496.847] (-496.847) (-496.847) (-496.847) * [-496.847] (-496.847) (-496.847) (-496.847)
500 -- [-315.137] (-315.017) (-318.589) (-314.823) * (-316.234) [-316.727] (-319.409) (-325.029) -- 0:00:00
1000 -- (-315.840) (-317.134) [-313.626] (-315.214) * (-317.472) [-318.438] (-322.584) (-325.783) -- 0:00:00
1500 -- (-313.042) (-324.366) [-313.143] (-317.031) * (-319.086) (-314.702) (-314.750) [-313.153] -- 0:05:32
2000 -- [-314.880] (-323.694) (-320.605) (-321.530) * [-312.982] (-334.837) (-325.029) (-319.474) -- 0:04:09
2500 -- [-316.898] (-321.384) (-320.405) (-321.159) * (-315.361) (-321.107) [-318.123] (-318.337) -- 0:03:19
3000 -- [-318.438] (-313.789) (-315.307) (-318.844) * (-317.777) (-324.590) (-316.785) [-317.428] -- 0:02:45
3500 -- [-315.649] (-312.933) (-315.917) (-316.037) * (-318.914) (-317.284) (-316.488) [-317.467] -- 0:02:21
4000 -- (-317.763) (-318.845) [-315.216] (-314.351) * (-319.792) (-314.658) [-315.268] (-317.000) -- 0:02:04
4500 -- (-332.410) (-318.561) (-319.845) [-320.102] * (-318.593) (-322.227) (-317.901) [-315.901] -- 0:01:50
5000 -- (-322.073) (-319.396) (-320.932) [-318.796] * (-325.858) (-318.549) [-315.020] (-320.113) -- 0:01:39
Average standard deviation of split frequencies: 0.107137
5500 -- (-322.373) (-319.226) [-323.759] (-326.386) * (-322.902) (-321.412) [-316.149] (-320.000) -- 0:01:29
6000 -- (-316.993) (-328.776) (-315.423) [-313.894] * (-324.775) (-313.954) [-315.202] (-319.612) -- 0:01:22
6500 -- (-318.365) (-323.944) [-320.766] (-317.820) * (-334.083) (-318.655) (-320.753) [-319.232] -- 0:01:15
7000 -- (-313.613) [-317.786] (-317.734) (-319.493) * (-311.298) [-316.406] (-321.841) (-319.929) -- 0:01:10
7500 -- (-320.216) [-322.242] (-319.634) (-323.053) * (-309.577) [-314.497] (-317.057) (-321.680) -- 0:01:05
8000 -- (-324.879) (-318.922) (-319.468) [-316.333] * (-309.625) (-325.120) [-315.646] (-317.761) -- 0:01:01
8500 -- (-320.434) (-320.598) [-316.463] (-322.707) * (-311.982) [-317.711] (-320.197) (-323.309) -- 0:00:57
9000 -- (-316.650) (-321.907) [-319.441] (-314.835) * (-309.785) (-310.935) [-321.798] (-321.923) -- 0:00:54
9500 -- (-320.236) [-313.995] (-318.715) (-318.110) * (-310.876) (-307.497) [-314.871] (-320.763) -- 0:00:51
10000 -- (-318.279) (-318.455) [-317.385] (-327.613) * [-309.121] (-308.553) (-317.653) (-316.947) -- 0:00:49
Average standard deviation of split frequencies: 0.028726
10500 -- [-317.012] (-324.504) (-317.466) (-312.939) * (-309.142) (-310.268) (-317.144) [-321.403] -- 0:00:46
11000 -- (-332.770) (-319.089) (-316.518) [-307.668] * (-308.579) (-311.090) [-312.743] (-315.765) -- 0:00:44
11500 -- [-321.015] (-318.725) (-318.266) (-308.047) * (-307.452) [-309.246] (-309.007) (-319.201) -- 0:00:42
12000 -- (-329.263) [-318.438] (-319.451) (-311.668) * (-310.676) (-312.695) [-309.063] (-321.991) -- 0:00:40
12500 -- (-326.586) (-317.793) [-315.805] (-312.537) * (-311.260) [-307.221] (-311.377) (-315.898) -- 0:00:39
13000 -- (-311.247) [-321.944] (-326.095) (-311.655) * (-309.600) (-310.177) [-311.212] (-312.826) -- 0:00:37
13500 -- (-311.613) (-328.373) (-319.368) [-314.309] * (-312.076) (-308.032) (-307.319) [-318.935] -- 0:00:36
14000 -- [-307.200] (-332.644) (-324.789) (-307.761) * (-308.555) [-308.146] (-308.920) (-323.002) -- 0:00:34
14500 -- (-310.151) (-325.878) (-326.402) [-307.941] * (-307.829) (-307.346) [-309.276] (-316.054) -- 0:00:33
15000 -- (-310.245) (-321.740) [-315.425] (-310.206) * (-313.348) [-307.526] (-308.159) (-319.578) -- 0:00:32
Average standard deviation of split frequencies: 0.053401
15500 -- (-308.673) (-315.539) (-322.345) [-310.541] * (-309.165) [-308.448] (-308.683) (-318.778) -- 0:00:31
16000 -- [-308.791] (-311.881) (-320.863) (-311.234) * (-307.501) (-310.155) (-308.100) [-317.992] -- 0:00:30
16500 -- (-312.725) (-311.536) [-320.614] (-309.695) * (-307.235) [-307.801] (-309.866) (-318.915) -- 0:00:29
17000 -- (-312.340) (-309.185) [-326.441] (-309.008) * [-314.630] (-309.827) (-312.611) (-323.478) -- 0:00:28
17500 -- [-310.466] (-309.726) (-324.520) (-309.166) * (-312.449) (-309.755) (-309.150) [-309.639] -- 0:00:55
18000 -- (-308.347) [-310.937] (-319.545) (-308.284) * [-307.528] (-313.494) (-312.724) (-308.882) -- 0:00:53
18500 -- (-308.546) [-308.906] (-317.689) (-310.302) * [-308.236] (-312.748) (-314.947) (-311.052) -- 0:00:52
19000 -- (-312.740) (-310.483) (-318.267) [-307.098] * (-308.742) (-309.504) [-310.962] (-312.483) -- 0:00:50
19500 -- (-308.226) (-311.323) [-314.426] (-307.965) * (-308.389) [-308.639] (-310.753) (-314.692) -- 0:00:49
20000 -- [-310.479] (-310.828) (-318.346) (-309.031) * (-308.011) (-310.328) (-308.408) [-309.316] -- 0:00:48
Average standard deviation of split frequencies: 0.048303
20500 -- [-309.068] (-307.453) (-317.645) (-308.151) * (-308.199) (-307.045) [-307.369] (-308.592) -- 0:00:46
21000 -- [-309.074] (-313.396) (-322.258) (-308.520) * [-308.435] (-310.524) (-308.420) (-308.109) -- 0:00:45
21500 -- (-308.453) [-307.593] (-319.410) (-310.733) * [-308.698] (-307.353) (-308.792) (-308.141) -- 0:00:44
22000 -- (-309.257) [-307.217] (-321.484) (-308.640) * (-308.164) (-307.632) (-309.139) [-308.295] -- 0:00:43
22500 -- (-309.587) (-308.807) [-319.828] (-311.574) * [-308.830] (-307.962) (-308.309) (-309.739) -- 0:00:42
23000 -- (-307.688) (-310.293) [-315.819] (-310.992) * (-309.028) [-309.328] (-309.328) (-310.818) -- 0:00:41
23500 -- [-308.200] (-311.226) (-331.450) (-314.085) * (-310.008) (-307.512) [-309.369] (-311.613) -- 0:00:40
24000 -- [-313.683] (-308.533) (-318.992) (-308.638) * [-308.889] (-309.702) (-308.593) (-308.041) -- 0:00:39
24500 -- (-312.763) (-308.506) [-318.575] (-308.377) * [-311.605] (-310.921) (-309.473) (-311.240) -- 0:00:38
25000 -- (-308.242) (-307.959) [-321.389] (-307.519) * (-307.727) (-311.142) [-310.982] (-310.071) -- 0:00:38
Average standard deviation of split frequencies: 0.042031
25500 -- [-309.806] (-307.318) (-325.305) (-308.327) * (-312.134) (-309.612) [-309.557] (-306.714) -- 0:00:37
26000 -- (-308.964) (-308.147) (-321.616) [-308.259] * (-311.126) [-308.308] (-308.620) (-313.703) -- 0:00:36
26500 -- (-307.774) (-312.855) [-314.826] (-307.466) * [-309.067] (-316.535) (-309.457) (-311.093) -- 0:00:35
27000 -- (-308.644) (-311.491) [-318.153] (-307.609) * (-308.457) (-315.390) (-309.039) [-310.123] -- 0:00:35
27500 -- (-307.101) (-313.394) [-315.218] (-307.330) * (-308.323) (-315.284) (-307.837) [-310.476] -- 0:00:34
28000 -- (-308.822) (-312.938) [-315.876] (-310.252) * (-309.238) [-309.247] (-308.346) (-309.023) -- 0:00:33
28500 -- (-308.713) (-311.967) [-314.502] (-312.934) * (-308.981) (-310.093) (-310.363) [-308.103] -- 0:00:33
29000 -- (-309.934) (-309.555) [-318.483] (-310.866) * (-309.329) [-310.537] (-309.290) (-309.740) -- 0:00:32
29500 -- [-308.858] (-307.436) (-321.588) (-308.507) * (-312.024) (-308.988) [-312.387] (-308.907) -- 0:00:31
30000 -- [-308.420] (-309.447) (-319.068) (-307.835) * (-310.464) (-307.395) [-310.426] (-309.537) -- 0:00:31
Average standard deviation of split frequencies: 0.032940
30500 -- (-311.652) [-309.060] (-319.289) (-312.168) * (-309.259) (-311.358) (-309.959) [-309.930] -- 0:00:30
31000 -- (-310.928) (-311.542) (-328.377) [-308.384] * [-310.089] (-307.371) (-312.093) (-314.130) -- 0:00:30
31500 -- (-308.671) (-310.451) (-329.462) [-308.115] * (-311.248) (-309.714) (-310.056) [-313.443] -- 0:00:29
32000 -- (-310.133) (-307.732) [-316.977] (-309.922) * (-307.388) (-308.361) [-308.002] (-308.927) -- 0:00:29
32500 -- (-308.397) (-307.442) [-314.544] (-309.369) * (-308.730) (-311.107) (-310.044) [-311.026] -- 0:00:28
33000 -- [-307.460] (-308.750) (-308.691) (-307.636) * (-309.502) (-307.484) (-313.331) [-309.589] -- 0:00:28
33500 -- (-310.280) [-308.676] (-308.036) (-310.296) * (-308.126) [-309.479] (-308.597) (-309.934) -- 0:00:27
34000 -- (-310.727) [-310.695] (-310.314) (-311.025) * (-309.285) (-309.072) (-308.693) [-307.142] -- 0:00:27
34500 -- (-313.673) (-307.835) [-309.290] (-314.035) * (-308.638) [-306.917] (-307.887) (-309.142) -- 0:00:26
35000 -- (-309.605) [-309.450] (-308.735) (-316.120) * (-308.779) [-312.226] (-308.790) (-307.537) -- 0:00:39
Average standard deviation of split frequencies: 0.037320
35500 -- (-310.770) (-311.759) (-307.425) [-308.659] * (-310.269) [-308.740] (-309.112) (-307.256) -- 0:00:39
36000 -- (-311.562) (-312.008) (-310.579) [-308.373] * (-308.836) [-307.354] (-310.323) (-308.674) -- 0:00:38
36500 -- (-308.193) (-310.473) (-310.051) [-307.369] * (-312.087) [-313.560] (-308.654) (-312.900) -- 0:00:38
37000 -- (-307.872) [-307.881] (-308.857) (-309.010) * [-308.897] (-307.481) (-312.722) (-309.442) -- 0:00:37
37500 -- (-311.596) (-309.906) (-308.748) [-309.451] * (-310.879) [-308.023] (-309.578) (-310.449) -- 0:00:37
38000 -- (-307.211) [-307.738] (-314.180) (-308.835) * (-309.798) (-308.612) [-308.467] (-310.078) -- 0:00:36
38500 -- (-312.100) (-310.245) (-307.508) [-308.117] * (-310.376) (-308.988) (-308.541) [-308.326] -- 0:00:35
39000 -- [-308.286] (-310.657) (-309.038) (-308.130) * [-307.643] (-307.570) (-309.535) (-308.474) -- 0:00:35
39500 -- (-310.500) (-310.339) (-309.667) [-309.076] * (-309.136) (-315.166) [-311.181] (-309.401) -- 0:00:34
40000 -- (-310.757) [-307.363] (-307.396) (-309.643) * [-308.046] (-310.354) (-309.584) (-312.121) -- 0:00:34
Average standard deviation of split frequencies: 0.033617
40500 -- (-308.989) (-307.905) (-310.269) [-308.166] * (-307.618) [-309.501] (-307.639) (-314.695) -- 0:00:34
41000 -- (-308.064) (-308.521) [-310.476] (-307.568) * (-309.284) [-309.725] (-311.037) (-307.731) -- 0:00:33
41500 -- (-308.977) (-309.168) [-307.658] (-307.883) * (-308.933) (-309.643) [-309.642] (-310.697) -- 0:00:33
42000 -- (-311.060) (-307.420) [-307.201] (-308.008) * [-308.184] (-309.019) (-311.960) (-310.646) -- 0:00:32
42500 -- (-309.538) (-307.242) [-309.586] (-307.190) * (-308.464) (-310.967) [-308.110] (-307.696) -- 0:00:32
43000 -- [-307.253] (-310.032) (-307.557) (-307.858) * (-308.604) [-316.076] (-310.786) (-308.404) -- 0:00:31
43500 -- (-314.719) [-307.932] (-308.534) (-308.341) * (-307.934) (-313.547) (-308.275) [-310.458] -- 0:00:31
44000 -- (-308.875) [-310.171] (-309.252) (-309.543) * (-307.169) [-308.512] (-309.404) (-310.491) -- 0:00:31
44500 -- (-311.123) [-308.536] (-312.831) (-309.255) * (-307.741) (-306.796) [-312.524] (-312.249) -- 0:00:30
45000 -- (-309.568) (-308.297) [-310.015] (-310.493) * (-309.662) [-306.878] (-309.979) (-308.538) -- 0:00:30
Average standard deviation of split frequencies: 0.032607
45500 -- (-311.602) (-308.435) [-309.284] (-308.518) * (-313.359) (-307.094) (-309.804) [-310.934] -- 0:00:29
46000 -- [-309.971] (-307.966) (-311.866) (-312.830) * (-313.094) [-310.904] (-307.657) (-312.304) -- 0:00:29
46500 -- [-310.399] (-311.235) (-315.536) (-311.614) * (-311.550) (-310.117) [-308.820] (-312.795) -- 0:00:29
47000 -- (-324.401) (-307.285) (-311.389) [-309.873] * (-310.211) (-310.957) [-311.374] (-308.951) -- 0:00:28
47500 -- (-309.811) [-309.996] (-308.562) (-309.693) * (-309.439) [-308.507] (-316.025) (-307.132) -- 0:00:28
48000 -- (-309.177) [-307.731] (-309.404) (-314.613) * (-307.049) (-308.482) (-312.354) [-308.486] -- 0:00:28
48500 -- (-309.968) (-312.020) [-307.657] (-309.571) * (-309.103) (-310.258) (-311.032) [-307.661] -- 0:00:37
49000 -- [-308.006] (-308.427) (-308.092) (-308.047) * (-308.293) (-310.146) [-307.145] (-308.812) -- 0:00:36
49500 -- (-309.821) (-311.349) [-308.610] (-307.905) * [-308.306] (-308.940) (-307.328) (-308.911) -- 0:00:36
50000 -- (-316.851) (-308.976) [-308.918] (-311.796) * (-310.226) (-310.306) (-308.277) [-309.106] -- 0:00:36
Average standard deviation of split frequencies: 0.030703
50500 -- (-307.554) [-308.292] (-315.250) (-307.686) * (-313.481) (-310.537) [-308.435] (-312.058) -- 0:00:35
51000 -- (-309.263) (-308.188) [-309.405] (-309.900) * [-309.522] (-309.558) (-306.781) (-310.400) -- 0:00:35
51500 -- [-310.313] (-310.825) (-307.537) (-309.452) * [-307.239] (-309.806) (-307.916) (-307.332) -- 0:00:34
52000 -- [-307.178] (-310.497) (-308.004) (-311.898) * (-309.376) [-309.190] (-308.659) (-311.105) -- 0:00:34
52500 -- (-308.895) (-310.755) (-312.017) [-308.589] * [-308.662] (-312.803) (-307.717) (-309.112) -- 0:00:34
53000 -- (-310.056) (-307.806) (-309.363) [-308.385] * (-310.208) (-312.173) [-309.171] (-308.458) -- 0:00:33
53500 -- (-310.515) (-308.591) (-311.259) [-311.108] * (-308.849) (-307.961) [-310.288] (-308.997) -- 0:00:33
54000 -- (-308.206) (-310.163) (-308.446) [-307.277] * [-308.306] (-312.557) (-308.916) (-308.491) -- 0:00:33
54500 -- (-308.356) (-310.097) [-311.502] (-308.354) * (-315.700) [-309.364] (-308.242) (-307.323) -- 0:00:32
55000 -- [-307.813] (-308.228) (-310.364) (-307.721) * (-309.703) (-310.883) [-307.724] (-309.552) -- 0:00:32
Average standard deviation of split frequencies: 0.032409
55500 -- (-309.136) (-307.282) [-310.415] (-310.919) * (-309.924) (-308.989) (-308.951) [-307.913] -- 0:00:32
56000 -- (-311.519) (-307.676) (-308.224) [-310.096] * (-310.807) [-307.634] (-309.241) (-307.886) -- 0:00:31
56500 -- (-311.597) (-309.095) (-310.838) [-307.085] * (-307.285) [-308.141] (-309.938) (-308.883) -- 0:00:31
57000 -- (-309.905) (-311.067) (-308.088) [-307.625] * (-308.228) (-309.121) (-311.678) [-307.329] -- 0:00:31
57500 -- [-308.126] (-309.444) (-307.737) (-308.190) * (-310.719) (-309.439) (-311.633) [-307.880] -- 0:00:30
58000 -- (-307.434) [-309.330] (-308.282) (-312.589) * (-308.823) (-307.885) [-313.055] (-310.544) -- 0:00:30
58500 -- (-308.781) [-309.689] (-315.710) (-309.403) * (-311.803) (-307.567) (-310.046) [-310.153] -- 0:00:30
59000 -- (-309.000) (-308.238) [-310.665] (-310.386) * (-309.732) (-307.257) [-308.451] (-315.465) -- 0:00:29
59500 -- (-307.985) (-307.574) (-307.828) [-307.793] * (-308.059) [-307.749] (-310.393) (-307.677) -- 0:00:29
60000 -- (-317.198) [-307.249] (-311.012) (-307.523) * (-309.948) (-309.538) (-309.756) [-306.844] -- 0:00:29
Average standard deviation of split frequencies: 0.037298
60500 -- [-310.270] (-308.181) (-311.829) (-309.159) * (-314.617) (-310.789) [-313.154] (-307.589) -- 0:00:29
61000 -- [-311.002] (-308.706) (-308.580) (-309.020) * (-311.346) (-307.843) [-309.169] (-309.076) -- 0:00:28
61500 -- (-309.897) (-312.904) (-308.345) [-312.430] * [-310.137] (-307.668) (-307.376) (-308.751) -- 0:00:28
62000 -- (-309.374) [-307.637] (-308.210) (-309.993) * (-310.973) (-308.172) (-315.626) [-307.980] -- 0:00:28
62500 -- (-308.962) [-310.066] (-309.353) (-308.147) * [-311.908] (-308.651) (-310.135) (-307.719) -- 0:00:28
63000 -- [-309.220] (-311.875) (-311.014) (-308.157) * [-309.662] (-308.706) (-309.153) (-307.889) -- 0:00:27
63500 -- (-311.997) (-308.802) [-312.908] (-308.194) * (-308.577) (-308.297) [-308.605] (-309.406) -- 0:00:27
64000 -- (-312.258) (-308.273) (-308.339) [-309.470] * (-310.176) (-307.300) (-307.784) [-309.953] -- 0:00:27
64500 -- [-308.545] (-308.187) (-308.288) (-307.738) * [-308.532] (-309.917) (-308.243) (-308.534) -- 0:00:33
65000 -- (-309.812) (-307.437) (-308.462) [-308.791] * (-308.617) (-310.197) [-308.831] (-307.980) -- 0:00:33
Average standard deviation of split frequencies: 0.031971
65500 -- [-309.750] (-308.002) (-313.704) (-308.592) * (-308.626) (-311.053) (-310.240) [-310.372] -- 0:00:33
66000 -- (-308.907) [-308.364] (-309.614) (-307.608) * (-311.245) [-309.648] (-312.930) (-310.086) -- 0:00:32
66500 -- (-309.235) [-308.998] (-308.457) (-309.597) * (-310.007) (-313.907) [-313.533] (-308.335) -- 0:00:32
67000 -- (-307.481) [-308.315] (-311.143) (-310.758) * (-309.516) [-310.528] (-312.932) (-307.469) -- 0:00:32
67500 -- (-309.811) (-308.980) (-309.413) [-311.754] * (-308.951) [-309.553] (-308.683) (-310.106) -- 0:00:32
68000 -- [-308.078] (-309.041) (-308.040) (-308.754) * [-312.389] (-308.758) (-308.922) (-310.505) -- 0:00:31
68500 -- (-310.686) (-310.553) (-309.510) [-309.594] * [-308.462] (-308.212) (-308.650) (-311.620) -- 0:00:31
69000 -- (-307.762) (-309.768) [-309.194] (-309.391) * (-307.745) [-307.460] (-307.387) (-310.700) -- 0:00:31
69500 -- (-307.195) (-307.911) [-313.706] (-310.086) * (-309.573) [-306.949] (-311.854) (-308.680) -- 0:00:30
70000 -- (-309.436) (-307.875) [-308.973] (-307.453) * (-308.191) (-309.440) [-307.689] (-310.905) -- 0:00:30
Average standard deviation of split frequencies: 0.033354
70500 -- (-307.813) (-307.263) [-308.980] (-307.220) * (-308.531) (-308.110) (-308.166) [-309.178] -- 0:00:30
71000 -- (-312.244) [-308.640] (-309.542) (-308.499) * (-308.305) (-309.107) (-308.000) [-309.780] -- 0:00:30
71500 -- (-309.553) (-309.872) (-314.596) [-309.554] * (-310.590) (-310.803) [-308.490] (-312.948) -- 0:00:29
72000 -- [-307.676] (-313.683) (-308.200) (-308.903) * [-307.050] (-308.775) (-310.292) (-307.402) -- 0:00:29
72500 -- (-307.742) (-310.950) [-308.598] (-308.127) * (-308.936) (-308.615) (-309.343) [-308.716] -- 0:00:29
73000 -- (-312.195) (-309.871) (-311.448) [-312.165] * (-309.463) (-307.622) (-308.267) [-308.883] -- 0:00:29
73500 -- [-307.589] (-309.710) (-308.541) (-307.566) * (-309.747) (-309.981) (-308.646) [-308.278] -- 0:00:29
74000 -- (-309.686) [-307.554] (-308.204) (-309.761) * (-309.837) [-308.101] (-308.366) (-309.089) -- 0:00:28
74500 -- (-308.877) (-307.007) (-311.145) [-306.967] * (-308.585) (-310.184) [-311.022] (-311.376) -- 0:00:28
75000 -- (-309.122) [-309.375] (-309.155) (-307.024) * [-308.113] (-308.416) (-308.768) (-311.683) -- 0:00:28
Average standard deviation of split frequencies: 0.033625
75500 -- [-307.500] (-309.616) (-310.837) (-312.274) * (-307.295) (-312.252) [-308.924] (-308.277) -- 0:00:28
76000 -- (-308.157) [-307.961] (-312.475) (-309.275) * (-309.797) [-312.201] (-309.099) (-317.384) -- 0:00:27
76500 -- (-308.012) (-307.141) [-307.439] (-308.151) * (-312.284) [-308.182] (-308.664) (-307.967) -- 0:00:27
77000 -- [-309.357] (-308.381) (-308.438) (-308.827) * (-309.980) (-307.847) [-310.516] (-308.735) -- 0:00:27
77500 -- (-311.445) [-309.527] (-308.131) (-307.742) * (-310.188) [-309.073] (-309.059) (-312.873) -- 0:00:27
78000 -- (-308.457) (-308.705) [-308.036] (-310.213) * (-308.019) (-310.337) [-309.253] (-308.156) -- 0:00:27
78500 -- (-309.784) (-309.955) (-308.873) [-309.600] * (-309.944) [-307.793] (-316.617) (-308.799) -- 0:00:26
79000 -- (-309.160) (-309.272) (-313.324) [-307.341] * (-310.493) [-309.401] (-308.219) (-308.186) -- 0:00:26
79500 -- (-307.396) (-309.091) [-310.105] (-308.414) * (-308.650) (-307.442) (-310.314) [-313.274] -- 0:00:26
80000 -- (-309.662) (-309.081) (-309.431) [-308.584] * (-309.954) (-308.158) (-310.727) [-307.897] -- 0:00:26
Average standard deviation of split frequencies: 0.032791
80500 -- (-311.223) [-309.350] (-311.112) (-309.469) * (-307.398) (-308.140) (-311.857) [-309.609] -- 0:00:26
81000 -- (-309.529) (-309.811) (-312.716) [-307.897] * (-309.196) [-307.786] (-314.704) (-311.074) -- 0:00:25
81500 -- [-307.656] (-310.070) (-309.046) (-308.323) * [-308.846] (-307.114) (-309.034) (-307.632) -- 0:00:25
82000 -- (-310.881) (-311.497) [-312.836] (-307.045) * (-312.275) [-308.937] (-314.225) (-308.851) -- 0:00:30
82500 -- [-308.257] (-308.501) (-308.681) (-308.817) * (-307.375) [-309.582] (-307.936) (-309.900) -- 0:00:30
83000 -- (-308.698) (-308.879) (-309.361) [-310.971] * (-310.542) [-308.970] (-307.820) (-309.676) -- 0:00:30
83500 -- (-308.898) (-309.063) [-310.983] (-309.827) * (-308.325) [-307.577] (-308.272) (-309.111) -- 0:00:29
84000 -- (-308.932) [-307.034] (-308.649) (-310.103) * (-308.316) [-312.307] (-306.908) (-308.491) -- 0:00:29
84500 -- (-307.609) [-307.662] (-308.403) (-310.420) * [-308.799] (-311.451) (-307.288) (-307.139) -- 0:00:29
85000 -- (-307.426) (-308.012) [-308.041] (-308.218) * (-307.084) [-307.898] (-308.500) (-309.078) -- 0:00:29
Average standard deviation of split frequencies: 0.024536
85500 -- (-307.535) (-308.037) (-307.461) [-308.893] * (-308.283) [-308.764] (-308.477) (-310.818) -- 0:00:29
86000 -- (-309.453) [-311.097] (-307.103) (-308.324) * (-310.321) (-311.388) [-307.779] (-307.830) -- 0:00:28
86500 -- (-311.239) (-311.161) [-309.785] (-311.435) * (-310.821) (-308.620) (-308.930) [-310.172] -- 0:00:28
87000 -- [-306.948] (-308.725) (-306.989) (-307.687) * (-307.987) [-310.026] (-311.223) (-309.797) -- 0:00:28
87500 -- (-309.180) (-311.741) (-307.152) [-308.024] * (-308.128) (-307.968) (-308.187) [-309.558] -- 0:00:28
88000 -- [-311.170] (-309.561) (-308.791) (-307.086) * [-311.336] (-308.272) (-309.695) (-307.744) -- 0:00:28
88500 -- (-308.780) [-308.027] (-307.908) (-309.193) * (-313.311) (-307.039) (-309.097) [-309.064] -- 0:00:27
89000 -- [-309.472] (-307.783) (-310.398) (-311.281) * (-312.042) (-307.923) (-310.052) [-308.529] -- 0:00:27
89500 -- (-308.713) [-307.944] (-310.277) (-308.111) * (-310.490) [-310.751] (-308.632) (-311.524) -- 0:00:27
90000 -- (-309.037) (-311.211) (-309.588) [-308.437] * (-307.297) (-310.481) (-312.620) [-308.043] -- 0:00:27
Average standard deviation of split frequencies: 0.024511
90500 -- [-308.371] (-309.143) (-309.354) (-308.561) * (-307.745) (-309.078) [-311.285] (-307.027) -- 0:00:27
91000 -- (-311.323) [-308.759] (-308.587) (-307.443) * (-309.391) [-307.883] (-307.282) (-308.603) -- 0:00:26
91500 -- (-308.209) (-309.653) (-310.648) [-314.788] * [-308.340] (-308.996) (-311.254) (-309.794) -- 0:00:26
92000 -- (-308.133) (-307.727) (-312.259) [-308.656] * (-311.059) [-307.947] (-308.813) (-309.796) -- 0:00:26
92500 -- (-316.797) [-309.142] (-312.692) (-310.093) * (-313.356) (-308.391) [-307.067] (-312.598) -- 0:00:26
93000 -- (-309.794) (-310.421) [-307.635] (-308.462) * (-309.378) (-309.427) (-309.134) [-310.107] -- 0:00:26
93500 -- (-309.174) [-308.265] (-310.733) (-308.400) * (-308.619) (-310.715) (-312.017) [-307.241] -- 0:00:26
94000 -- (-308.147) (-308.811) (-312.678) [-311.622] * (-311.973) (-309.527) (-309.871) [-308.691] -- 0:00:25
94500 -- [-311.979] (-307.511) (-310.470) (-311.104) * [-310.777] (-309.190) (-310.839) (-308.308) -- 0:00:25
95000 -- (-311.448) [-309.396] (-308.868) (-312.079) * (-311.575) (-311.796) [-307.177] (-311.035) -- 0:00:25
Average standard deviation of split frequencies: 0.025043
95500 -- (-311.424) [-308.694] (-310.454) (-310.712) * (-308.620) [-307.017] (-309.513) (-315.989) -- 0:00:25
96000 -- (-310.036) [-309.324] (-309.932) (-310.083) * (-311.821) (-309.003) (-307.020) [-308.141] -- 0:00:25
96500 -- (-309.802) (-308.366) [-309.059] (-309.755) * (-309.960) (-316.945) (-309.159) [-307.655] -- 0:00:25
97000 -- (-310.714) (-309.323) [-309.736] (-308.678) * (-307.745) (-308.504) (-308.820) [-308.015] -- 0:00:24
97500 -- (-308.056) (-309.594) [-309.661] (-309.156) * [-309.416] (-310.619) (-309.550) (-308.766) -- 0:00:24
98000 -- [-309.464] (-309.035) (-307.479) (-310.613) * (-307.990) [-308.328] (-308.065) (-307.343) -- 0:00:24
98500 -- (-313.980) [-307.560] (-311.408) (-314.214) * [-308.287] (-307.776) (-311.714) (-308.543) -- 0:00:24
99000 -- (-310.886) (-310.280) [-309.764] (-313.318) * (-306.809) [-307.713] (-310.310) (-308.344) -- 0:00:28
99500 -- (-311.279) (-311.007) [-310.251] (-310.458) * (-310.973) (-307.516) [-313.807] (-310.004) -- 0:00:28
100000 -- (-310.091) [-308.774] (-312.653) (-315.864) * [-309.110] (-307.697) (-310.030) (-310.874) -- 0:00:27
Average standard deviation of split frequencies: 0.024154
100500 -- (-308.796) [-307.340] (-309.581) (-312.313) * (-307.370) [-308.885] (-313.655) (-309.926) -- 0:00:27
101000 -- (-310.421) (-308.965) (-309.385) [-312.430] * (-309.122) (-309.213) (-311.787) [-310.963] -- 0:00:27
101500 -- [-307.177] (-308.485) (-311.744) (-309.291) * (-306.813) (-307.735) [-309.220] (-307.563) -- 0:00:27
102000 -- (-309.392) (-310.723) (-308.409) [-307.869] * (-308.394) [-307.492] (-306.982) (-308.769) -- 0:00:27
102500 -- (-309.978) (-310.834) [-307.338] (-307.730) * (-306.959) (-307.607) (-307.566) [-310.782] -- 0:00:27
103000 -- (-308.556) (-309.649) [-310.567] (-308.884) * [-308.630] (-308.693) (-308.856) (-308.554) -- 0:00:26
103500 -- (-307.137) [-307.293] (-311.873) (-309.601) * (-308.589) (-308.548) (-311.799) [-308.765] -- 0:00:26
104000 -- (-310.806) (-308.333) (-309.948) [-308.262] * [-309.665] (-310.048) (-310.935) (-310.664) -- 0:00:26
104500 -- (-314.296) (-311.019) [-311.102] (-310.296) * (-311.238) (-308.518) [-307.989] (-310.888) -- 0:00:26
105000 -- (-313.708) (-308.404) (-308.773) [-311.626] * [-309.134] (-309.563) (-307.672) (-311.036) -- 0:00:26
Average standard deviation of split frequencies: 0.020330
105500 -- (-308.614) [-308.846] (-311.067) (-307.978) * (-312.854) [-309.354] (-309.038) (-310.344) -- 0:00:26
106000 -- (-309.969) (-308.540) (-310.520) [-310.135] * [-310.219] (-309.611) (-307.117) (-310.882) -- 0:00:26
106500 -- (-311.358) (-307.965) [-309.143] (-316.520) * (-312.943) (-314.532) (-308.038) [-308.051] -- 0:00:25
107000 -- (-312.705) (-309.091) [-308.261] (-309.641) * (-313.388) (-308.879) [-311.120] (-307.880) -- 0:00:25
107500 -- [-307.957] (-310.241) (-309.881) (-309.058) * (-310.015) [-307.473] (-308.436) (-307.431) -- 0:00:25
108000 -- [-307.745] (-311.035) (-308.571) (-309.268) * (-311.956) (-308.421) (-310.010) [-307.969] -- 0:00:25
108500 -- [-311.583] (-310.327) (-311.351) (-308.382) * [-307.543] (-310.401) (-312.976) (-308.707) -- 0:00:25
109000 -- (-308.514) (-309.203) (-312.117) [-308.648] * [-309.314] (-310.170) (-311.616) (-311.930) -- 0:00:25
109500 -- [-310.799] (-311.092) (-309.418) (-307.775) * [-308.429] (-311.136) (-307.593) (-310.432) -- 0:00:24
110000 -- (-307.916) [-313.684] (-310.107) (-307.183) * (-307.578) (-311.665) (-309.138) [-307.918] -- 0:00:24
Average standard deviation of split frequencies: 0.019879
110500 -- (-310.295) (-311.283) (-307.473) [-308.765] * (-307.668) (-312.120) (-309.235) [-307.777] -- 0:00:24
111000 -- (-313.922) (-310.234) [-313.055] (-309.231) * (-307.635) (-308.986) (-310.931) [-308.826] -- 0:00:24
111500 -- (-312.260) (-310.704) [-307.195] (-309.324) * (-308.555) [-308.248] (-307.757) (-309.060) -- 0:00:24
112000 -- (-311.556) [-312.926] (-307.970) (-306.911) * (-309.100) (-312.282) [-308.286] (-311.354) -- 0:00:24
112500 -- (-316.120) (-311.758) (-307.886) [-307.282] * (-312.353) (-312.172) [-307.389] (-307.961) -- 0:00:24
113000 -- (-308.767) [-309.025] (-311.753) (-308.079) * (-309.674) (-308.717) (-308.648) [-308.044] -- 0:00:23
113500 -- (-309.280) (-311.939) (-312.227) [-309.330] * [-308.720] (-307.333) (-308.662) (-307.528) -- 0:00:23
114000 -- [-308.914] (-310.744) (-309.639) (-311.800) * (-311.609) [-307.726] (-310.151) (-310.250) -- 0:00:23
114500 -- (-308.165) (-310.723) (-307.568) [-308.655] * [-311.492] (-307.213) (-308.611) (-309.309) -- 0:00:23
115000 -- [-310.125] (-312.062) (-307.233) (-308.441) * (-309.096) [-307.066] (-308.402) (-307.282) -- 0:00:23
Average standard deviation of split frequencies: 0.018513
115500 -- (-308.989) (-308.206) (-307.960) [-308.188] * (-311.732) (-306.871) [-308.272] (-307.957) -- 0:00:23
116000 -- (-309.324) (-309.000) [-310.703] (-307.112) * (-307.901) [-308.163] (-308.322) (-308.266) -- 0:00:26
116500 -- [-311.990] (-310.594) (-308.693) (-308.130) * (-309.197) [-311.961] (-310.554) (-309.765) -- 0:00:26
117000 -- (-310.234) (-308.635) [-309.279] (-308.382) * (-309.174) (-307.652) (-310.906) [-308.052] -- 0:00:26
117500 -- (-314.370) (-312.682) [-310.829] (-307.602) * [-308.034] (-311.224) (-308.746) (-306.977) -- 0:00:26
118000 -- (-308.962) (-312.784) [-308.796] (-308.709) * (-308.964) (-307.719) [-307.780] (-307.010) -- 0:00:25
118500 -- [-309.654] (-308.882) (-307.371) (-308.280) * (-309.780) [-311.059] (-310.602) (-310.070) -- 0:00:25
119000 -- [-308.576] (-307.653) (-308.573) (-309.060) * [-308.975] (-308.651) (-309.265) (-322.520) -- 0:00:25
119500 -- (-307.671) (-309.111) [-310.718] (-308.941) * (-309.210) (-307.925) [-309.584] (-312.025) -- 0:00:25
120000 -- (-312.686) [-309.850] (-307.762) (-308.150) * (-308.584) [-308.985] (-316.668) (-311.755) -- 0:00:25
Average standard deviation of split frequencies: 0.016929
120500 -- (-313.032) (-314.087) (-309.779) [-308.982] * (-308.335) [-310.389] (-312.623) (-309.443) -- 0:00:25
121000 -- [-311.539] (-311.626) (-308.046) (-308.215) * (-308.086) [-309.563] (-308.075) (-309.252) -- 0:00:25
121500 -- (-309.827) [-309.714] (-309.013) (-307.745) * [-308.839] (-310.511) (-309.420) (-308.252) -- 0:00:24
122000 -- (-309.313) (-307.137) (-313.572) [-309.762] * [-308.328] (-310.860) (-307.878) (-309.189) -- 0:00:24
122500 -- (-309.625) (-310.725) (-310.960) [-307.405] * [-310.207] (-310.934) (-310.148) (-308.219) -- 0:00:24
123000 -- [-307.776] (-311.996) (-310.745) (-308.336) * [-308.601] (-309.423) (-311.057) (-307.133) -- 0:00:24
123500 -- (-308.009) [-309.441] (-318.110) (-307.644) * (-309.908) (-308.666) [-308.535] (-307.219) -- 0:00:24
124000 -- (-306.789) (-310.262) (-313.450) [-306.813] * (-308.662) [-309.378] (-307.789) (-309.831) -- 0:00:24
124500 -- (-307.556) (-313.114) [-313.817] (-309.311) * (-308.759) [-309.336] (-307.719) (-309.486) -- 0:00:24
125000 -- (-307.222) (-308.392) (-316.303) [-308.703] * (-307.240) [-312.146] (-308.330) (-309.756) -- 0:00:24
Average standard deviation of split frequencies: 0.013469
125500 -- (-309.937) (-307.492) (-316.997) [-309.537] * (-307.706) (-307.249) (-309.222) [-307.307] -- 0:00:23
126000 -- (-307.415) (-307.935) (-309.597) [-307.521] * (-307.624) [-307.003] (-308.312) (-309.874) -- 0:00:23
126500 -- (-309.545) [-311.239] (-307.769) (-308.026) * (-310.461) [-309.486] (-309.326) (-309.926) -- 0:00:23
127000 -- [-309.083] (-309.926) (-308.308) (-308.331) * (-310.425) (-309.854) [-308.195] (-308.358) -- 0:00:23
127500 -- (-314.168) (-307.655) [-309.309] (-309.497) * (-309.172) [-308.034] (-315.488) (-308.230) -- 0:00:23
128000 -- (-314.516) (-307.258) (-307.597) [-308.149] * (-309.039) (-311.847) [-312.026] (-309.750) -- 0:00:23
128500 -- (-307.775) [-309.951] (-307.470) (-311.669) * (-307.045) (-312.540) (-309.848) [-309.623] -- 0:00:23
129000 -- (-309.554) [-310.113] (-307.310) (-309.909) * (-308.174) (-311.230) (-311.886) [-307.186] -- 0:00:23
129500 -- [-307.968] (-307.701) (-310.276) (-307.612) * (-315.396) (-308.065) [-308.615] (-308.372) -- 0:00:22
130000 -- [-307.746] (-308.519) (-307.415) (-309.540) * (-308.781) [-307.246] (-311.768) (-308.192) -- 0:00:22
Average standard deviation of split frequencies: 0.014621
130500 -- (-319.090) [-308.722] (-308.080) (-308.281) * [-310.094] (-309.781) (-314.394) (-308.638) -- 0:00:22
131000 -- [-312.014] (-309.458) (-307.280) (-308.205) * [-306.791] (-312.643) (-313.967) (-308.956) -- 0:00:22
131500 -- (-313.606) (-311.967) (-307.484) [-309.926] * (-308.527) (-309.261) [-309.479] (-308.980) -- 0:00:22
132000 -- (-309.209) (-311.008) (-307.539) [-308.297] * (-311.575) (-308.419) [-308.111] (-311.051) -- 0:00:22
132500 -- (-308.481) (-308.721) (-307.558) [-308.948] * (-308.179) (-309.829) (-308.391) [-309.639] -- 0:00:22
133000 -- [-311.311] (-309.785) (-309.415) (-309.110) * [-308.923] (-309.640) (-307.154) (-309.579) -- 0:00:22
133500 -- (-309.833) [-311.170] (-310.758) (-311.911) * (-309.681) [-308.752] (-307.617) (-309.674) -- 0:00:24
134000 -- (-308.054) [-309.943] (-310.248) (-310.443) * (-311.881) (-307.314) (-309.507) [-307.952] -- 0:00:24
134500 -- [-309.504] (-309.569) (-307.674) (-307.277) * (-309.978) [-307.664] (-309.241) (-309.021) -- 0:00:24
135000 -- (-308.768) [-315.387] (-309.599) (-308.911) * (-313.440) (-307.742) (-309.309) [-307.516] -- 0:00:24
Average standard deviation of split frequencies: 0.015507
135500 -- [-307.230] (-310.680) (-307.170) (-312.300) * (-308.814) (-308.423) [-308.160] (-308.384) -- 0:00:24
136000 -- (-307.446) (-309.469) [-309.258] (-308.855) * (-308.905) (-307.237) [-307.881] (-308.333) -- 0:00:24
136500 -- [-310.088] (-311.630) (-314.718) (-308.174) * (-308.766) (-307.918) (-311.283) [-310.331] -- 0:00:23
137000 -- (-312.658) (-310.621) [-309.764] (-311.077) * (-310.399) (-307.357) (-308.692) [-307.324] -- 0:00:23
137500 -- (-308.855) (-308.888) [-307.890] (-309.239) * (-307.691) (-309.620) (-308.814) [-309.026] -- 0:00:23
138000 -- (-308.959) [-310.089] (-310.691) (-308.962) * (-309.974) (-309.466) [-308.109] (-311.302) -- 0:00:23
138500 -- [-308.898] (-308.274) (-311.675) (-307.051) * [-307.805] (-311.929) (-311.920) (-307.812) -- 0:00:23
139000 -- (-309.624) (-307.803) (-309.695) [-307.207] * (-312.553) (-309.959) (-309.274) [-308.814] -- 0:00:23
139500 -- (-310.441) (-307.861) (-311.764) [-307.252] * (-309.467) (-309.973) (-308.790) [-308.908] -- 0:00:23
140000 -- (-309.189) (-309.670) [-307.458] (-310.305) * [-307.739] (-308.412) (-307.826) (-312.206) -- 0:00:23
Average standard deviation of split frequencies: 0.012699
140500 -- [-310.255] (-308.313) (-308.137) (-308.575) * (-308.724) (-308.565) (-312.311) [-307.970] -- 0:00:23
141000 -- (-309.727) [-309.666] (-308.972) (-308.323) * (-311.685) [-309.701] (-310.426) (-308.056) -- 0:00:22
141500 -- (-309.014) (-308.389) (-308.696) [-308.231] * [-307.220] (-309.232) (-310.340) (-309.231) -- 0:00:22
142000 -- (-308.133) [-309.097] (-309.491) (-311.110) * (-310.234) [-308.780] (-308.860) (-309.739) -- 0:00:22
142500 -- (-309.614) (-310.624) (-314.343) [-312.017] * [-309.344] (-308.028) (-311.387) (-309.509) -- 0:00:22
143000 -- [-309.402] (-310.634) (-310.340) (-309.113) * (-308.385) [-307.449] (-307.911) (-309.819) -- 0:00:22
143500 -- (-311.643) (-310.987) [-308.291] (-308.737) * (-307.879) (-309.441) (-308.007) [-309.273] -- 0:00:22
144000 -- (-311.069) [-308.815] (-308.663) (-312.993) * (-311.258) (-308.103) (-312.094) [-307.398] -- 0:00:22
144500 -- (-310.326) (-310.335) (-307.871) [-311.426] * (-309.944) (-310.047) (-311.541) [-308.625] -- 0:00:22
145000 -- (-314.492) [-309.268] (-309.408) (-310.373) * [-311.488] (-310.601) (-312.623) (-308.863) -- 0:00:22
Average standard deviation of split frequencies: 0.011531
145500 -- (-309.850) [-308.908] (-308.446) (-311.504) * (-310.003) (-309.489) (-309.792) [-308.761] -- 0:00:21
146000 -- (-310.514) (-307.809) (-313.323) [-307.919] * [-309.505] (-308.368) (-308.813) (-312.268) -- 0:00:21
146500 -- (-309.498) [-310.072] (-310.205) (-307.467) * (-314.444) (-307.533) (-307.709) [-313.228] -- 0:00:21
147000 -- (-307.448) (-308.398) [-307.188] (-310.837) * (-310.334) (-308.952) [-308.731] (-307.743) -- 0:00:21
147500 -- (-312.390) [-309.690] (-309.758) (-308.381) * (-309.901) (-314.781) (-308.514) [-307.561] -- 0:00:21
148000 -- (-311.209) (-309.765) [-309.144] (-309.893) * (-311.008) (-313.123) [-308.745] (-308.929) -- 0:00:21
148500 -- [-308.043] (-310.961) (-306.768) (-311.814) * (-313.509) (-315.442) (-308.521) [-308.407] -- 0:00:21
149000 -- (-308.496) [-308.339] (-307.083) (-309.631) * (-309.778) (-311.848) [-311.796] (-307.304) -- 0:00:21
149500 -- (-307.856) (-309.846) [-309.163] (-309.844) * (-308.539) (-311.557) [-310.991] (-307.591) -- 0:00:21
150000 -- (-309.193) (-308.020) (-309.064) [-309.725] * (-309.134) (-312.198) (-316.264) [-307.724] -- 0:00:21
Average standard deviation of split frequencies: 0.013610
150500 -- (-308.442) (-307.155) [-307.858] (-309.898) * (-308.938) (-311.041) (-309.592) [-310.281] -- 0:00:23
151000 -- [-307.082] (-307.586) (-307.582) (-307.566) * (-308.004) (-321.201) (-308.331) [-309.619] -- 0:00:23
151500 -- [-309.062] (-309.254) (-307.792) (-310.332) * (-309.221) [-310.729] (-309.165) (-309.604) -- 0:00:23
152000 -- (-309.693) (-308.530) [-312.432] (-310.909) * (-308.042) [-307.310] (-310.003) (-309.043) -- 0:00:22
152500 -- (-312.119) [-309.491] (-310.175) (-309.307) * (-310.162) [-308.348] (-307.124) (-309.267) -- 0:00:22
153000 -- (-311.122) (-311.064) (-309.805) [-307.488] * (-308.512) (-312.217) [-310.729] (-308.147) -- 0:00:22
153500 -- [-313.165] (-308.309) (-309.303) (-312.289) * (-311.672) [-308.320] (-311.471) (-310.483) -- 0:00:22
154000 -- (-309.229) (-309.974) [-309.935] (-309.560) * (-308.464) (-309.319) (-310.389) [-310.520] -- 0:00:22
154500 -- (-308.354) (-311.243) (-311.098) [-307.919] * [-308.976] (-309.288) (-312.156) (-314.185) -- 0:00:22
155000 -- [-308.308] (-307.918) (-315.070) (-309.360) * (-309.566) (-308.370) (-307.791) [-310.685] -- 0:00:22
Average standard deviation of split frequencies: 0.015268
155500 -- (-308.104) [-307.292] (-314.105) (-308.690) * (-308.860) (-312.898) [-313.731] (-307.626) -- 0:00:22
156000 -- (-312.321) (-311.130) (-309.795) [-307.323] * [-309.335] (-313.501) (-310.562) (-308.325) -- 0:00:22
156500 -- (-309.986) [-310.390] (-313.487) (-309.770) * (-309.608) (-309.183) [-308.301] (-309.771) -- 0:00:21
157000 -- [-309.177] (-309.466) (-309.103) (-308.850) * (-307.064) [-308.339] (-309.041) (-309.984) -- 0:00:21
157500 -- (-309.183) (-308.019) [-307.855] (-307.267) * (-312.059) (-307.690) [-307.998] (-313.456) -- 0:00:21
158000 -- (-307.812) (-307.568) (-309.384) [-308.531] * [-308.293] (-310.584) (-308.735) (-315.180) -- 0:00:21
158500 -- (-308.806) (-309.339) (-311.312) [-308.723] * (-310.463) [-313.318] (-308.530) (-308.861) -- 0:00:21
159000 -- (-312.877) (-307.577) [-314.250] (-307.838) * (-308.401) (-309.712) [-308.192] (-308.254) -- 0:00:21
159500 -- (-309.781) (-307.942) [-311.803] (-307.619) * [-311.136] (-307.608) (-307.843) (-308.512) -- 0:00:21
160000 -- (-308.630) (-308.560) (-314.965) [-310.140] * (-307.849) (-313.715) [-308.691] (-308.085) -- 0:00:21
Average standard deviation of split frequencies: 0.014152
160500 -- (-308.188) (-308.258) [-310.352] (-310.076) * [-308.789] (-310.952) (-310.361) (-308.893) -- 0:00:21
161000 -- (-309.021) (-307.872) [-309.300] (-309.893) * [-309.350] (-313.048) (-307.113) (-309.042) -- 0:00:21
161500 -- (-310.518) (-309.647) (-309.385) [-309.003] * (-306.971) (-310.660) [-308.672] (-308.802) -- 0:00:20
162000 -- (-312.207) (-307.960) (-308.766) [-310.213] * (-308.590) (-308.002) [-311.753] (-309.969) -- 0:00:20
162500 -- (-312.719) (-309.200) (-309.671) [-308.574] * [-307.650] (-307.591) (-307.955) (-310.147) -- 0:00:20
163000 -- (-310.912) (-307.960) [-309.652] (-309.570) * (-309.360) [-308.918] (-307.602) (-308.118) -- 0:00:20
163500 -- [-312.741] (-312.173) (-308.375) (-310.794) * [-309.652] (-307.727) (-310.096) (-309.914) -- 0:00:20
164000 -- (-311.119) (-309.014) (-310.457) [-308.314] * (-307.330) (-308.409) [-311.340] (-310.982) -- 0:00:20
164500 -- (-307.412) (-308.288) (-311.865) [-307.919] * (-307.729) (-309.553) [-311.118] (-308.532) -- 0:00:20
165000 -- [-307.516] (-308.591) (-309.412) (-309.277) * [-308.708] (-308.400) (-311.839) (-307.330) -- 0:00:20
Average standard deviation of split frequencies: 0.014797
165500 -- (-308.215) (-309.134) [-307.123] (-311.021) * (-308.580) [-309.438] (-311.771) (-311.177) -- 0:00:20
166000 -- (-307.085) (-307.273) (-308.497) [-309.684] * [-310.534] (-311.871) (-308.993) (-308.410) -- 0:00:20
166500 -- [-307.809] (-309.135) (-308.219) (-311.752) * (-310.508) (-309.979) [-308.431] (-308.773) -- 0:00:20
167000 -- (-307.134) (-307.054) [-310.201] (-314.996) * (-312.596) [-307.541] (-310.348) (-308.737) -- 0:00:19
167500 -- (-309.115) [-308.261] (-309.846) (-311.832) * (-307.283) [-311.520] (-310.290) (-312.767) -- 0:00:19
168000 -- [-307.721] (-312.933) (-307.421) (-313.279) * (-308.274) [-309.999] (-309.609) (-310.223) -- 0:00:21
168500 -- [-308.407] (-313.004) (-308.002) (-310.209) * (-309.350) (-310.896) (-308.398) [-308.481] -- 0:00:21
169000 -- [-308.802] (-315.981) (-309.791) (-310.269) * [-309.188] (-314.125) (-308.776) (-308.816) -- 0:00:21
169500 -- (-309.551) (-309.776) [-310.980] (-307.019) * (-308.371) [-310.810] (-307.938) (-308.674) -- 0:00:21
170000 -- (-307.988) (-315.089) [-310.759] (-307.500) * [-308.572] (-307.028) (-310.321) (-307.914) -- 0:00:21
Average standard deviation of split frequencies: 0.014118
170500 -- (-308.234) (-311.107) [-312.132] (-314.433) * (-307.468) [-308.668] (-309.807) (-307.515) -- 0:00:21
171000 -- (-311.680) (-310.679) [-310.056] (-308.796) * [-308.103] (-307.643) (-310.310) (-311.789) -- 0:00:21
171500 -- (-311.957) (-309.329) [-309.239] (-307.966) * (-310.243) (-307.984) [-307.818] (-308.585) -- 0:00:21
172000 -- (-308.897) (-308.609) (-311.398) [-308.389] * (-307.954) (-309.525) [-309.044] (-307.278) -- 0:00:20
172500 -- (-308.921) (-309.338) (-313.195) [-309.504] * (-309.884) (-308.270) (-310.355) [-308.611] -- 0:00:20
173000 -- [-309.784] (-307.023) (-308.595) (-311.982) * [-309.310] (-306.918) (-307.847) (-307.256) -- 0:00:20
173500 -- (-307.832) (-312.106) (-311.196) [-307.149] * (-309.857) [-309.290] (-310.463) (-307.762) -- 0:00:20
174000 -- (-307.689) [-309.180] (-309.740) (-307.488) * (-311.683) (-310.437) [-308.833] (-312.222) -- 0:00:20
174500 -- (-312.593) (-309.192) (-309.976) [-308.190] * (-307.562) (-308.911) [-308.370] (-307.843) -- 0:00:20
175000 -- (-311.880) (-312.048) (-310.281) [-306.874] * [-309.837] (-308.258) (-309.071) (-308.267) -- 0:00:20
Average standard deviation of split frequencies: 0.014943
175500 -- (-308.339) (-310.415) (-312.590) [-308.466] * (-311.937) (-308.199) [-307.034] (-309.344) -- 0:00:20
176000 -- (-310.120) (-308.779) [-308.457] (-307.388) * (-310.051) (-307.669) (-312.339) [-310.402] -- 0:00:20
176500 -- (-308.902) [-307.552] (-313.591) (-307.851) * (-313.317) (-309.900) [-307.892] (-310.176) -- 0:00:20
177000 -- (-307.756) (-310.470) [-307.987] (-314.045) * [-307.333] (-313.457) (-308.776) (-308.741) -- 0:00:20
177500 -- (-308.905) (-308.226) [-308.366] (-312.195) * [-310.531] (-311.314) (-309.892) (-309.327) -- 0:00:19
178000 -- [-309.187] (-308.221) (-309.337) (-308.399) * (-315.724) [-308.883] (-311.395) (-309.707) -- 0:00:19
178500 -- [-309.535] (-308.529) (-307.364) (-309.009) * [-309.983] (-307.118) (-310.176) (-307.196) -- 0:00:19
179000 -- [-307.378] (-309.293) (-309.645) (-310.233) * (-308.761) (-307.123) [-309.502] (-309.792) -- 0:00:19
179500 -- (-307.987) (-311.895) [-313.944] (-313.548) * [-308.863] (-307.727) (-308.485) (-310.963) -- 0:00:19
180000 -- (-310.732) (-309.639) (-312.119) [-307.507] * (-308.017) (-311.246) (-308.394) [-310.282] -- 0:00:19
Average standard deviation of split frequencies: 0.013771
180500 -- (-307.736) (-307.529) (-311.877) [-308.335] * [-308.020] (-308.951) (-308.714) (-310.420) -- 0:00:19
181000 -- (-310.356) (-312.516) (-308.066) [-310.000] * [-311.380] (-309.464) (-311.685) (-308.349) -- 0:00:19
181500 -- (-308.187) (-309.454) (-310.510) [-308.077] * (-307.737) (-308.704) [-318.529] (-311.082) -- 0:00:19
182000 -- (-307.643) [-308.316] (-308.395) (-307.563) * [-307.574] (-310.787) (-313.385) (-307.711) -- 0:00:19
182500 -- (-310.989) (-308.157) (-307.818) [-307.587] * [-309.429] (-307.159) (-310.515) (-307.411) -- 0:00:19
183000 -- (-309.035) (-310.998) [-308.303] (-308.835) * [-310.018] (-307.575) (-307.679) (-308.310) -- 0:00:19
183500 -- [-308.259] (-312.361) (-307.215) (-310.056) * (-311.556) (-307.833) (-308.757) [-307.366] -- 0:00:18
184000 -- (-309.154) (-308.019) [-307.987] (-307.346) * (-307.408) (-309.742) (-307.569) [-309.538] -- 0:00:18
184500 -- (-310.214) (-311.231) (-311.107) [-307.709] * [-308.219] (-309.873) (-309.421) (-309.058) -- 0:00:18
185000 -- (-308.461) (-312.380) (-312.387) [-307.362] * (-313.113) (-309.901) (-310.089) [-307.490] -- 0:00:20
Average standard deviation of split frequencies: 0.014406
185500 -- (-311.808) [-308.616] (-311.308) (-314.407) * [-308.727] (-310.420) (-310.866) (-307.678) -- 0:00:20
186000 -- [-308.082] (-312.054) (-309.521) (-309.220) * (-308.125) (-312.025) [-308.619] (-308.687) -- 0:00:20
186500 -- [-311.818] (-310.107) (-307.800) (-311.443) * (-307.767) (-311.004) [-309.603] (-308.219) -- 0:00:20
187000 -- (-310.182) (-308.478) [-311.718] (-307.750) * (-309.217) (-308.409) (-316.462) [-307.625] -- 0:00:20
187500 -- (-308.171) [-309.790] (-312.710) (-310.849) * (-309.178) (-309.469) (-309.605) [-308.207] -- 0:00:20
188000 -- [-311.151] (-309.497) (-309.343) (-307.980) * (-308.560) (-307.534) (-306.880) [-309.591] -- 0:00:19
188500 -- (-311.941) [-309.375] (-308.160) (-308.430) * [-312.150] (-308.680) (-307.789) (-307.362) -- 0:00:19
189000 -- [-309.352] (-311.883) (-311.209) (-312.473) * (-309.600) (-309.256) (-309.738) [-308.501] -- 0:00:19
189500 -- (-311.735) [-308.542] (-312.279) (-307.589) * [-306.979] (-310.231) (-308.522) (-309.158) -- 0:00:19
190000 -- (-312.384) (-309.613) (-312.155) [-308.254] * [-311.156] (-308.285) (-308.141) (-310.421) -- 0:00:19
Average standard deviation of split frequencies: 0.013873
190500 -- [-308.894] (-310.553) (-311.404) (-308.360) * (-308.591) (-307.632) (-319.416) [-308.940] -- 0:00:19
191000 -- [-308.688] (-308.970) (-312.188) (-310.307) * (-310.394) (-308.383) [-308.312] (-309.326) -- 0:00:19
191500 -- [-309.520] (-309.939) (-311.982) (-309.300) * (-311.061) (-308.566) [-308.604] (-310.056) -- 0:00:19
192000 -- [-307.815] (-310.219) (-310.527) (-311.822) * (-309.134) [-308.446] (-309.970) (-311.471) -- 0:00:19
192500 -- [-308.846] (-308.677) (-311.146) (-307.532) * [-309.564] (-309.059) (-311.334) (-311.373) -- 0:00:19
193000 -- [-313.016] (-307.622) (-309.047) (-307.929) * (-311.501) (-314.134) [-309.071] (-310.516) -- 0:00:19
193500 -- (-314.123) (-310.275) [-310.595] (-308.939) * (-309.221) (-309.819) [-312.356] (-313.241) -- 0:00:19
194000 -- (-307.774) (-311.201) [-307.199] (-308.827) * (-308.146) (-313.080) [-308.587] (-309.501) -- 0:00:18
194500 -- (-308.940) [-307.303] (-309.872) (-309.172) * [-307.946] (-312.781) (-307.884) (-309.205) -- 0:00:18
195000 -- (-310.993) (-310.831) [-308.806] (-307.520) * (-307.753) (-307.944) (-307.744) [-309.362] -- 0:00:18
Average standard deviation of split frequencies: 0.013078
195500 -- (-309.210) (-313.443) [-308.190] (-309.709) * (-314.562) (-309.888) [-307.839] (-306.937) -- 0:00:18
196000 -- [-308.151] (-312.366) (-308.496) (-308.790) * (-310.624) (-308.324) [-307.129] (-310.882) -- 0:00:18
196500 -- [-307.582] (-307.667) (-308.520) (-309.873) * (-309.270) [-306.808] (-307.799) (-310.689) -- 0:00:18
197000 -- [-308.387] (-308.339) (-307.755) (-311.956) * (-309.363) (-310.363) (-308.839) [-308.086] -- 0:00:18
197500 -- (-308.181) (-312.458) [-310.209] (-310.433) * (-309.460) (-316.894) [-311.501] (-308.454) -- 0:00:18
198000 -- [-309.042] (-309.913) (-310.213) (-311.124) * (-312.120) (-311.404) [-309.448] (-308.030) -- 0:00:18
198500 -- (-310.407) (-308.951) (-311.392) [-308.359] * (-308.194) [-313.787] (-310.969) (-308.236) -- 0:00:18
199000 -- (-307.961) [-309.098] (-314.014) (-307.940) * (-307.754) (-312.470) [-308.277] (-312.054) -- 0:00:18
199500 -- (-308.391) [-311.546] (-306.975) (-310.751) * [-307.759] (-308.968) (-307.654) (-308.401) -- 0:00:18
200000 -- [-307.128] (-309.782) (-308.071) (-315.266) * (-308.942) [-308.501] (-309.143) (-308.281) -- 0:00:18
Average standard deviation of split frequencies: 0.013443
200500 -- (-308.996) [-310.882] (-308.476) (-309.123) * (-312.372) [-308.580] (-309.508) (-311.542) -- 0:00:17
201000 -- (-307.909) [-308.414] (-307.205) (-308.104) * (-307.320) [-307.892] (-310.811) (-308.813) -- 0:00:17
201500 -- (-310.116) [-310.258] (-308.372) (-308.696) * [-307.163] (-306.810) (-309.300) (-308.999) -- 0:00:17
202000 -- (-311.087) (-307.903) (-308.601) [-307.962] * (-308.646) (-308.508) [-308.877] (-310.302) -- 0:00:17
202500 -- [-310.876] (-308.463) (-308.138) (-309.769) * [-307.405] (-310.095) (-310.850) (-310.834) -- 0:00:19
203000 -- (-310.273) [-307.169] (-307.155) (-309.505) * (-307.362) [-309.814] (-307.483) (-310.776) -- 0:00:19
203500 -- (-308.378) (-309.695) (-306.796) [-309.721] * (-308.034) (-308.267) (-307.004) [-312.919] -- 0:00:18
204000 -- [-312.348] (-308.572) (-307.982) (-310.240) * [-307.755] (-312.318) (-311.008) (-310.498) -- 0:00:18
204500 -- (-309.656) (-309.797) (-314.191) [-308.670] * (-311.681) (-307.768) (-311.993) [-308.664] -- 0:00:18
205000 -- (-308.259) (-307.523) [-309.023] (-308.172) * (-311.738) [-307.234] (-310.720) (-307.924) -- 0:00:18
Average standard deviation of split frequencies: 0.013730
205500 -- [-307.646] (-308.776) (-313.269) (-309.074) * (-307.941) (-308.590) (-307.561) [-308.488] -- 0:00:18
206000 -- (-311.853) (-309.002) [-309.785] (-310.371) * [-309.537] (-309.930) (-311.003) (-308.059) -- 0:00:18
206500 -- (-310.037) [-312.145] (-308.693) (-311.650) * [-309.039] (-313.080) (-307.679) (-312.951) -- 0:00:18
207000 -- (-308.814) (-310.955) (-308.845) [-311.257] * (-311.752) (-312.272) [-307.818] (-307.790) -- 0:00:18
207500 -- (-308.588) (-310.171) [-310.667] (-309.832) * (-308.662) [-308.023] (-309.047) (-306.930) -- 0:00:18
208000 -- (-308.114) (-307.799) [-307.840] (-308.214) * (-310.108) (-315.174) [-307.942] (-307.492) -- 0:00:18
208500 -- (-309.083) [-310.200] (-309.697) (-312.931) * (-308.110) [-307.443] (-306.946) (-307.741) -- 0:00:18
209000 -- [-306.950] (-310.888) (-308.278) (-311.567) * (-309.248) [-310.492] (-308.305) (-309.638) -- 0:00:18
209500 -- [-307.194] (-309.102) (-309.624) (-310.337) * [-307.753] (-316.797) (-309.198) (-309.041) -- 0:00:18
210000 -- (-308.077) [-308.507] (-309.278) (-313.906) * (-309.642) [-309.212] (-309.276) (-309.743) -- 0:00:17
Average standard deviation of split frequencies: 0.013953
210500 -- (-308.879) (-308.095) (-308.286) [-308.524] * [-310.952] (-308.771) (-308.369) (-311.576) -- 0:00:17
211000 -- (-306.888) (-307.428) (-307.791) [-306.863] * [-308.325] (-312.516) (-310.141) (-313.328) -- 0:00:17
211500 -- (-308.749) (-309.698) (-310.145) [-310.113] * [-308.354] (-309.992) (-308.126) (-309.424) -- 0:00:17
212000 -- [-309.671] (-307.599) (-310.153) (-306.795) * (-308.704) [-307.397] (-311.084) (-310.723) -- 0:00:17
212500 -- (-313.436) (-309.538) [-309.986] (-310.388) * [-309.152] (-309.410) (-310.138) (-309.448) -- 0:00:17
213000 -- (-307.415) (-313.651) [-308.454] (-310.455) * (-311.554) [-307.948] (-310.130) (-306.748) -- 0:00:17
213500 -- (-307.852) [-308.786] (-308.147) (-308.996) * (-307.940) [-308.943] (-310.684) (-307.363) -- 0:00:17
214000 -- (-307.425) (-309.399) (-309.788) [-310.798] * (-308.947) [-308.534] (-310.184) (-308.700) -- 0:00:17
214500 -- (-307.279) [-309.462] (-309.975) (-308.855) * [-310.009] (-309.690) (-311.248) (-308.487) -- 0:00:17
215000 -- [-307.901] (-311.272) (-308.387) (-309.404) * [-308.594] (-307.657) (-311.010) (-313.044) -- 0:00:17
Average standard deviation of split frequencies: 0.012966
215500 -- (-309.631) [-309.795] (-309.912) (-314.255) * (-310.522) (-307.927) (-308.723) [-307.461] -- 0:00:17
216000 -- (-311.395) [-311.016] (-307.890) (-308.822) * (-309.672) (-309.963) (-311.504) [-307.555] -- 0:00:17
216500 -- (-308.919) [-306.845] (-311.712) (-312.517) * [-310.894] (-310.465) (-313.864) (-307.088) -- 0:00:17
217000 -- [-307.357] (-311.117) (-308.958) (-310.748) * (-307.852) (-307.393) (-311.544) [-307.199] -- 0:00:16
217500 -- (-310.196) (-307.065) (-318.418) [-307.518] * (-307.500) (-307.489) [-308.976] (-308.823) -- 0:00:16
218000 -- (-314.199) (-307.578) (-313.151) [-308.467] * (-308.234) [-309.596] (-309.518) (-309.851) -- 0:00:16
218500 -- [-310.216] (-311.156) (-311.584) (-308.959) * (-308.393) (-308.892) [-308.454] (-307.838) -- 0:00:16
219000 -- (-313.529) [-310.650] (-311.276) (-309.197) * [-310.016] (-308.663) (-311.698) (-308.317) -- 0:00:16
219500 -- (-312.158) [-310.701] (-311.171) (-308.426) * [-310.911] (-308.420) (-310.756) (-307.216) -- 0:00:17
220000 -- (-310.666) [-308.109] (-309.226) (-311.782) * (-311.366) [-308.333] (-312.969) (-312.297) -- 0:00:17
Average standard deviation of split frequencies: 0.012343
220500 -- [-308.742] (-307.287) (-308.297) (-309.425) * (-313.330) (-308.384) (-312.300) [-310.044] -- 0:00:17
221000 -- [-311.731] (-308.290) (-308.560) (-307.325) * [-310.975] (-309.469) (-308.901) (-307.658) -- 0:00:17
221500 -- [-307.489] (-306.943) (-308.897) (-312.385) * (-309.575) (-308.795) (-311.368) [-311.540] -- 0:00:17
222000 -- (-308.446) (-307.959) (-315.623) [-312.955] * (-309.820) (-309.803) (-315.666) [-309.615] -- 0:00:17
222500 -- (-308.618) (-308.698) (-313.074) [-308.694] * (-308.513) (-311.490) [-309.175] (-308.356) -- 0:00:17
223000 -- [-307.716] (-308.967) (-310.340) (-311.022) * (-307.811) (-311.128) [-308.892] (-308.980) -- 0:00:17
223500 -- (-308.523) (-308.272) (-310.806) [-308.473] * (-309.499) (-308.215) (-309.210) [-308.719] -- 0:00:17
224000 -- [-311.162] (-310.919) (-309.516) (-309.115) * [-309.339] (-310.494) (-311.708) (-308.991) -- 0:00:17
224500 -- [-309.030] (-308.025) (-308.604) (-318.122) * (-312.798) (-309.649) [-308.988] (-309.485) -- 0:00:17
225000 -- (-308.385) (-307.805) [-311.857] (-309.946) * (-310.547) (-309.939) [-307.834] (-310.002) -- 0:00:17
Average standard deviation of split frequencies: 0.012307
225500 -- (-311.312) (-309.507) (-314.744) [-308.699] * (-307.936) (-308.588) (-309.245) [-308.916] -- 0:00:17
226000 -- (-308.019) (-309.866) [-308.186] (-308.625) * (-309.108) (-314.787) (-306.971) [-308.204] -- 0:00:16
226500 -- [-307.955] (-308.208) (-306.968) (-308.375) * (-309.559) (-316.287) [-309.218] (-308.167) -- 0:00:16
227000 -- [-307.911] (-307.766) (-310.465) (-307.285) * [-308.109] (-311.323) (-307.202) (-308.322) -- 0:00:16
227500 -- [-312.288] (-309.463) (-308.719) (-307.917) * (-309.403) (-312.269) [-308.846] (-307.570) -- 0:00:16
228000 -- (-311.281) (-307.564) (-309.116) [-312.675] * (-307.482) (-308.212) (-319.032) [-308.157] -- 0:00:16
228500 -- (-308.040) (-308.667) [-307.898] (-314.055) * (-308.737) (-307.613) (-309.178) [-310.338] -- 0:00:16
229000 -- (-309.176) (-308.553) [-308.057] (-310.818) * (-308.563) [-307.728] (-308.133) (-307.823) -- 0:00:16
229500 -- (-307.605) (-310.407) [-308.162] (-308.293) * (-307.338) (-307.467) (-310.478) [-309.316] -- 0:00:16
230000 -- [-310.193] (-312.384) (-307.905) (-308.044) * (-308.458) (-307.019) [-307.394] (-309.152) -- 0:00:16
Average standard deviation of split frequencies: 0.013445
230500 -- (-307.420) (-311.806) (-308.367) [-309.749] * (-309.112) (-309.262) (-308.116) [-308.562] -- 0:00:16
231000 -- (-309.676) [-308.057] (-309.000) (-311.010) * (-310.244) (-311.345) (-309.910) [-308.752] -- 0:00:16
231500 -- (-311.188) [-306.991] (-307.142) (-316.258) * (-310.677) (-313.567) (-309.248) [-309.239] -- 0:00:16
232000 -- (-308.021) [-311.944] (-310.950) (-309.456) * (-310.299) (-307.324) (-312.356) [-308.808] -- 0:00:16
232500 -- (-308.847) [-310.616] (-307.692) (-310.198) * [-310.323] (-308.251) (-307.425) (-310.819) -- 0:00:16
233000 -- (-308.196) [-308.720] (-308.300) (-310.351) * (-309.179) [-308.408] (-307.778) (-311.058) -- 0:00:16
233500 -- (-309.504) (-308.862) [-311.544] (-307.034) * (-312.856) [-308.086] (-307.731) (-311.677) -- 0:00:15
234000 -- (-310.631) [-308.437] (-315.719) (-309.056) * (-312.810) [-309.242] (-314.110) (-311.389) -- 0:00:15
234500 -- (-309.410) (-310.722) [-307.521] (-308.733) * (-309.494) [-309.748] (-313.498) (-309.325) -- 0:00:15
235000 -- [-309.027] (-310.001) (-309.172) (-307.945) * (-309.728) [-308.393] (-308.868) (-310.983) -- 0:00:15
Average standard deviation of split frequencies: 0.012651
235500 -- (-309.497) (-311.651) (-309.380) [-308.528] * (-309.088) [-308.263] (-312.727) (-308.073) -- 0:00:15
236000 -- (-309.135) (-308.806) (-309.263) [-308.466] * [-309.242] (-312.270) (-309.154) (-308.975) -- 0:00:15
236500 -- (-310.414) [-307.566] (-310.895) (-316.515) * (-311.507) (-320.186) (-307.562) [-309.131] -- 0:00:15
237000 -- (-309.316) (-311.713) (-307.386) [-307.888] * (-308.692) (-310.612) [-308.234] (-311.050) -- 0:00:16
237500 -- (-310.268) (-310.738) [-308.158] (-308.251) * (-308.179) (-310.178) (-307.893) [-307.421] -- 0:00:16
238000 -- (-308.131) [-309.573] (-308.388) (-308.959) * (-307.721) [-309.272] (-307.642) (-308.581) -- 0:00:16
238500 -- [-308.480] (-309.091) (-312.271) (-310.596) * (-307.477) (-309.218) (-310.750) [-308.737] -- 0:00:16
239000 -- (-308.825) (-309.372) [-309.958] (-309.191) * (-308.400) (-312.289) [-307.580] (-308.152) -- 0:00:16
239500 -- (-307.574) (-312.848) [-309.855] (-308.905) * (-313.274) (-318.394) (-307.308) [-309.589] -- 0:00:16
240000 -- (-312.710) (-309.869) [-307.152] (-307.032) * [-310.812] (-310.588) (-311.583) (-307.889) -- 0:00:16
Average standard deviation of split frequencies: 0.013602
240500 -- (-312.141) (-308.895) (-308.081) [-308.069] * (-311.985) (-309.503) [-309.981] (-308.158) -- 0:00:16
241000 -- (-309.984) (-309.723) (-309.917) [-308.990] * [-308.689] (-309.287) (-308.242) (-309.696) -- 0:00:16
241500 -- (-309.101) [-312.631] (-309.339) (-307.116) * [-316.113] (-308.838) (-307.389) (-308.066) -- 0:00:16
242000 -- [-307.955] (-309.559) (-310.237) (-307.460) * (-309.434) (-307.840) (-308.458) [-308.774] -- 0:00:15
242500 -- (-317.562) (-310.266) [-308.196] (-310.471) * (-309.388) [-307.807] (-308.058) (-310.011) -- 0:00:15
243000 -- [-310.194] (-311.683) (-308.393) (-311.724) * (-308.298) (-309.876) (-313.685) [-308.821] -- 0:00:15
243500 -- (-311.445) (-308.679) (-310.599) [-308.085] * (-309.061) (-310.226) [-311.838] (-310.982) -- 0:00:15
244000 -- [-310.432] (-307.434) (-310.121) (-308.749) * (-307.591) (-312.774) [-307.932] (-311.021) -- 0:00:15
244500 -- [-308.332] (-307.457) (-310.361) (-311.892) * [-309.949] (-309.503) (-314.239) (-309.563) -- 0:00:15
245000 -- (-308.018) [-309.138] (-309.032) (-309.235) * (-309.282) (-310.487) (-309.309) [-309.820] -- 0:00:15
Average standard deviation of split frequencies: 0.012882
245500 -- (-307.756) (-311.068) (-308.851) [-307.424] * (-310.852) (-311.390) (-309.501) [-307.270] -- 0:00:15
246000 -- [-307.697] (-306.991) (-307.528) (-308.184) * (-310.331) (-308.832) (-307.278) [-308.681] -- 0:00:15
246500 -- (-312.020) (-308.097) (-306.770) [-310.311] * (-308.234) [-309.115] (-310.431) (-310.410) -- 0:00:15
247000 -- (-308.773) (-308.829) [-308.417] (-307.816) * (-307.996) (-308.281) [-308.817] (-309.391) -- 0:00:15
247500 -- (-308.736) (-307.970) (-311.433) [-307.736] * (-310.065) (-307.861) (-307.389) [-307.809] -- 0:00:15
248000 -- [-308.844] (-307.757) (-309.389) (-311.789) * [-310.662] (-308.646) (-312.652) (-308.864) -- 0:00:15
248500 -- [-309.839] (-310.096) (-309.400) (-308.583) * (-308.098) [-308.601] (-307.778) (-310.441) -- 0:00:15
249000 -- [-313.370] (-308.523) (-308.380) (-307.885) * (-307.525) (-312.234) (-308.377) [-310.394] -- 0:00:15
249500 -- (-313.944) (-314.017) (-310.520) [-308.037] * (-309.905) (-311.974) [-308.118] (-308.424) -- 0:00:15
250000 -- (-308.870) (-310.607) (-308.877) [-309.694] * [-308.894] (-307.467) (-307.769) (-310.378) -- 0:00:15
Average standard deviation of split frequencies: 0.013054
250500 -- (-308.142) (-311.776) [-309.204] (-308.762) * (-309.997) [-309.458] (-307.520) (-311.145) -- 0:00:14
251000 -- (-309.295) (-311.885) [-308.299] (-309.630) * (-310.409) [-311.400] (-309.102) (-308.885) -- 0:00:14
251500 -- (-307.045) (-310.655) [-308.422] (-311.860) * (-307.687) [-307.521] (-311.237) (-308.658) -- 0:00:14
252000 -- (-308.064) (-317.121) [-307.348] (-309.922) * (-307.196) [-309.097] (-310.044) (-314.094) -- 0:00:14
252500 -- (-309.086) (-307.695) (-311.890) [-308.496] * (-307.124) (-308.408) [-308.323] (-313.318) -- 0:00:14
253000 -- [-308.461] (-308.138) (-308.263) (-310.896) * (-307.350) [-311.394] (-314.844) (-309.151) -- 0:00:14
253500 -- (-308.540) (-307.469) [-308.036] (-314.520) * (-310.027) (-309.782) (-309.686) [-310.174] -- 0:00:14
254000 -- (-313.671) (-307.796) (-307.190) [-307.883] * (-313.354) (-310.597) (-312.467) [-309.642] -- 0:00:14
254500 -- (-311.210) (-308.053) [-314.053] (-308.666) * (-313.521) [-307.416] (-310.923) (-311.254) -- 0:00:15
255000 -- [-309.809] (-309.564) (-309.292) (-307.833) * (-312.693) [-308.374] (-313.200) (-309.578) -- 0:00:15
Average standard deviation of split frequencies: 0.015056
255500 -- [-310.136] (-307.679) (-310.963) (-308.242) * [-308.742] (-310.738) (-309.441) (-308.325) -- 0:00:15
256000 -- (-310.448) (-311.276) (-311.618) [-307.634] * (-308.598) (-309.127) [-308.901] (-310.898) -- 0:00:15
256500 -- (-309.754) (-309.443) [-310.177] (-310.821) * (-308.606) [-308.583] (-311.740) (-309.757) -- 0:00:15
257000 -- (-308.768) (-310.730) (-306.766) [-311.543] * (-311.864) [-308.153] (-308.065) (-308.293) -- 0:00:15
257500 -- (-313.031) [-307.263] (-307.519) (-308.908) * (-309.590) [-316.409] (-310.597) (-307.210) -- 0:00:15
258000 -- (-309.965) (-308.729) (-310.525) [-307.730] * (-308.822) (-310.048) (-309.139) [-310.781] -- 0:00:15
258500 -- (-309.711) [-311.455] (-308.674) (-309.800) * [-308.841] (-309.850) (-309.087) (-308.510) -- 0:00:14
259000 -- (-310.506) (-308.625) (-308.156) [-307.024] * [-308.358] (-309.692) (-314.338) (-313.771) -- 0:00:14
259500 -- (-309.053) [-309.272] (-308.135) (-309.227) * (-307.516) [-307.012] (-307.997) (-309.948) -- 0:00:14
260000 -- (-309.110) (-309.315) (-308.948) [-308.303] * [-307.837] (-307.008) (-314.681) (-308.431) -- 0:00:14
Average standard deviation of split frequencies: 0.014166
260500 -- (-309.248) (-312.539) [-312.085] (-310.785) * (-309.900) (-307.578) (-309.680) [-307.504] -- 0:00:14
261000 -- (-309.655) (-309.859) [-308.968] (-308.745) * (-312.339) (-310.733) [-310.683] (-309.619) -- 0:00:14
261500 -- (-309.418) [-308.535] (-307.710) (-307.282) * (-311.225) (-311.163) [-308.508] (-309.385) -- 0:00:14
262000 -- (-307.524) [-311.563] (-310.320) (-307.286) * (-311.041) [-308.577] (-307.464) (-307.435) -- 0:00:14
262500 -- (-309.796) [-309.000] (-310.260) (-307.858) * (-310.050) (-309.937) [-310.503] (-312.199) -- 0:00:14
263000 -- [-307.536] (-309.248) (-308.942) (-309.480) * (-309.149) [-310.249] (-310.163) (-310.918) -- 0:00:14
263500 -- (-308.740) (-308.662) [-308.909] (-308.040) * [-308.060] (-310.073) (-312.146) (-308.504) -- 0:00:14
264000 -- (-307.603) [-308.161] (-308.168) (-308.872) * (-311.427) (-308.443) (-311.999) [-307.609] -- 0:00:14
264500 -- (-309.606) [-307.902] (-310.245) (-309.174) * (-308.872) [-307.587] (-311.736) (-308.243) -- 0:00:14
265000 -- (-309.651) (-313.646) (-307.531) [-308.493] * (-310.766) [-308.829] (-312.850) (-307.227) -- 0:00:14
Average standard deviation of split frequencies: 0.014830
265500 -- [-307.310] (-311.045) (-308.846) (-309.345) * (-310.464) (-309.033) [-311.260] (-307.820) -- 0:00:14
266000 -- (-307.355) [-309.178] (-311.226) (-308.226) * (-308.598) (-308.010) (-311.680) [-310.084] -- 0:00:14
266500 -- (-307.357) (-307.708) [-311.770] (-307.100) * [-308.712] (-307.435) (-308.188) (-307.305) -- 0:00:14
267000 -- [-307.792] (-310.831) (-312.366) (-308.018) * (-309.857) (-307.546) [-309.646] (-309.650) -- 0:00:13
267500 -- [-308.192] (-312.315) (-312.529) (-307.840) * (-311.038) (-309.950) [-309.396] (-313.520) -- 0:00:13
268000 -- (-308.316) (-313.859) (-309.628) [-309.112] * [-311.041] (-312.286) (-311.037) (-309.866) -- 0:00:13
268500 -- (-308.189) (-307.672) (-309.812) [-310.896] * (-310.576) [-308.696] (-307.671) (-308.965) -- 0:00:13
269000 -- (-306.806) [-308.180] (-310.474) (-311.624) * (-309.472) [-310.198] (-307.683) (-308.744) -- 0:00:13
269500 -- (-308.222) (-314.466) (-308.523) [-307.631] * (-309.363) (-308.890) [-313.910] (-306.916) -- 0:00:13
270000 -- [-311.972] (-308.943) (-307.445) (-310.900) * (-313.215) (-307.537) (-310.095) [-307.425] -- 0:00:13
Average standard deviation of split frequencies: 0.015326
270500 -- (-307.560) (-313.315) (-312.696) [-310.615] * [-311.853] (-309.893) (-308.930) (-309.245) -- 0:00:13
271000 -- (-308.103) (-311.034) (-307.768) [-306.821] * (-312.027) (-312.019) (-310.783) [-309.125] -- 0:00:13
271500 -- (-309.194) [-311.999] (-311.659) (-308.576) * (-309.449) (-310.445) [-311.325] (-307.460) -- 0:00:13
272000 -- (-308.278) [-308.167] (-313.681) (-309.921) * (-308.521) [-310.648] (-308.850) (-309.229) -- 0:00:14
272500 -- (-307.472) (-308.540) [-310.804] (-307.002) * [-309.718] (-310.084) (-307.680) (-308.611) -- 0:00:14
273000 -- (-308.787) [-309.889] (-312.330) (-309.935) * (-311.753) (-310.294) [-308.617] (-307.904) -- 0:00:14
273500 -- (-308.001) [-309.437] (-309.775) (-311.390) * (-308.859) [-310.035] (-309.909) (-308.179) -- 0:00:14
274000 -- [-307.690] (-308.552) (-309.386) (-307.247) * [-307.264] (-308.898) (-311.691) (-308.185) -- 0:00:14
274500 -- [-309.069] (-309.513) (-309.532) (-307.602) * (-309.292) [-309.794] (-310.209) (-309.011) -- 0:00:13
275000 -- [-310.391] (-308.029) (-308.195) (-307.873) * (-308.893) (-310.516) (-308.097) [-308.008] -- 0:00:13
Average standard deviation of split frequencies: 0.015282
275500 -- [-307.795] (-309.540) (-308.061) (-307.980) * (-310.409) (-309.098) [-308.303] (-311.459) -- 0:00:13
276000 -- [-308.418] (-308.643) (-311.123) (-308.877) * [-308.317] (-308.703) (-310.903) (-308.221) -- 0:00:13
276500 -- (-308.367) (-307.600) (-310.388) [-309.058] * (-309.546) [-308.014] (-307.435) (-308.986) -- 0:00:13
277000 -- (-308.546) [-309.943] (-307.282) (-315.162) * (-311.356) [-308.274] (-311.868) (-308.634) -- 0:00:13
277500 -- [-307.024] (-308.394) (-309.906) (-311.089) * (-307.343) (-307.961) [-308.813] (-308.920) -- 0:00:13
278000 -- [-307.498] (-309.362) (-308.012) (-311.847) * (-309.689) (-309.387) (-307.389) [-310.685] -- 0:00:13
278500 -- (-307.929) [-312.594] (-307.723) (-309.408) * [-310.143] (-308.933) (-307.462) (-311.601) -- 0:00:13
279000 -- [-312.705] (-308.026) (-307.246) (-309.478) * (-309.247) [-307.806] (-306.777) (-311.402) -- 0:00:13
279500 -- (-311.998) (-310.283) (-307.825) [-308.877] * (-311.355) [-309.485] (-308.004) (-308.291) -- 0:00:13
280000 -- (-308.362) (-308.764) (-307.292) [-309.562] * (-312.632) [-308.617] (-307.663) (-308.664) -- 0:00:13
Average standard deviation of split frequencies: 0.016000
280500 -- (-308.310) (-310.199) [-308.218] (-309.225) * [-309.186] (-309.084) (-309.080) (-310.329) -- 0:00:13
281000 -- (-309.333) (-308.786) (-307.028) [-307.252] * (-308.136) (-309.648) [-308.775] (-309.275) -- 0:00:13
281500 -- (-308.864) (-309.270) [-307.533] (-307.545) * (-308.339) [-307.991] (-308.498) (-307.494) -- 0:00:13
282000 -- (-309.432) (-311.055) (-310.414) [-309.044] * (-309.502) (-308.475) (-309.885) [-308.131] -- 0:00:13
282500 -- (-310.022) (-315.916) [-308.279] (-312.380) * [-307.746] (-307.845) (-311.786) (-307.949) -- 0:00:13
283000 -- (-308.841) [-314.196] (-307.757) (-309.744) * [-307.332] (-308.140) (-311.527) (-307.049) -- 0:00:13
283500 -- (-311.150) (-307.802) (-307.543) [-310.874] * (-309.799) [-309.242] (-309.714) (-309.486) -- 0:00:12
284000 -- (-308.654) (-310.487) [-308.523] (-310.118) * (-310.953) [-309.586] (-310.329) (-308.474) -- 0:00:12
284500 -- (-310.174) (-308.373) [-307.990] (-310.610) * (-310.868) (-309.207) (-309.747) [-307.527] -- 0:00:12
285000 -- (-308.252) (-310.336) (-308.321) [-308.459] * [-309.545] (-308.341) (-308.667) (-309.758) -- 0:00:12
Average standard deviation of split frequencies: 0.015442
285500 -- (-309.789) (-307.139) [-310.713] (-310.855) * (-309.266) (-307.940) (-310.879) [-307.332] -- 0:00:12
286000 -- (-310.974) [-307.509] (-311.935) (-311.772) * (-308.424) (-311.790) [-308.412] (-307.098) -- 0:00:12
286500 -- (-308.104) (-311.096) (-307.492) [-310.353] * (-312.006) [-308.491] (-309.467) (-308.463) -- 0:00:12
287000 -- (-308.043) (-312.403) (-312.343) [-307.237] * [-309.442] (-308.297) (-307.445) (-313.190) -- 0:00:12
287500 -- (-309.637) (-309.861) (-307.910) [-309.456] * (-309.007) [-313.549] (-310.256) (-309.320) -- 0:00:12
288000 -- [-308.956] (-307.987) (-308.237) (-309.837) * (-310.712) (-306.779) (-308.100) [-309.152] -- 0:00:12
288500 -- (-310.914) (-309.416) [-308.651] (-312.787) * (-310.455) [-309.522] (-309.846) (-308.250) -- 0:00:12
289000 -- (-312.375) (-307.474) [-308.203] (-308.956) * (-311.302) (-308.918) (-309.372) [-309.143] -- 0:00:13
289500 -- (-309.617) [-309.006] (-310.551) (-308.231) * (-307.724) (-310.692) (-308.604) [-307.755] -- 0:00:13
290000 -- (-310.889) (-309.926) (-309.889) [-308.683] * [-309.219] (-309.116) (-309.955) (-308.628) -- 0:00:13
Average standard deviation of split frequencies: 0.015023
290500 -- (-311.056) [-307.927] (-312.845) (-310.322) * (-310.315) (-308.170) (-308.719) [-307.500] -- 0:00:12
291000 -- (-310.429) [-307.527] (-308.429) (-309.327) * (-308.313) [-308.199] (-310.091) (-311.302) -- 0:00:12
291500 -- [-308.464] (-307.109) (-308.363) (-309.637) * (-309.762) [-312.853] (-309.317) (-311.531) -- 0:00:12
292000 -- (-308.012) (-308.177) (-308.422) [-307.485] * (-310.563) (-312.177) [-308.011] (-310.284) -- 0:00:12
292500 -- (-310.266) [-308.456] (-310.159) (-307.335) * (-309.445) [-311.718] (-308.446) (-312.792) -- 0:00:12
293000 -- (-312.561) (-310.226) [-309.393] (-307.200) * (-312.404) (-310.164) (-308.253) [-308.069] -- 0:00:12
293500 -- (-310.890) (-309.493) (-308.454) [-308.843] * (-308.981) [-308.067] (-308.447) (-308.861) -- 0:00:12
294000 -- (-310.219) (-312.375) (-307.804) [-308.590] * (-310.090) (-309.070) [-309.941] (-314.103) -- 0:00:12
294500 -- (-308.175) [-311.189] (-313.294) (-306.844) * [-308.653] (-307.582) (-307.785) (-311.273) -- 0:00:12
295000 -- (-313.128) [-308.467] (-309.540) (-307.870) * (-307.417) (-306.858) (-313.020) [-309.084] -- 0:00:12
Average standard deviation of split frequencies: 0.013183
295500 -- (-307.992) [-307.360] (-307.897) (-310.436) * (-308.789) (-307.664) [-310.056] (-310.973) -- 0:00:12
296000 -- (-309.423) [-310.346] (-309.695) (-314.535) * (-309.101) [-309.053] (-309.637) (-308.452) -- 0:00:12
296500 -- (-309.643) [-307.841] (-312.795) (-310.175) * (-309.894) (-309.857) [-311.890] (-306.972) -- 0:00:12
297000 -- (-309.278) [-307.411] (-307.246) (-312.736) * (-308.370) (-309.298) [-307.852] (-308.687) -- 0:00:12
297500 -- (-309.574) (-311.014) (-310.040) [-308.533] * (-308.693) [-308.932] (-310.553) (-310.210) -- 0:00:12
298000 -- [-311.356] (-308.978) (-314.755) (-313.130) * (-308.957) (-310.415) [-311.596] (-308.919) -- 0:00:12
298500 -- (-308.072) (-307.119) (-309.978) [-309.307] * (-314.298) (-309.087) (-314.408) [-307.367] -- 0:00:12
299000 -- (-310.681) (-307.991) (-309.234) [-308.313] * (-311.703) (-309.659) [-309.272] (-311.280) -- 0:00:12
299500 -- (-310.881) (-307.863) [-308.246] (-311.959) * [-311.182] (-306.900) (-311.461) (-308.249) -- 0:00:12
300000 -- (-308.638) (-308.724) [-308.316] (-311.730) * [-308.655] (-308.485) (-310.098) (-308.266) -- 0:00:12
Average standard deviation of split frequencies: 0.013588
300500 -- [-307.320] (-308.118) (-308.072) (-308.722) * (-309.596) (-314.892) [-308.408] (-307.992) -- 0:00:11
301000 -- (-310.206) (-308.827) (-307.606) [-307.742] * [-308.599] (-309.425) (-309.118) (-307.970) -- 0:00:11
301500 -- [-308.583] (-309.146) (-311.678) (-309.852) * (-307.705) [-310.491] (-310.634) (-307.924) -- 0:00:11
302000 -- (-309.095) (-310.253) (-312.877) [-308.482] * (-310.523) [-308.083] (-308.182) (-307.576) -- 0:00:11
302500 -- (-313.043) [-308.548] (-315.081) (-308.181) * (-312.320) (-310.894) (-308.378) [-307.450] -- 0:00:11
303000 -- (-309.163) (-312.231) (-315.031) [-307.761] * [-308.845] (-309.144) (-309.496) (-307.460) -- 0:00:11
303500 -- [-308.832] (-308.492) (-309.580) (-307.320) * (-310.218) (-307.875) (-308.899) [-308.337] -- 0:00:11
304000 -- (-311.419) (-308.252) [-310.003] (-308.913) * (-310.185) (-307.822) [-308.577] (-311.594) -- 0:00:11
304500 -- (-309.902) (-308.490) (-317.950) [-308.106] * [-309.738] (-308.284) (-308.543) (-307.567) -- 0:00:11
305000 -- [-307.963] (-308.321) (-313.076) (-308.164) * (-308.370) [-308.276] (-309.964) (-311.973) -- 0:00:11
Average standard deviation of split frequencies: 0.013950
305500 -- [-310.438] (-309.970) (-309.049) (-308.486) * (-316.872) (-309.272) [-308.193] (-312.891) -- 0:00:11
306000 -- [-312.267] (-308.734) (-308.959) (-307.503) * (-311.373) (-311.408) [-309.717] (-317.197) -- 0:00:11
306500 -- (-307.792) [-308.325] (-308.367) (-307.039) * (-307.094) (-310.693) [-308.880] (-315.592) -- 0:00:11
307000 -- (-310.233) (-310.306) (-312.188) [-308.720] * (-307.980) (-309.506) (-310.931) [-307.265] -- 0:00:11
307500 -- (-309.916) (-307.529) (-309.445) [-307.431] * (-310.218) [-307.543] (-311.531) (-308.055) -- 0:00:11
308000 -- (-308.364) [-306.909] (-314.813) (-308.858) * (-310.344) (-310.180) (-312.431) [-307.346] -- 0:00:11
308500 -- (-308.875) (-317.126) [-312.428] (-308.562) * (-308.254) [-309.569] (-307.488) (-310.370) -- 0:00:11
309000 -- (-307.051) (-316.192) (-308.490) [-309.355] * [-310.172] (-310.893) (-307.381) (-310.169) -- 0:00:11
309500 -- (-308.555) (-312.446) [-307.016] (-312.250) * [-313.095] (-307.479) (-308.317) (-313.762) -- 0:00:11
310000 -- [-308.223] (-310.645) (-308.879) (-309.909) * (-313.806) (-307.546) [-309.455] (-315.827) -- 0:00:11
Average standard deviation of split frequencies: 0.013389
310500 -- (-310.252) (-310.468) (-311.341) [-307.465] * [-309.078] (-310.625) (-309.363) (-310.799) -- 0:00:11
311000 -- (-311.497) [-306.776] (-311.519) (-308.043) * [-310.113] (-309.115) (-309.917) (-310.438) -- 0:00:11
311500 -- (-308.231) (-308.728) (-309.897) [-308.066] * [-310.485] (-309.356) (-310.899) (-307.959) -- 0:00:11
312000 -- (-310.727) (-307.879) (-312.118) [-308.462] * (-307.380) (-314.278) (-313.664) [-307.778] -- 0:00:11
312500 -- (-307.611) (-308.218) (-313.835) [-307.029] * (-314.899) [-313.921] (-309.694) (-308.012) -- 0:00:11
313000 -- (-307.313) (-308.726) [-308.419] (-307.831) * [-308.156] (-310.648) (-311.583) (-307.248) -- 0:00:11
313500 -- (-307.803) [-308.411] (-309.221) (-308.866) * (-307.028) (-309.325) [-307.181] (-308.307) -- 0:00:11
314000 -- (-308.274) (-308.262) [-311.831] (-309.564) * [-306.974] (-310.218) (-308.318) (-309.624) -- 0:00:11
314500 -- (-308.893) (-307.717) (-308.737) [-308.229] * (-308.594) (-309.771) [-308.488] (-309.870) -- 0:00:11
315000 -- [-311.225] (-310.514) (-309.351) (-313.777) * [-308.215] (-308.487) (-308.344) (-307.566) -- 0:00:11
Average standard deviation of split frequencies: 0.012846
315500 -- [-309.092] (-308.482) (-311.461) (-312.200) * (-309.013) [-309.082] (-308.309) (-307.565) -- 0:00:11
316000 -- [-306.862] (-309.340) (-309.838) (-310.659) * (-308.718) (-308.477) [-309.746] (-307.803) -- 0:00:11
316500 -- (-309.449) (-312.169) (-309.475) [-307.448] * (-309.849) [-307.623] (-309.961) (-310.959) -- 0:00:11
317000 -- [-309.448] (-308.824) (-307.949) (-309.484) * (-311.610) (-307.282) [-309.197] (-308.546) -- 0:00:10
317500 -- (-308.900) (-308.178) [-310.894] (-308.757) * (-308.732) [-308.483] (-310.021) (-310.895) -- 0:00:10
318000 -- (-312.334) [-309.710] (-314.446) (-310.043) * (-308.953) [-307.958] (-310.163) (-314.696) -- 0:00:10
318500 -- (-310.739) (-308.947) (-312.268) [-308.541] * (-308.290) (-307.826) (-311.707) [-309.379] -- 0:00:10
319000 -- (-313.867) (-308.894) [-307.424] (-308.243) * [-310.776] (-307.937) (-309.913) (-308.697) -- 0:00:10
319500 -- (-309.982) (-309.875) (-307.412) [-308.016] * (-309.558) [-309.765] (-309.232) (-307.783) -- 0:00:10
320000 -- (-307.115) [-306.910] (-308.188) (-307.008) * (-309.300) (-311.530) (-307.932) [-308.329] -- 0:00:10
Average standard deviation of split frequencies: 0.012087
320500 -- (-312.742) (-309.987) (-307.030) [-307.016] * (-308.462) (-310.242) (-309.936) [-308.623] -- 0:00:10
321000 -- (-311.065) (-308.708) [-307.103] (-307.867) * (-308.189) [-308.088] (-308.762) (-307.891) -- 0:00:10
321500 -- (-312.813) (-310.469) (-307.390) [-308.832] * [-307.895] (-315.346) (-310.291) (-309.741) -- 0:00:10
322000 -- [-307.730] (-313.990) (-308.981) (-307.829) * (-308.703) [-317.345] (-310.693) (-312.220) -- 0:00:10
322500 -- (-308.829) (-310.057) (-311.271) [-309.662] * (-308.312) (-315.617) (-307.516) [-309.932] -- 0:00:10
323000 -- (-310.528) [-308.577] (-308.678) (-307.905) * (-306.815) (-306.866) (-312.821) [-309.574] -- 0:00:10
323500 -- (-311.322) [-309.009] (-308.852) (-314.283) * (-308.242) (-307.879) [-308.283] (-308.674) -- 0:00:10
324000 -- (-312.462) (-310.821) (-309.422) [-309.197] * (-308.178) (-308.494) (-309.484) [-308.410] -- 0:00:10
324500 -- [-311.838] (-314.002) (-308.498) (-307.179) * [-308.926] (-307.600) (-309.641) (-307.101) -- 0:00:10
325000 -- (-308.494) [-308.856] (-308.562) (-309.988) * (-312.011) (-308.290) [-310.611] (-307.208) -- 0:00:10
Average standard deviation of split frequencies: 0.012253
325500 -- (-308.663) (-310.479) (-308.252) [-309.166] * (-307.916) (-309.217) [-311.032] (-308.087) -- 0:00:10
326000 -- [-307.310] (-312.051) (-310.431) (-307.634) * [-310.785] (-309.461) (-309.059) (-307.211) -- 0:00:10
326500 -- (-309.405) (-308.767) [-311.222] (-307.788) * (-307.978) (-309.136) [-311.471] (-307.949) -- 0:00:10
327000 -- (-307.453) (-307.730) (-309.884) [-311.753] * (-310.898) (-310.751) [-307.972] (-309.107) -- 0:00:10
327500 -- [-308.877] (-310.114) (-309.718) (-308.103) * [-307.951] (-312.544) (-308.572) (-308.362) -- 0:00:10
328000 -- (-308.979) (-307.690) (-313.342) [-309.043] * (-309.918) (-312.358) [-310.277] (-307.995) -- 0:00:10
328500 -- [-308.454] (-309.946) (-311.706) (-310.021) * [-308.408] (-314.931) (-310.420) (-308.030) -- 0:00:10
329000 -- (-310.009) [-311.668] (-308.578) (-311.398) * [-308.177] (-309.806) (-308.319) (-308.645) -- 0:00:10
329500 -- (-309.026) (-324.500) (-311.165) [-309.614] * (-308.399) (-311.469) (-309.061) [-308.603] -- 0:00:10
330000 -- [-306.969] (-317.372) (-307.498) (-310.386) * (-307.677) [-309.210] (-309.295) (-308.133) -- 0:00:10
Average standard deviation of split frequencies: 0.011563
330500 -- (-306.805) (-309.383) (-309.529) [-311.683] * (-309.149) (-310.741) (-308.566) [-307.905] -- 0:00:10
331000 -- (-308.332) [-312.829] (-308.806) (-310.545) * (-308.218) (-307.967) (-309.089) [-309.390] -- 0:00:10
331500 -- (-311.031) (-308.193) (-310.068) [-308.941] * (-310.095) (-309.282) (-307.716) [-309.912] -- 0:00:10
332000 -- (-310.167) (-313.521) (-311.060) [-308.113] * (-309.550) (-309.120) [-309.736] (-308.361) -- 0:00:10
332500 -- (-308.608) [-308.284] (-310.730) (-313.362) * (-309.866) (-309.411) [-309.777] (-309.099) -- 0:00:10
333000 -- [-308.362] (-309.236) (-307.491) (-307.894) * (-312.009) [-307.647] (-308.219) (-309.441) -- 0:00:10
333500 -- (-310.484) (-312.144) [-307.727] (-307.859) * (-309.222) (-308.774) [-310.705] (-307.512) -- 0:00:09
334000 -- (-308.499) (-308.451) [-308.443] (-307.215) * (-312.806) (-310.372) [-314.723] (-308.195) -- 0:00:09
334500 -- (-307.903) [-309.142] (-309.991) (-308.598) * (-316.835) (-311.113) (-308.598) [-311.957] -- 0:00:09
335000 -- [-307.988] (-307.024) (-310.648) (-308.293) * (-311.085) (-309.962) (-311.845) [-307.903] -- 0:00:09
Average standard deviation of split frequencies: 0.012315
335500 -- (-308.149) (-310.311) (-307.294) [-310.103] * (-313.460) (-307.650) [-306.998] (-309.141) -- 0:00:09
336000 -- [-307.544] (-308.550) (-308.188) (-312.708) * [-309.495] (-308.261) (-309.986) (-308.109) -- 0:00:09
336500 -- (-308.917) [-309.280] (-308.628) (-308.573) * [-309.889] (-308.708) (-309.593) (-308.797) -- 0:00:09
337000 -- (-313.591) (-309.140) (-308.008) [-307.899] * (-311.164) [-307.594] (-308.113) (-308.857) -- 0:00:09
337500 -- (-312.179) (-308.170) (-307.112) [-309.872] * (-312.018) [-309.148] (-310.238) (-307.504) -- 0:00:09
338000 -- [-308.878] (-308.221) (-311.371) (-309.568) * (-310.178) (-314.758) (-312.998) [-313.210] -- 0:00:09
338500 -- [-310.767] (-310.926) (-310.683) (-308.672) * (-309.076) (-310.235) (-308.704) [-307.604] -- 0:00:09
339000 -- (-308.179) [-307.545] (-310.426) (-310.272) * (-307.174) [-307.743] (-310.653) (-311.229) -- 0:00:09
339500 -- (-307.988) (-312.287) (-312.053) [-312.125] * (-308.260) (-308.318) (-311.692) [-316.053] -- 0:00:09
340000 -- (-308.173) (-308.323) [-308.839] (-311.216) * (-308.008) (-308.771) [-310.037] (-318.053) -- 0:00:09
Average standard deviation of split frequencies: 0.012377
340500 -- [-310.663] (-307.898) (-308.731) (-308.420) * (-309.064) [-307.209] (-308.794) (-314.581) -- 0:00:09
341000 -- (-311.468) (-307.636) (-312.887) [-307.463] * (-316.689) [-307.746] (-307.562) (-307.731) -- 0:00:09
341500 -- (-310.372) (-308.325) [-310.413] (-308.425) * (-308.032) (-312.011) [-309.225] (-312.287) -- 0:00:09
342000 -- [-308.024] (-308.019) (-308.911) (-308.794) * (-307.981) [-308.791] (-309.389) (-308.989) -- 0:00:09
342500 -- [-308.143] (-312.949) (-309.341) (-307.678) * (-309.383) (-307.399) [-310.028] (-309.189) -- 0:00:09
343000 -- (-314.233) (-308.605) [-309.401] (-310.886) * (-307.213) [-307.180] (-311.675) (-309.409) -- 0:00:09
343500 -- (-308.594) [-308.740] (-307.709) (-308.447) * (-310.304) [-309.759] (-308.949) (-307.856) -- 0:00:09
344000 -- [-307.238] (-308.092) (-309.725) (-307.393) * (-310.129) (-313.217) [-308.487] (-309.964) -- 0:00:09
344500 -- (-310.092) [-309.094] (-309.879) (-308.418) * (-310.537) (-314.904) (-311.044) [-307.789] -- 0:00:09
345000 -- [-307.825] (-309.509) (-310.022) (-310.186) * (-310.471) (-311.727) (-314.647) [-307.487] -- 0:00:09
Average standard deviation of split frequencies: 0.012338
345500 -- [-310.595] (-314.414) (-311.079) (-312.777) * [-311.862] (-309.749) (-308.035) (-308.312) -- 0:00:09
346000 -- (-309.615) (-309.104) (-310.537) [-308.235] * (-307.818) [-309.316] (-307.944) (-313.771) -- 0:00:09
346500 -- (-309.714) (-307.687) [-311.904] (-310.236) * (-309.587) (-309.151) (-309.735) [-307.542] -- 0:00:09
347000 -- [-311.751] (-307.801) (-309.887) (-308.179) * (-310.182) (-310.911) (-312.725) [-309.744] -- 0:00:09
347500 -- (-311.389) [-310.303] (-310.579) (-309.720) * (-309.039) [-307.337] (-308.356) (-308.871) -- 0:00:09
348000 -- [-308.651] (-311.276) (-307.926) (-307.763) * (-310.465) [-308.215] (-308.122) (-310.238) -- 0:00:09
348500 -- (-309.222) (-307.063) (-311.698) [-309.340] * (-311.571) (-310.326) [-310.273] (-311.314) -- 0:00:09
349000 -- [-307.926] (-308.625) (-309.684) (-309.556) * (-308.240) (-307.621) (-311.448) [-308.946] -- 0:00:09
349500 -- (-308.045) (-307.871) [-307.844] (-308.471) * (-310.670) [-309.386] (-311.296) (-310.268) -- 0:00:09
350000 -- (-309.681) [-307.094] (-312.261) (-308.702) * (-310.529) [-310.914] (-308.226) (-307.843) -- 0:00:09
Average standard deviation of split frequencies: 0.011800
350500 -- [-309.136] (-310.364) (-310.402) (-310.281) * [-309.697] (-313.614) (-308.281) (-309.745) -- 0:00:08
351000 -- (-309.749) (-313.415) [-308.890] (-308.852) * (-311.031) (-310.189) (-307.511) [-311.973] -- 0:00:08
351500 -- (-308.881) (-309.559) [-310.500] (-310.241) * (-309.585) (-310.683) [-307.731] (-310.122) -- 0:00:08
352000 -- (-308.278) (-308.130) [-310.368] (-307.988) * (-308.380) [-311.320] (-307.730) (-308.683) -- 0:00:08
352500 -- (-309.767) (-307.267) (-309.961) [-307.610] * [-308.957] (-308.004) (-308.615) (-307.342) -- 0:00:08
353000 -- (-307.597) (-311.249) (-310.578) [-308.473] * (-308.987) (-316.271) (-309.353) [-309.506] -- 0:00:08
353500 -- (-310.929) [-309.964] (-311.503) (-309.134) * (-307.879) (-312.942) [-312.636] (-310.554) -- 0:00:08
354000 -- [-308.799] (-308.547) (-308.855) (-308.922) * (-307.240) (-309.345) [-308.594] (-308.981) -- 0:00:08
354500 -- [-308.101] (-315.275) (-309.200) (-310.822) * (-311.086) (-311.944) [-306.846] (-308.905) -- 0:00:08
355000 -- (-308.931) (-315.614) (-307.453) [-308.104] * (-310.906) (-309.376) (-308.482) [-307.586] -- 0:00:08
Average standard deviation of split frequencies: 0.013242
355500 -- [-308.306] (-308.892) (-310.368) (-310.930) * (-311.428) [-308.086] (-311.882) (-309.646) -- 0:00:08
356000 -- (-309.421) [-307.795] (-313.402) (-312.548) * (-312.288) (-307.991) [-309.756] (-310.449) -- 0:00:08
356500 -- (-310.760) (-307.621) [-309.665] (-307.649) * (-310.032) (-311.485) [-307.616] (-315.893) -- 0:00:08
357000 -- (-310.825) [-308.087] (-307.558) (-308.508) * (-311.268) [-308.489] (-308.738) (-316.081) -- 0:00:08
357500 -- (-310.595) [-311.817] (-309.205) (-308.424) * (-310.928) (-308.564) [-308.451] (-313.481) -- 0:00:08
358000 -- (-314.034) [-310.500] (-307.237) (-309.348) * [-308.941] (-310.106) (-309.850) (-309.255) -- 0:00:08
358500 -- (-307.461) (-312.934) [-308.915] (-308.144) * (-312.552) (-313.513) (-308.038) [-310.592] -- 0:00:08
359000 -- (-308.404) [-312.772] (-310.458) (-309.945) * (-308.472) [-308.051] (-309.357) (-309.211) -- 0:00:08
359500 -- [-307.877] (-314.104) (-307.811) (-307.241) * (-311.016) [-307.748] (-308.562) (-308.182) -- 0:00:08
360000 -- (-311.971) (-310.362) [-309.115] (-315.099) * (-307.377) (-308.489) (-310.297) [-308.795] -- 0:00:08
Average standard deviation of split frequencies: 0.013070
360500 -- [-307.154] (-310.209) (-310.490) (-309.573) * (-309.333) [-311.768] (-310.177) (-311.919) -- 0:00:08
361000 -- (-311.274) (-308.426) (-309.132) [-308.430] * (-307.889) (-308.855) (-309.370) [-310.113] -- 0:00:08
361500 -- (-309.386) [-308.499] (-308.649) (-308.164) * (-308.093) (-310.205) (-308.772) [-311.205] -- 0:00:08
362000 -- (-308.017) (-310.693) (-310.021) [-309.354] * (-308.466) [-308.856] (-307.779) (-310.074) -- 0:00:08
362500 -- (-309.015) (-307.519) (-310.030) [-308.519] * [-309.588] (-308.034) (-310.611) (-308.328) -- 0:00:08
363000 -- [-310.579] (-309.090) (-310.638) (-310.198) * [-307.132] (-316.060) (-311.660) (-309.716) -- 0:00:08
363500 -- (-311.216) (-307.614) (-307.647) [-309.879] * (-308.785) (-308.414) (-307.587) [-312.501] -- 0:00:08
364000 -- (-309.020) (-307.434) (-309.209) [-307.506] * (-309.203) [-309.403] (-310.330) (-307.966) -- 0:00:08
364500 -- (-310.785) [-308.759] (-308.833) (-309.067) * (-307.361) (-307.447) (-309.240) [-312.362] -- 0:00:08
365000 -- (-310.581) (-307.492) (-307.677) [-308.795] * (-308.692) [-307.194] (-309.023) (-309.363) -- 0:00:08
Average standard deviation of split frequencies: 0.013354
365500 -- [-309.084] (-308.546) (-307.866) (-307.942) * [-307.337] (-307.818) (-309.363) (-309.838) -- 0:00:08
366000 -- (-314.491) (-312.694) (-308.587) [-309.487] * (-309.190) (-306.979) (-308.946) [-309.608] -- 0:00:08
366500 -- (-309.762) [-311.626] (-308.712) (-307.744) * (-312.341) (-314.492) [-307.320] (-308.532) -- 0:00:08
367000 -- (-313.897) (-315.327) [-310.570] (-308.009) * (-307.746) [-312.829] (-307.197) (-312.511) -- 0:00:07
367500 -- (-310.036) (-308.561) (-311.862) [-309.117] * (-313.007) (-313.457) [-308.035] (-312.978) -- 0:00:07
368000 -- (-308.431) [-309.477] (-309.241) (-308.483) * (-308.931) (-312.184) [-308.846] (-312.177) -- 0:00:07
368500 -- (-309.505) (-308.849) (-307.757) [-313.036] * [-307.772] (-309.170) (-309.363) (-312.301) -- 0:00:07
369000 -- (-309.487) (-309.799) [-311.384] (-313.235) * (-309.770) (-309.502) (-311.604) [-309.160] -- 0:00:07
369500 -- (-310.078) [-308.898] (-308.620) (-311.477) * [-306.912] (-306.760) (-308.519) (-308.376) -- 0:00:07
370000 -- [-307.262] (-311.284) (-310.291) (-310.025) * (-307.747) [-307.701] (-308.392) (-308.089) -- 0:00:07
Average standard deviation of split frequencies: 0.012852
370500 -- [-308.342] (-308.121) (-312.334) (-309.451) * (-313.359) [-308.714] (-309.511) (-307.775) -- 0:00:07
371000 -- (-308.104) (-316.071) [-307.514] (-309.987) * (-309.298) [-309.880] (-308.732) (-309.375) -- 0:00:07
371500 -- [-307.839] (-313.206) (-312.080) (-308.565) * (-310.290) [-309.058] (-308.636) (-310.746) -- 0:00:07
372000 -- [-307.813] (-309.995) (-307.149) (-308.554) * (-307.150) (-312.041) [-309.101] (-309.181) -- 0:00:07
372500 -- [-308.666] (-312.764) (-308.616) (-310.559) * (-307.018) [-308.204] (-309.102) (-308.569) -- 0:00:07
373000 -- (-312.354) (-310.810) [-308.153] (-308.393) * (-307.789) [-310.619] (-307.597) (-312.315) -- 0:00:07
373500 -- [-314.179] (-308.972) (-308.184) (-308.481) * (-310.347) (-307.837) [-308.981] (-309.148) -- 0:00:07
374000 -- [-308.875] (-311.101) (-311.224) (-307.537) * [-313.438] (-307.783) (-307.778) (-311.056) -- 0:00:07
374500 -- (-308.835) (-308.239) (-311.151) [-308.243] * (-311.005) (-310.194) [-310.615] (-311.295) -- 0:00:07
375000 -- (-309.110) (-310.607) (-308.460) [-309.328] * (-308.679) [-308.410] (-311.254) (-307.530) -- 0:00:07
Average standard deviation of split frequencies: 0.012141
375500 -- (-307.110) [-310.084] (-313.971) (-309.301) * (-309.597) (-308.239) (-313.278) [-307.464] -- 0:00:07
376000 -- (-310.917) (-309.806) (-308.750) [-309.438] * (-309.580) [-310.117] (-310.501) (-310.235) -- 0:00:07
376500 -- [-308.208] (-310.201) (-309.661) (-307.463) * [-308.794] (-307.452) (-313.145) (-310.597) -- 0:00:07
377000 -- [-308.352] (-310.207) (-311.230) (-312.195) * (-308.404) (-307.268) [-313.780] (-307.640) -- 0:00:07
377500 -- (-308.032) [-307.512] (-307.849) (-307.175) * (-308.394) [-310.988] (-312.012) (-309.589) -- 0:00:07
378000 -- (-307.320) [-308.952] (-307.550) (-309.033) * [-308.524] (-308.284) (-309.416) (-311.684) -- 0:00:07
378500 -- (-309.472) (-308.646) [-311.455] (-310.196) * [-307.781] (-313.118) (-309.000) (-307.692) -- 0:00:07
379000 -- (-308.112) (-307.758) (-312.981) [-310.849] * (-309.163) (-308.641) [-307.843] (-309.057) -- 0:00:07
379500 -- (-309.719) (-308.574) (-310.858) [-311.433] * (-310.544) (-309.334) [-309.434] (-308.791) -- 0:00:07
380000 -- (-310.117) (-311.521) [-309.423] (-308.025) * (-314.115) (-309.291) [-308.005] (-315.506) -- 0:00:07
Average standard deviation of split frequencies: 0.012318
380500 -- (-308.764) (-309.845) (-310.000) [-307.381] * (-310.178) (-310.093) (-307.518) [-307.316] -- 0:00:07
381000 -- [-310.282] (-308.041) (-311.179) (-312.788) * (-308.228) (-310.562) (-311.067) [-315.002] -- 0:00:07
381500 -- (-308.116) (-308.104) [-309.745] (-309.791) * (-309.045) (-309.144) [-308.927] (-313.906) -- 0:00:07
382000 -- [-308.597] (-308.693) (-308.257) (-308.908) * (-307.320) (-312.240) [-310.988] (-310.005) -- 0:00:07
382500 -- [-309.041] (-312.183) (-308.508) (-317.424) * [-308.108] (-311.630) (-311.386) (-310.428) -- 0:00:07
383000 -- [-307.370] (-310.613) (-311.947) (-308.056) * [-309.379] (-312.444) (-312.887) (-308.320) -- 0:00:07
383500 -- (-309.964) (-310.063) (-308.894) [-307.368] * [-307.990] (-313.924) (-313.994) (-309.024) -- 0:00:06
384000 -- (-307.713) (-310.031) (-308.324) [-308.846] * (-307.089) [-310.425] (-313.692) (-308.323) -- 0:00:06
384500 -- (-306.964) (-312.715) [-310.355] (-308.630) * [-307.185] (-309.143) (-311.651) (-309.688) -- 0:00:06
385000 -- [-309.127] (-309.929) (-307.351) (-307.922) * (-313.183) (-311.073) (-308.375) [-310.801] -- 0:00:06
Average standard deviation of split frequencies: 0.012598
385500 -- (-310.499) (-309.795) [-307.443] (-310.463) * [-311.250] (-310.710) (-312.650) (-310.122) -- 0:00:06
386000 -- [-312.983] (-310.196) (-310.198) (-310.022) * (-308.974) (-311.804) (-311.341) [-307.031] -- 0:00:06
386500 -- (-314.210) [-308.818] (-312.513) (-310.573) * (-311.293) (-314.390) [-310.720] (-309.407) -- 0:00:06
387000 -- (-309.838) (-308.267) [-307.651] (-310.653) * (-312.082) [-309.011] (-312.706) (-308.661) -- 0:00:06
387500 -- (-308.807) (-311.969) [-307.886] (-308.278) * [-308.400] (-308.748) (-310.838) (-309.242) -- 0:00:06
388000 -- (-311.742) [-310.063] (-307.465) (-310.085) * (-308.841) [-313.049] (-309.843) (-307.897) -- 0:00:06
388500 -- (-314.202) (-307.336) [-307.410] (-308.730) * (-309.969) (-308.290) [-310.050] (-310.096) -- 0:00:06
389000 -- (-309.753) (-307.411) [-309.526] (-309.028) * (-307.643) (-309.661) [-309.485] (-307.863) -- 0:00:06
389500 -- (-311.090) [-310.955] (-307.633) (-310.476) * (-310.314) [-309.190] (-310.002) (-309.820) -- 0:00:06
390000 -- (-315.989) (-308.329) (-308.483) [-307.559] * [-308.173] (-308.707) (-308.061) (-312.030) -- 0:00:06
Average standard deviation of split frequencies: 0.012130
390500 -- [-308.035] (-307.158) (-308.746) (-311.641) * [-310.210] (-309.880) (-308.905) (-309.324) -- 0:00:06
391000 -- [-307.729] (-309.969) (-312.697) (-309.629) * (-309.329) (-308.434) [-312.441] (-312.134) -- 0:00:06
391500 -- [-310.444] (-308.151) (-311.299) (-310.786) * (-309.518) (-310.426) [-310.398] (-308.070) -- 0:00:06
392000 -- (-314.018) (-308.200) (-310.830) [-307.992] * (-309.250) [-310.085] (-308.708) (-309.045) -- 0:00:06
392500 -- (-309.503) [-309.195] (-308.861) (-309.104) * (-312.699) (-309.001) [-308.119] (-308.724) -- 0:00:06
393000 -- (-308.949) [-309.061] (-311.439) (-316.168) * (-310.333) (-307.725) (-308.904) [-308.365] -- 0:00:06
393500 -- (-310.765) [-308.599] (-309.677) (-307.967) * (-309.018) [-313.732] (-312.423) (-311.559) -- 0:00:06
394000 -- (-307.252) (-307.335) (-308.487) [-311.215] * (-307.730) (-308.908) [-309.604] (-310.792) -- 0:00:06
394500 -- (-308.670) (-307.789) (-309.388) [-311.610] * (-307.273) (-312.046) (-313.255) [-307.086] -- 0:00:06
395000 -- [-309.206] (-312.263) (-309.491) (-310.003) * (-308.207) (-312.414) (-308.190) [-309.129] -- 0:00:06
Average standard deviation of split frequencies: 0.011772
395500 -- [-309.436] (-307.180) (-310.339) (-310.256) * (-311.977) (-312.453) (-308.002) [-307.304] -- 0:00:06
396000 -- (-308.188) (-309.610) (-311.184) [-308.790] * (-308.278) (-310.638) (-309.841) [-308.701] -- 0:00:06
396500 -- (-313.200) [-308.254] (-309.978) (-307.744) * [-308.093] (-309.044) (-311.389) (-311.303) -- 0:00:06
397000 -- [-307.026] (-309.792) (-308.084) (-311.557) * (-311.776) (-307.481) (-310.352) [-309.364] -- 0:00:06
397500 -- (-309.640) (-309.779) (-312.000) [-309.774] * (-311.946) (-309.831) (-310.823) [-312.801] -- 0:00:06
398000 -- [-308.757] (-309.632) (-311.152) (-309.811) * (-307.978) [-309.919] (-309.851) (-308.718) -- 0:00:06
398500 -- (-311.945) [-308.590] (-309.747) (-309.679) * (-307.464) [-307.714] (-311.956) (-310.488) -- 0:00:06
399000 -- (-308.795) [-308.358] (-308.826) (-309.307) * (-308.781) (-311.399) (-308.846) [-311.567] -- 0:00:06
399500 -- (-309.860) [-308.336] (-309.718) (-311.764) * (-310.187) (-310.603) [-310.061] (-309.228) -- 0:00:06
400000 -- (-313.904) (-308.318) (-310.785) [-315.932] * (-308.277) (-308.590) (-310.876) [-308.441] -- 0:00:06
Average standard deviation of split frequencies: 0.011700
400500 -- [-308.430] (-307.345) (-309.944) (-315.906) * (-312.298) [-309.813] (-315.116) (-307.866) -- 0:00:05
401000 -- (-309.032) [-307.884] (-310.059) (-310.298) * (-311.197) (-312.077) (-311.139) [-309.415] -- 0:00:05
401500 -- (-308.205) (-310.915) (-309.385) [-308.701] * (-308.423) (-309.407) (-308.143) [-309.159] -- 0:00:05
402000 -- (-307.873) [-307.486] (-309.150) (-308.119) * (-307.274) [-310.824] (-307.838) (-307.005) -- 0:00:05
402500 -- (-308.470) [-307.836] (-314.134) (-312.484) * [-310.750] (-307.753) (-310.453) (-309.553) -- 0:00:05
403000 -- (-310.116) [-307.626] (-310.367) (-310.608) * (-309.367) (-311.377) (-307.280) [-308.050] -- 0:00:05
403500 -- (-314.634) [-307.476] (-307.334) (-307.794) * (-309.498) (-307.661) (-307.787) [-307.268] -- 0:00:05
404000 -- (-310.583) (-307.458) [-308.270] (-306.994) * (-309.324) (-308.585) [-309.588] (-307.468) -- 0:00:05
404500 -- (-309.179) (-307.532) (-307.703) [-307.319] * (-310.801) (-307.716) [-307.640] (-307.419) -- 0:00:05
405000 -- (-312.887) [-309.909] (-307.556) (-308.083) * [-311.010] (-309.215) (-307.860) (-316.062) -- 0:00:05
Average standard deviation of split frequencies: 0.011546
405500 -- (-311.030) (-310.675) (-307.776) [-307.317] * (-310.357) [-308.795] (-309.236) (-309.088) -- 0:00:05
406000 -- (-307.183) (-309.475) (-308.640) [-307.963] * [-307.003] (-307.455) (-307.019) (-307.881) -- 0:00:05
406500 -- (-307.354) (-309.509) [-310.120] (-309.217) * (-309.128) (-309.741) [-308.210] (-307.944) -- 0:00:05
407000 -- [-309.314] (-307.956) (-310.980) (-310.843) * (-309.643) (-309.716) (-308.921) [-307.448] -- 0:00:05
407500 -- (-308.544) [-309.881] (-309.747) (-312.653) * (-308.638) (-308.211) (-308.175) [-308.404] -- 0:00:05
408000 -- (-311.565) (-309.904) (-308.158) [-307.877] * (-311.616) (-309.306) (-307.392) [-308.124] -- 0:00:05
408500 -- [-310.257] (-308.515) (-309.488) (-307.674) * (-309.373) (-309.399) [-308.128] (-308.615) -- 0:00:05
409000 -- [-307.974] (-309.333) (-315.711) (-307.815) * (-310.686) [-309.049] (-310.048) (-310.163) -- 0:00:05
409500 -- [-309.904] (-313.383) (-308.590) (-307.425) * [-309.523] (-310.830) (-308.391) (-307.427) -- 0:00:05
410000 -- [-307.736] (-313.428) (-310.071) (-307.370) * [-308.481] (-309.937) (-308.514) (-308.272) -- 0:00:05
Average standard deviation of split frequencies: 0.010905
410500 -- (-306.945) (-311.818) [-309.997] (-307.834) * [-307.571] (-309.217) (-311.501) (-310.061) -- 0:00:05
411000 -- [-308.503] (-307.919) (-308.200) (-308.720) * (-307.151) (-317.354) [-310.098] (-311.227) -- 0:00:05
411500 -- (-307.568) [-312.134] (-311.462) (-308.878) * [-308.242] (-310.717) (-308.023) (-309.411) -- 0:00:05
412000 -- (-307.747) (-309.292) [-309.647] (-308.627) * (-307.448) (-310.737) [-310.586] (-306.830) -- 0:00:05
412500 -- (-309.006) (-308.155) (-308.662) [-307.369] * (-309.909) (-314.364) [-308.550] (-307.382) -- 0:00:05
413000 -- [-307.884] (-310.092) (-307.499) (-307.603) * [-308.135] (-312.918) (-308.584) (-311.089) -- 0:00:05
413500 -- (-308.097) (-308.951) [-308.926] (-312.072) * (-307.903) (-310.452) [-314.726] (-313.104) -- 0:00:05
414000 -- [-310.359] (-307.801) (-311.100) (-309.528) * (-308.281) (-312.876) (-310.221) [-307.438] -- 0:00:05
414500 -- (-308.967) [-309.289] (-309.487) (-309.165) * [-309.317] (-308.250) (-308.865) (-310.771) -- 0:00:05
415000 -- (-308.302) (-308.398) [-308.974] (-309.948) * (-311.448) [-307.674] (-310.539) (-310.566) -- 0:00:05
Average standard deviation of split frequencies: 0.010465
415500 -- [-311.895] (-308.403) (-311.579) (-309.964) * [-308.629] (-309.726) (-307.670) (-309.644) -- 0:00:05
416000 -- (-308.947) (-309.654) [-307.560] (-311.311) * (-309.412) (-310.941) [-310.298] (-307.866) -- 0:00:05
416500 -- (-311.985) (-311.340) (-308.399) [-313.384] * (-307.310) (-307.873) [-309.400] (-315.578) -- 0:00:05
417000 -- (-310.132) (-309.489) [-308.317] (-310.629) * [-311.705] (-307.618) (-310.900) (-307.865) -- 0:00:04
417500 -- (-310.931) (-313.884) (-307.765) [-307.920] * (-312.894) (-309.428) [-307.988] (-316.681) -- 0:00:04
418000 -- [-309.324] (-308.996) (-307.410) (-308.106) * (-316.261) [-310.174] (-314.783) (-308.173) -- 0:00:04
418500 -- (-307.765) [-310.460] (-309.357) (-309.982) * (-308.012) (-309.766) [-312.221] (-310.624) -- 0:00:04
419000 -- (-308.998) [-309.504] (-307.947) (-311.025) * (-310.012) [-312.006] (-310.619) (-308.019) -- 0:00:04
419500 -- [-308.723] (-310.037) (-308.848) (-311.451) * (-309.224) (-307.364) [-308.555] (-309.519) -- 0:00:04
420000 -- (-312.657) [-309.684] (-308.352) (-308.331) * (-308.997) (-309.026) [-311.689] (-308.005) -- 0:00:04
Average standard deviation of split frequencies: 0.010415
420500 -- (-312.386) [-312.400] (-307.871) (-306.986) * [-308.161] (-309.229) (-314.762) (-308.934) -- 0:00:04
421000 -- (-309.187) [-314.823] (-307.956) (-314.899) * (-308.834) (-308.331) [-307.684] (-312.535) -- 0:00:04
421500 -- (-309.876) (-306.815) [-309.318] (-314.054) * [-307.038] (-308.556) (-308.490) (-310.878) -- 0:00:04
422000 -- (-308.852) [-307.286] (-310.669) (-311.074) * [-307.586] (-308.705) (-309.847) (-308.433) -- 0:00:04
422500 -- (-310.449) (-308.445) (-308.218) [-306.921] * (-311.058) (-307.460) [-311.747] (-310.102) -- 0:00:04
423000 -- (-308.726) (-307.820) [-312.645] (-308.068) * [-306.855] (-309.252) (-307.122) (-309.626) -- 0:00:04
423500 -- (-311.228) (-307.676) [-312.834] (-308.636) * (-308.383) (-311.186) [-307.690] (-307.768) -- 0:00:04
424000 -- (-312.677) [-308.006] (-307.262) (-309.265) * (-308.758) (-309.314) [-308.217] (-309.047) -- 0:00:04
424500 -- (-308.054) (-308.691) (-308.235) [-308.040] * (-312.679) (-309.884) [-307.513] (-307.735) -- 0:00:04
425000 -- [-308.026] (-307.587) (-310.078) (-310.084) * (-317.804) (-312.639) [-309.181] (-311.340) -- 0:00:04
Average standard deviation of split frequencies: 0.010328
425500 -- (-308.291) (-307.957) (-308.593) [-308.545] * [-308.492] (-310.492) (-311.520) (-315.137) -- 0:00:04
426000 -- [-308.216] (-309.331) (-308.086) (-310.823) * [-311.210] (-308.347) (-310.915) (-308.684) -- 0:00:04
426500 -- (-307.113) (-307.571) [-307.409] (-310.546) * (-311.064) [-309.052] (-309.043) (-308.037) -- 0:00:04
427000 -- (-307.273) (-310.909) (-311.309) [-309.163] * (-309.303) (-309.645) [-307.304] (-308.296) -- 0:00:04
427500 -- [-308.239] (-309.823) (-309.940) (-310.499) * (-308.182) (-307.264) [-307.185] (-310.020) -- 0:00:04
428000 -- (-308.793) [-310.925] (-308.270) (-310.265) * [-313.620] (-310.140) (-307.455) (-311.726) -- 0:00:04
428500 -- (-307.994) (-307.957) [-307.438] (-311.347) * (-310.634) (-313.703) (-308.113) [-308.673] -- 0:00:04
429000 -- [-310.065] (-312.282) (-309.811) (-308.506) * [-309.405] (-312.083) (-307.566) (-308.745) -- 0:00:04
429500 -- (-311.334) (-311.206) (-311.097) [-308.278] * (-307.666) (-309.531) [-308.215] (-308.877) -- 0:00:04
430000 -- [-310.464] (-308.726) (-311.463) (-311.995) * (-308.805) (-309.803) [-312.027] (-312.325) -- 0:00:04
Average standard deviation of split frequencies: 0.009594
430500 -- [-309.569] (-312.408) (-307.960) (-308.306) * (-308.814) [-307.533] (-310.656) (-311.472) -- 0:00:04
431000 -- (-308.438) (-308.148) [-309.225] (-308.735) * (-308.360) [-307.518] (-310.889) (-307.618) -- 0:00:04
431500 -- [-308.468] (-308.167) (-307.803) (-310.084) * (-312.408) (-309.908) (-309.695) [-308.406] -- 0:00:04
432000 -- [-308.700] (-307.129) (-307.472) (-309.084) * (-308.585) [-310.992] (-311.823) (-316.396) -- 0:00:04
432500 -- (-307.472) (-307.340) (-309.289) [-307.616] * [-308.884] (-311.707) (-309.028) (-307.489) -- 0:00:04
433000 -- (-307.547) [-308.797] (-307.880) (-308.752) * [-308.579] (-308.794) (-310.971) (-309.846) -- 0:00:04
433500 -- (-309.407) (-307.285) (-307.901) [-307.118] * (-307.682) (-309.670) [-309.506] (-308.153) -- 0:00:03
434000 -- (-310.104) [-308.777] (-310.084) (-308.776) * (-309.673) [-310.229] (-309.727) (-308.890) -- 0:00:03
434500 -- (-308.264) (-307.801) [-308.013] (-308.168) * (-308.868) (-309.718) [-308.382] (-308.313) -- 0:00:03
435000 -- (-308.572) (-311.053) (-312.264) [-307.214] * (-307.922) (-311.295) (-308.783) [-309.009] -- 0:00:03
Average standard deviation of split frequencies: 0.009190
435500 -- (-308.017) (-308.532) [-308.621] (-309.947) * (-308.810) (-312.530) (-309.589) [-309.652] -- 0:00:03
436000 -- (-311.212) (-311.738) (-309.127) [-311.033] * (-308.760) (-310.829) [-310.125] (-310.971) -- 0:00:03
436500 -- [-311.199] (-310.053) (-312.999) (-310.949) * [-307.857] (-307.948) (-310.111) (-308.345) -- 0:00:03
437000 -- [-309.407] (-313.370) (-308.462) (-309.773) * (-307.363) (-307.904) (-311.324) [-311.782] -- 0:00:03
437500 -- (-309.091) (-312.712) (-307.405) [-310.401] * (-310.277) (-307.894) [-307.613] (-310.296) -- 0:00:03
438000 -- (-310.510) [-312.972] (-308.128) (-315.606) * (-309.743) [-307.661] (-309.702) (-308.126) -- 0:00:03
438500 -- [-311.580] (-310.274) (-308.125) (-310.145) * (-307.986) (-309.315) [-309.891] (-309.432) -- 0:00:03
439000 -- (-308.488) [-310.987] (-308.348) (-310.526) * (-307.242) (-309.217) [-308.174] (-306.989) -- 0:00:03
439500 -- (-308.960) [-310.850] (-307.980) (-308.969) * (-307.077) [-307.256] (-310.869) (-309.089) -- 0:00:03
440000 -- (-307.885) [-311.811] (-310.657) (-310.848) * (-307.323) [-309.435] (-315.453) (-308.978) -- 0:00:03
Average standard deviation of split frequencies: 0.009160
440500 -- (-310.454) (-307.718) [-309.545] (-310.962) * [-309.311] (-309.331) (-307.848) (-307.108) -- 0:00:03
441000 -- (-310.013) (-310.408) (-307.567) [-308.655] * (-312.441) (-310.503) [-307.981] (-312.692) -- 0:00:03
441500 -- (-308.480) [-308.379] (-311.280) (-308.944) * [-307.001] (-310.897) (-310.193) (-308.945) -- 0:00:03
442000 -- (-310.719) [-311.355] (-310.128) (-311.958) * (-312.574) (-309.106) (-308.619) [-307.460] -- 0:00:03
442500 -- (-310.601) (-310.058) (-307.672) [-309.577] * (-309.868) [-310.915] (-307.677) (-307.885) -- 0:00:03
443000 -- (-312.522) (-314.214) (-310.221) [-307.320] * (-309.982) (-310.755) (-308.933) [-308.784] -- 0:00:03
443500 -- (-310.681) (-313.787) [-307.945] (-312.105) * (-308.915) (-307.363) (-309.178) [-308.452] -- 0:00:03
444000 -- [-307.625] (-308.754) (-310.014) (-311.395) * [-311.071] (-308.945) (-308.737) (-310.037) -- 0:00:03
444500 -- (-309.210) (-309.464) [-309.016] (-310.144) * (-308.677) (-310.039) (-309.532) [-315.299] -- 0:00:03
445000 -- (-310.285) (-308.687) [-309.089] (-315.265) * (-308.739) (-309.563) [-310.911] (-308.500) -- 0:00:03
Average standard deviation of split frequencies: 0.009450
445500 -- (-310.635) [-307.993] (-309.101) (-314.888) * [-307.864] (-315.021) (-309.969) (-312.022) -- 0:00:03
446000 -- (-310.765) (-308.282) (-310.092) [-307.354] * (-309.468) (-313.297) (-309.584) [-308.034] -- 0:00:03
446500 -- (-308.919) (-314.827) (-311.726) [-309.660] * [-308.998] (-310.483) (-309.181) (-307.942) -- 0:00:03
447000 -- (-308.207) (-311.321) (-313.627) [-308.180] * (-308.595) (-310.544) (-308.245) [-307.037] -- 0:00:03
447500 -- (-308.979) (-309.530) (-311.433) [-307.623] * (-311.855) [-307.898] (-307.583) (-309.493) -- 0:00:03
448000 -- (-311.872) (-307.780) [-308.200] (-313.434) * (-312.487) [-309.732] (-307.711) (-311.673) -- 0:00:03
448500 -- (-310.216) (-308.336) (-310.287) [-309.288] * [-308.054] (-310.287) (-308.150) (-307.976) -- 0:00:03
449000 -- (-311.698) (-307.714) [-307.458] (-308.810) * [-308.846] (-312.619) (-307.024) (-309.938) -- 0:00:03
449500 -- (-308.618) [-308.530] (-309.505) (-310.045) * (-309.137) [-309.432] (-308.727) (-314.028) -- 0:00:03
450000 -- (-310.782) (-307.982) (-308.290) [-308.461] * [-308.309] (-307.102) (-308.071) (-307.846) -- 0:00:03
Average standard deviation of split frequencies: 0.008564
450500 -- [-308.931] (-309.278) (-308.159) (-308.222) * (-314.014) (-315.228) (-311.019) [-312.712] -- 0:00:02
451000 -- (-310.458) (-309.663) [-308.650] (-307.996) * [-311.380] (-314.317) (-307.888) (-307.841) -- 0:00:02
451500 -- (-308.968) (-309.218) (-309.155) [-309.404] * [-310.824] (-311.733) (-310.198) (-309.977) -- 0:00:02
452000 -- (-308.215) [-307.988] (-306.938) (-310.461) * [-311.586] (-312.782) (-310.887) (-310.493) -- 0:00:02
452500 -- [-307.381] (-311.500) (-307.318) (-308.203) * (-309.233) (-309.949) (-312.318) [-308.256] -- 0:00:02
453000 -- (-308.477) (-309.460) [-312.089] (-311.988) * (-308.251) (-307.968) (-311.096) [-307.761] -- 0:00:02
453500 -- (-309.550) [-307.941] (-308.035) (-309.049) * [-308.314] (-308.238) (-308.354) (-312.431) -- 0:00:02
454000 -- (-309.944) [-308.342] (-307.184) (-307.353) * (-308.219) (-311.547) (-308.336) [-312.776] -- 0:00:02
454500 -- (-308.928) (-308.724) (-308.153) [-308.843] * (-308.193) (-310.274) [-309.301] (-309.555) -- 0:00:02
455000 -- [-309.126] (-308.534) (-309.320) (-308.163) * (-309.439) (-309.952) (-314.455) [-311.589] -- 0:00:02
Average standard deviation of split frequencies: 0.008339
455500 -- (-309.238) (-307.791) (-308.485) [-308.859] * (-308.123) (-307.721) (-307.766) [-310.663] -- 0:00:02
456000 -- (-309.081) (-313.437) [-309.219] (-310.313) * (-310.408) (-308.246) [-308.333] (-308.951) -- 0:00:02
456500 -- (-312.222) (-310.553) (-308.465) [-307.849] * (-308.734) [-309.939] (-309.579) (-308.706) -- 0:00:02
457000 -- (-310.622) [-311.542] (-310.356) (-307.769) * (-310.961) [-309.335] (-309.863) (-310.177) -- 0:00:02
457500 -- (-310.357) (-308.726) (-309.282) [-308.238] * (-308.290) (-309.855) (-307.896) [-310.491] -- 0:00:02
458000 -- [-308.714] (-308.025) (-310.121) (-310.514) * (-308.029) (-310.999) [-308.444] (-310.270) -- 0:00:02
458500 -- [-311.720] (-310.800) (-310.072) (-308.614) * (-307.946) [-308.372] (-309.905) (-308.174) -- 0:00:02
459000 -- (-311.973) (-313.267) [-314.377] (-309.104) * (-310.052) (-310.307) (-308.924) [-311.877] -- 0:00:02
459500 -- (-314.848) (-308.376) [-309.894] (-308.432) * (-308.584) (-310.323) [-308.458] (-308.238) -- 0:00:02
460000 -- (-311.527) [-310.010] (-307.022) (-314.372) * [-307.092] (-310.029) (-308.200) (-311.089) -- 0:00:02
Average standard deviation of split frequencies: 0.008323
460500 -- (-310.381) (-308.085) [-308.730] (-308.273) * [-309.321] (-311.624) (-312.694) (-309.558) -- 0:00:02
461000 -- (-307.949) (-311.377) [-309.355] (-308.444) * (-309.515) (-315.041) [-308.086] (-310.823) -- 0:00:02
461500 -- (-310.875) [-310.239] (-310.292) (-311.509) * (-311.798) [-310.138] (-309.411) (-307.700) -- 0:00:02
462000 -- [-311.911] (-311.872) (-312.994) (-308.968) * (-310.430) (-308.093) [-307.290] (-308.550) -- 0:00:02
462500 -- (-307.608) [-307.151] (-307.534) (-312.122) * (-309.873) (-308.802) (-310.407) [-308.078] -- 0:00:02
463000 -- (-308.898) [-307.180] (-307.769) (-309.428) * [-309.435] (-306.805) (-310.540) (-307.262) -- 0:00:02
463500 -- (-308.811) (-308.345) [-307.365] (-310.623) * (-312.426) (-309.948) [-307.356] (-307.341) -- 0:00:02
464000 -- [-309.885] (-307.751) (-307.974) (-308.248) * (-308.345) [-308.259] (-309.997) (-307.264) -- 0:00:02
464500 -- (-311.102) [-307.689] (-307.383) (-310.880) * (-309.632) [-307.921] (-312.468) (-311.622) -- 0:00:02
465000 -- (-308.435) (-308.610) [-309.552] (-309.243) * (-308.579) [-307.076] (-312.541) (-308.710) -- 0:00:02
Average standard deviation of split frequencies: 0.008363
465500 -- [-308.364] (-308.459) (-312.738) (-311.281) * (-313.356) (-307.672) [-309.621] (-310.419) -- 0:00:02
466000 -- (-307.130) (-308.159) [-306.960] (-313.984) * (-307.712) (-312.188) (-307.591) [-308.999] -- 0:00:02
466500 -- (-307.457) [-309.265] (-307.855) (-312.403) * (-311.795) [-309.829] (-320.154) (-308.697) -- 0:00:02
467000 -- (-307.908) (-311.146) [-309.579] (-308.408) * (-310.172) [-307.496] (-310.633) (-310.934) -- 0:00:01
467500 -- (-309.385) (-311.962) (-309.033) [-308.605] * (-309.158) [-309.947] (-313.755) (-311.277) -- 0:00:01
468000 -- (-311.484) (-308.764) [-310.283] (-308.335) * (-307.871) (-319.601) [-312.229] (-307.881) -- 0:00:01
468500 -- (-308.738) [-309.521] (-310.498) (-314.024) * [-308.917] (-310.872) (-308.053) (-311.956) -- 0:00:01
469000 -- (-306.961) (-308.755) (-310.858) [-311.338] * (-312.388) (-309.303) [-307.632] (-309.409) -- 0:00:01
469500 -- (-309.922) (-308.339) (-307.620) [-310.444] * (-308.352) [-309.599] (-308.992) (-308.206) -- 0:00:01
470000 -- [-311.127] (-314.885) (-308.211) (-310.711) * (-309.785) (-307.398) [-308.491] (-308.587) -- 0:00:01
Average standard deviation of split frequencies: 0.008280
470500 -- [-313.802] (-307.637) (-307.782) (-310.805) * (-313.277) (-311.714) [-308.891] (-308.490) -- 0:00:01
471000 -- (-313.331) [-307.080] (-310.566) (-307.954) * (-311.941) [-311.525] (-308.829) (-308.486) -- 0:00:01
471500 -- (-308.734) [-308.421] (-311.208) (-310.190) * (-307.709) (-310.181) (-307.606) [-307.247] -- 0:00:01
472000 -- (-307.924) (-308.858) [-308.085] (-310.753) * (-308.763) [-307.669] (-308.467) (-309.026) -- 0:00:01
472500 -- (-310.970) (-314.662) (-308.704) [-310.494] * (-310.487) (-309.187) (-310.618) [-307.595] -- 0:00:01
473000 -- [-308.962] (-315.706) (-311.277) (-316.145) * (-309.344) (-308.541) [-308.208] (-309.728) -- 0:00:01
473500 -- (-312.070) (-308.577) [-308.008] (-311.944) * (-308.132) (-308.687) (-307.375) [-307.969] -- 0:00:01
474000 -- (-311.341) (-312.799) [-308.501] (-311.931) * (-308.514) (-309.076) [-308.143] (-308.568) -- 0:00:01
474500 -- (-310.554) [-308.262] (-309.965) (-309.546) * [-308.449] (-307.928) (-308.319) (-308.382) -- 0:00:01
475000 -- (-309.732) [-309.833] (-308.042) (-307.545) * [-310.246] (-307.447) (-308.260) (-310.730) -- 0:00:01
Average standard deviation of split frequencies: 0.008451
475500 -- [-307.705] (-309.335) (-309.468) (-313.299) * [-308.708] (-313.581) (-308.626) (-308.852) -- 0:00:01
476000 -- (-308.367) (-308.001) (-311.984) [-308.097] * (-307.576) [-312.650] (-307.687) (-309.974) -- 0:00:01
476500 -- [-310.333] (-308.918) (-314.329) (-311.035) * (-310.401) [-310.832] (-308.828) (-310.947) -- 0:00:01
477000 -- [-308.124] (-309.244) (-312.832) (-308.487) * (-312.413) [-308.773] (-308.995) (-312.237) -- 0:00:01
477500 -- (-307.496) [-308.418] (-308.059) (-311.464) * (-324.201) (-308.364) [-308.722] (-309.582) -- 0:00:01
478000 -- (-310.477) [-307.939] (-310.549) (-308.314) * (-309.724) [-308.898] (-308.691) (-308.767) -- 0:00:01
478500 -- (-310.390) (-310.357) (-312.803) [-307.306] * (-308.454) (-308.242) (-307.896) [-310.604] -- 0:00:01
479000 -- [-308.223] (-309.345) (-315.501) (-307.452) * (-311.083) (-308.805) [-308.081] (-312.521) -- 0:00:01
479500 -- (-309.591) [-307.849] (-312.926) (-311.087) * (-310.489) (-309.598) [-307.571] (-310.886) -- 0:00:01
480000 -- (-308.631) [-308.503] (-317.188) (-309.742) * [-308.645] (-310.206) (-308.374) (-310.278) -- 0:00:01
Average standard deviation of split frequencies: 0.009284
480500 -- (-309.654) (-308.711) [-314.860] (-314.073) * (-307.659) [-311.304] (-306.971) (-307.921) -- 0:00:01
481000 -- (-307.110) (-307.751) (-318.216) [-311.511] * (-307.458) (-311.024) [-307.463] (-307.815) -- 0:00:01
481500 -- (-312.135) [-310.675] (-307.949) (-311.808) * (-307.688) [-310.871] (-308.704) (-308.236) -- 0:00:01
482000 -- (-307.248) [-311.508] (-312.202) (-313.687) * (-309.267) (-308.631) (-308.992) [-308.367] -- 0:00:01
482500 -- (-307.869) (-307.674) [-311.162] (-308.623) * (-309.138) [-308.463] (-308.235) (-310.370) -- 0:00:01
483000 -- (-308.365) [-308.071] (-309.090) (-309.329) * (-310.011) (-306.882) [-307.825] (-309.161) -- 0:00:01
483500 -- (-309.933) [-308.789] (-307.461) (-310.159) * (-307.037) [-309.587] (-310.045) (-310.349) -- 0:00:00
484000 -- (-309.303) (-312.165) (-307.286) [-309.771] * [-308.465] (-307.408) (-310.048) (-307.405) -- 0:00:00
484500 -- (-307.634) (-309.744) [-310.977] (-308.969) * (-309.185) (-309.088) (-310.523) [-311.643] -- 0:00:00
485000 -- (-309.441) [-312.276] (-312.084) (-309.224) * (-308.839) [-308.537] (-310.793) (-307.800) -- 0:00:00
Average standard deviation of split frequencies: 0.009118
485500 -- (-309.987) (-315.833) (-309.585) [-309.491] * (-313.410) (-307.366) (-309.009) [-310.409] -- 0:00:00
486000 -- (-307.395) (-312.159) (-309.165) [-312.167] * (-309.344) [-307.231] (-308.316) (-309.062) -- 0:00:00
486500 -- (-314.518) [-307.542] (-308.705) (-313.080) * [-308.511] (-307.692) (-308.033) (-308.544) -- 0:00:00
487000 -- [-309.354] (-310.317) (-310.918) (-313.649) * [-309.682] (-311.431) (-307.035) (-308.158) -- 0:00:00
487500 -- (-308.838) (-307.540) [-307.495] (-313.732) * (-314.612) (-309.950) [-308.803] (-309.623) -- 0:00:00
488000 -- [-308.665] (-307.929) (-308.486) (-308.173) * (-310.957) (-309.840) [-306.943] (-308.168) -- 0:00:00
488500 -- (-311.049) [-309.627] (-311.093) (-309.823) * [-306.708] (-307.189) (-307.143) (-310.564) -- 0:00:00
489000 -- (-309.184) [-311.335] (-308.534) (-308.591) * (-308.524) [-310.187] (-311.464) (-309.263) -- 0:00:00
489500 -- (-310.875) (-313.177) [-309.049] (-314.722) * (-312.031) (-310.123) [-309.229] (-310.018) -- 0:00:00
490000 -- (-309.432) (-307.265) (-311.401) [-313.490] * (-309.813) (-312.230) [-308.307] (-310.365) -- 0:00:00
Average standard deviation of split frequencies: 0.008967
490500 -- (-308.356) [-308.478] (-309.353) (-308.402) * (-308.413) (-309.762) (-308.667) [-308.833] -- 0:00:00
491000 -- (-311.081) (-307.905) [-309.326] (-310.711) * (-313.231) [-310.805] (-311.661) (-309.184) -- 0:00:00
491500 -- (-311.748) (-311.738) (-309.728) [-310.740] * (-310.722) (-310.013) (-312.439) [-308.516] -- 0:00:00
492000 -- (-310.873) (-307.602) (-312.440) [-307.339] * [-307.667] (-309.489) (-311.513) (-308.541) -- 0:00:00
492500 -- (-309.888) (-309.886) [-308.677] (-308.872) * (-308.242) (-307.974) (-310.414) [-307.701] -- 0:00:00
493000 -- (-309.833) (-313.251) [-309.329] (-309.646) * (-309.104) (-308.847) (-309.685) [-309.134] -- 0:00:00
493500 -- (-309.375) [-307.690] (-308.264) (-309.766) * [-308.613] (-310.914) (-308.891) (-307.114) -- 0:00:00
494000 -- (-308.960) (-307.529) [-312.592] (-309.828) * (-309.493) (-311.086) (-310.757) [-308.277] -- 0:00:00
494500 -- [-309.379] (-307.377) (-306.865) (-310.185) * (-308.112) [-313.109] (-311.220) (-311.714) -- 0:00:00
495000 -- (-312.527) [-311.424] (-308.663) (-307.378) * [-308.602] (-310.850) (-312.033) (-307.869) -- 0:00:00
Average standard deviation of split frequencies: 0.008554
495500 -- (-311.006) (-312.696) [-309.874] (-308.635) * (-310.670) (-311.615) [-308.092] (-313.657) -- 0:00:00
496000 -- (-315.640) (-309.961) [-308.486] (-310.916) * (-308.159) [-311.330] (-312.911) (-310.206) -- 0:00:00
496500 -- (-309.966) (-308.183) (-307.239) [-309.687] * (-308.416) (-307.925) [-309.574] (-310.552) -- 0:00:00
497000 -- (-311.254) (-310.466) (-309.400) [-310.593] * [-308.171] (-309.451) (-312.248) (-311.191) -- 0:00:00
497500 -- (-309.708) [-308.071] (-309.905) (-310.991) * (-307.218) (-308.773) [-308.160] (-309.825) -- 0:00:00
498000 -- (-311.167) [-311.407] (-309.909) (-313.484) * (-309.857) (-308.867) [-307.684] (-307.265) -- 0:00:00
498500 -- (-311.795) (-309.313) (-308.572) [-312.514] * (-310.700) (-307.582) [-308.770] (-307.885) -- 0:00:00
499000 -- [-308.124] (-308.661) (-309.724) (-311.465) * (-309.800) [-307.732] (-312.166) (-310.152) -- 0:00:00
499500 -- [-308.605] (-310.952) (-313.102) (-312.369) * [-307.977] (-307.694) (-311.846) (-309.072) -- 0:00:00
500000 -- (-307.693) (-312.918) [-311.792] (-309.123) * (-309.113) [-309.942] (-314.184) (-310.171) -- 0:00:00
Average standard deviation of split frequencies: 0.008223
Analysis completed in 30 seconds
Analysis used 28.69 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -306.67
Likelihood of best state for "cold" chain of run 2 was -306.67
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
78.2 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
50.1 % ( 44 %) Dirichlet(Pi{all})
52.5 % ( 49 %) Slider(Pi{all})
88.9 % ( 84 %) Multiplier(Alpha{1,2})
87.6 % ( 77 %) Multiplier(Alpha{3})
28.2 % ( 32 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
30.8 % ( 26 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
35.4 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
79.1 % ( 78 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
50.4 % ( 43 %) Dirichlet(Pi{all})
52.1 % ( 48 %) Slider(Pi{all})
88.6 % ( 84 %) Multiplier(Alpha{1,2})
87.9 % ( 84 %) Multiplier(Alpha{3})
27.6 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 62 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
30.7 % ( 26 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
35.3 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83008 0.82 0.66
3 | 83602 83057 0.83
4 | 83849 83186 83298
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.65 0.50
2 | 82845 0.82 0.67
3 | 83320 83765 0.84
4 | 83120 83670 83280
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -308.26
| 1 1 |
| 22 2 1 1 2 2 |
| 1 2 2 1 1 1 2 |
|2 1 1 12 2 2 1 2 2 1 |
| 1 2 2 1 2 11 2 2 1 1 1 2 |
| 11 1 *121 1 1 1 2|
| 1 1 12 2 12 |
|1 2 1 22 11 2 11 22 2 2 |
| 2 22 1 21 2 1 2 2 1 2 2 1 |
| 21 1 1 2 2 2 * 1 2 1 |
| 2 1 2 2 2 2 |
| 2 2 1 1 2 |
| |
| 1 1 2 1 |
| 2 1 21 1 1|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -310.21
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -308.38 -311.15
2 -308.40 -312.58
--------------------------------------
TOTAL -308.39 -312.10
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885931 0.090625 0.380769 1.508894 0.850759 702.69 726.85 1.000
r(A<->C){all} 0.166357 0.020241 0.000521 0.442132 0.127278 63.85 110.62 1.004
r(A<->G){all} 0.155798 0.016190 0.000006 0.399550 0.122229 52.93 106.05 1.008
r(A<->T){all} 0.166821 0.019351 0.000401 0.462733 0.130261 116.00 119.93 1.015
r(C<->G){all} 0.166465 0.019220 0.000141 0.437338 0.133497 105.46 144.44 1.003
r(C<->T){all} 0.195185 0.021309 0.000047 0.488666 0.166595 59.46 94.28 1.001
r(G<->T){all} 0.149374 0.016711 0.000120 0.411998 0.113781 87.88 105.01 1.000
pi(A){all} 0.230133 0.000764 0.178248 0.284969 0.228372 528.48 559.75 1.000
pi(C){all} 0.274402 0.000866 0.216810 0.329046 0.273752 498.70 571.10 1.000
pi(G){all} 0.274359 0.000887 0.216742 0.329853 0.273962 543.25 587.65 1.002
pi(T){all} 0.221106 0.000798 0.168479 0.279196 0.220694 673.97 712.48 1.000
alpha{1,2} 0.398940 0.207939 0.000409 1.363686 0.235392 487.34 526.48 1.001
alpha{3} 0.463759 0.241861 0.000113 1.470444 0.289739 553.80 594.88 0.999
pinvar{all} 0.992392 0.000096 0.975042 0.999986 0.995602 596.81 673.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**.**
8 -- ..*..*
9 -- .***.*
10 -- ...*.*
11 -- .**...
12 -- .*.*..
13 -- .*..*.
14 -- .****.
15 -- .*.***
16 -- ....**
17 -- .*...*
18 -- ..*.*.
19 -- ...**.
20 -- ..**..
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 231 0.153795 0.012240 0.145140 0.162450 2
8 231 0.153795 0.017890 0.141145 0.166445 2
9 228 0.151798 0.024480 0.134487 0.169108 2
10 226 0.150466 0.000000 0.150466 0.150466 2
11 225 0.149800 0.004708 0.146471 0.153129 2
12 222 0.147803 0.003766 0.145140 0.150466 2
13 221 0.147137 0.004708 0.143808 0.150466 2
14 220 0.146471 0.024480 0.129161 0.163782 2
15 218 0.145140 0.000000 0.145140 0.145140 2
16 204 0.135819 0.001883 0.134487 0.137150 2
17 203 0.135153 0.002825 0.133156 0.137150 2
18 199 0.132490 0.012240 0.123835 0.141145 2
19 199 0.132490 0.012240 0.123835 0.141145 2
20 197 0.131158 0.000942 0.130493 0.131824 2
21 193 0.128495 0.000942 0.127830 0.129161 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096504 0.009582 0.000003 0.288190 0.067663 0.999 2
length{all}[2] 0.098977 0.009262 0.000043 0.289067 0.070299 0.999 2
length{all}[3] 0.101430 0.009810 0.000043 0.301523 0.072557 0.999 2
length{all}[4] 0.098273 0.008971 0.000038 0.284403 0.071032 1.000 2
length{all}[5] 0.096741 0.009808 0.000071 0.289497 0.066609 1.001 2
length{all}[6] 0.099098 0.009883 0.000031 0.293607 0.067638 0.999 2
length{all}[7] 0.099079 0.009963 0.000759 0.281938 0.066514 0.999 2
length{all}[8] 0.090899 0.006871 0.000211 0.234420 0.070240 0.996 2
length{all}[9] 0.106433 0.009638 0.001224 0.307927 0.083730 1.002 2
length{all}[10] 0.098661 0.011508 0.000161 0.312230 0.063169 0.999 2
length{all}[11] 0.101086 0.009842 0.000789 0.282974 0.075188 0.997 2
length{all}[12] 0.090231 0.007385 0.000398 0.237703 0.066198 0.999 2
length{all}[13] 0.095028 0.007979 0.000018 0.277253 0.067429 1.000 2
length{all}[14] 0.106644 0.011000 0.000628 0.288682 0.074297 1.005 2
length{all}[15] 0.102568 0.009461 0.000057 0.287829 0.071506 0.995 2
length{all}[16] 0.094283 0.009354 0.001259 0.259542 0.072682 0.999 2
length{all}[17] 0.102773 0.013291 0.000289 0.366103 0.064320 1.009 2
length{all}[18] 0.094691 0.009449 0.000055 0.298844 0.065880 0.995 2
length{all}[19] 0.107405 0.009190 0.000652 0.304111 0.078489 0.996 2
length{all}[20] 0.100655 0.011562 0.000622 0.312000 0.066042 0.999 2
length{all}[21] 0.097955 0.009721 0.000083 0.284032 0.065819 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008223
Maximum standard deviation of split frequencies = 0.024480
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 43 trees
90 % credible set contains 89 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 222
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 39 patterns at 74 / 74 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 39 patterns at 74 / 74 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
38064 bytes for conP
3432 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048422 0.058736 0.036405 0.081563 0.077860 0.044769 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -318.433491
Iterating by ming2
Initial: fx= 318.433491
x= 0.04842 0.05874 0.03641 0.08156 0.07786 0.04477 0.30000 1.30000
1 h-m-p 0.0000 0.0005 177.7238 +++ 302.596967 m 0.0005 14 | 1/8
2 h-m-p 0.0041 0.0862 19.6943 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 163.1958 ++ 299.531818 m 0.0001 46 | 2/8
4 h-m-p 0.0160 8.0000 16.4182 -------------.. | 2/8
5 h-m-p 0.0000 0.0001 146.0731 ++ 298.459181 m 0.0001 79 | 3/8
6 h-m-p 0.0160 8.0000 13.6085 -------------.. | 3/8
7 h-m-p 0.0000 0.0001 126.4463 ++ 296.183811 m 0.0001 112 | 4/8
8 h-m-p 0.0160 8.0000 10.6492 -------------.. | 4/8
9 h-m-p 0.0000 0.0003 103.3055 +++ 293.355385 m 0.0003 146 | 5/8
10 h-m-p 0.0160 8.0000 7.3852 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 73.2803 ++ 293.080036 m 0.0001 179 | 6/8
12 h-m-p 0.4442 8.0000 0.0000 C 293.080036 0 0.1111 190 | 6/8
13 h-m-p 0.3347 8.0000 0.0000 Y 293.080036 0 0.0312 203
Out..
lnL = -293.080036
204 lfun, 204 eigenQcodon, 1224 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.083386 0.093550 0.037441 0.012842 0.029613 0.090482 0.299997 0.580539 0.501921
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.952891
np = 9
lnL0 = -318.206864
Iterating by ming2
Initial: fx= 318.206864
x= 0.08339 0.09355 0.03744 0.01284 0.02961 0.09048 0.30000 0.58054 0.50192
1 h-m-p 0.0000 0.0002 174.4661 +++ 312.746526 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0011 85.2934 ++ 306.609461 m 0.0011 27 | 2/9
3 h-m-p 0.0000 0.0001 174.8456 ++ 304.634339 m 0.0001 39 | 3/9
4 h-m-p 0.0001 0.0008 317.8133 ++ 294.413243 m 0.0008 51 | 4/9
5 h-m-p 0.0000 0.0002 289.9783 ++ 293.307650 m 0.0002 63 | 5/9
6 h-m-p 0.0045 0.0588 15.6605 ------------.. | 5/9
7 h-m-p 0.0000 0.0000 74.0014 ++ 293.080056 m 0.0000 97 | 6/9
8 h-m-p 0.0719 8.0000 0.0000 ++++ 293.080056 m 8.0000 111 | 6/9
9 h-m-p 0.0255 8.0000 0.0012 +++++ 293.080056 m 8.0000 129 | 6/9
10 h-m-p 0.0924 1.3193 0.1009 ---------Y 293.080056 0 0.0000 153 | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 293.080056 m 8.0000 171 | 6/9
12 h-m-p 0.0052 1.2758 0.1012 ---------N 293.080056 0 0.0000 195 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 293.080056 m 8.0000 213 | 6/9
14 h-m-p 0.0089 4.4361 0.2541 +++++ 293.080043 m 4.4361 231 | 6/9
15 h-m-p 0.1812 0.9060 1.4478 --------------Y 293.080043 0 0.0000 260 | 6/9
16 h-m-p 0.0001 0.0004 0.0000 ---------.. | 6/9
17 h-m-p 0.0160 8.0000 0.0000 +++++ 293.080043 m 8.0000 297 | 6/9
18 h-m-p 0.0010 0.4836 0.4512 +++++ 293.080038 m 0.4836 315 | 7/9
19 h-m-p 1.6000 8.0000 0.0051 ++ 293.080038 m 8.0000 330 | 7/9
20 h-m-p 0.0053 0.1239 7.6819 +++ 293.080038 m 0.1239 345 | 7/9
21 h-m-p -0.0000 -0.0000 3.3081
h-m-p: -2.85939012e-18 -1.42969506e-17 3.30814414e+00 293.080038
.. | 7/9
22 h-m-p 0.0160 8.0000 0.0000 -C 293.080038 0 0.0010 367 | 7/9
23 h-m-p 0.0850 8.0000 0.0000 -----------Y 293.080038 0 0.0000 392
Out..
lnL = -293.080038
393 lfun, 1179 eigenQcodon, 4716 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067628 0.034215 0.018170 0.035249 0.058770 0.031908 1.360159 1.641458 0.423140 0.467598 1.331192
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.809698
np = 11
lnL0 = -310.898447
Iterating by ming2
Initial: fx= 310.898447
x= 0.06763 0.03422 0.01817 0.03525 0.05877 0.03191 1.36016 1.64146 0.42314 0.46760 1.33119
1 h-m-p 0.0000 0.0003 174.7178 +++ 303.099880 m 0.0003 17 | 1/11
2 h-m-p 0.0007 0.0036 44.4470 ++ 297.997684 m 0.0036 31 | 2/11
3 h-m-p 0.0000 0.0000 11350.1821 ++ 297.341644 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 633.2216 ++ 297.084086 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0002 979.7392 ++ 293.728931 m 0.0002 73 | 5/11
6 h-m-p 0.0000 0.0002 456.3716 ++ 293.369865 m 0.0002 87 | 5/11
7 h-m-p 0.0053 0.0534 19.8930 ------------.. | 5/11
8 h-m-p 0.0000 0.0001 73.9810 ++ 293.080059 m 0.0001 125 | 6/11
9 h-m-p 0.0741 8.0000 0.0000 ++++ 293.080059 m 8.0000 141 | 6/11
10 h-m-p 0.0183 0.0917 0.0004 -----N 293.080059 0 0.0000 165
Out..
lnL = -293.080059
166 lfun, 664 eigenQcodon, 2988 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -293.084988 S = -293.079227 -0.002202
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:02
did 20 / 39 patterns 0:02
did 30 / 39 patterns 0:02
did 39 / 39 patterns 0:02
Time used: 0:02
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076651 0.043858 0.057095 0.105913 0.010093 0.061078 1.354277 0.815227 0.898582 0.650052 1.477452 2.589185
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 4.142382
np = 12
lnL0 = -318.069416
Iterating by ming2
Initial: fx= 318.069416
x= 0.07665 0.04386 0.05709 0.10591 0.01009 0.06108 1.35428 0.81523 0.89858 0.65005 1.47745 2.58919
1 h-m-p 0.0000 0.0001 166.7871 ++ 313.958839 m 0.0001 17 | 1/12
2 h-m-p 0.0006 0.0101 40.5061 +++ 301.180593 m 0.0101 33 | 2/12
3 h-m-p 0.0000 0.0002 510.9018 ++ 297.741256 m 0.0002 48 | 3/12
4 h-m-p 0.0003 0.0015 78.1147 ++ 296.709859 m 0.0015 63 | 4/12
5 h-m-p 0.0000 0.0001 2020.9219 ++ 295.299260 m 0.0001 78 | 5/12
6 h-m-p 0.0133 0.8670 4.4923 -------------.. | 5/12
7 h-m-p 0.0000 0.0001 101.2793 ++ 294.697739 m 0.0001 119 | 6/12
8 h-m-p 0.0160 8.0000 1.3927 -------------.. | 6/12
9 h-m-p 0.0000 0.0003 71.8670 +++ 293.080037 m 0.0003 161 | 7/12
10 h-m-p 0.2412 8.0000 0.0000 +++ 293.080037 m 8.0000 177 | 7/12
11 h-m-p 0.0160 8.0000 0.0210 +++++ 293.080035 m 8.0000 200 | 7/12
12 h-m-p 0.1139 8.0000 1.4755 ++++ 293.080010 m 8.0000 222 | 7/12
13 h-m-p 1.6000 8.0000 0.7795 ++ 293.080007 m 8.0000 237 | 7/12
14 h-m-p 0.5622 8.0000 11.0928 ++ 293.079997 m 8.0000 257 | 7/12
15 h-m-p 0.3758 1.8791 12.5645 ++ 293.079996 m 1.8791 272 | 7/12
16 h-m-p -0.0000 -0.0000 42.8712
h-m-p: -0.00000000e+00 -0.00000000e+00 4.28712204e+01 293.079996
.. | 7/12
17 h-m-p 0.0160 8.0000 0.0000 Y 293.079996 0 0.0365 299 | 7/12
18 h-m-p 0.2212 8.0000 0.0000 --------C 293.079996 0 0.0000 327
Out..
lnL = -293.079996
328 lfun, 1312 eigenQcodon, 5904 P(t)
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053625 0.077327 0.087328 0.045061 0.061344 0.104957 20.419430 0.740100 1.158545
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.305689
np = 9
lnL0 = -323.605033
Iterating by ming2
Initial: fx= 323.605033
x= 0.05363 0.07733 0.08733 0.04506 0.06134 0.10496 20.41943 0.74010 1.15854
1 h-m-p 0.0000 0.0007 166.9888 ++++ 304.946722 m 0.0007 16 | 1/9
2 h-m-p 0.0122 0.0986 8.1354 -------------.. | 1/9
3 h-m-p 0.0000 0.0001 160.2669 ++ 301.828214 m 0.0001 51 | 2/9
4 h-m-p 0.0050 0.4566 3.4279 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 144.2473 ++ 299.554924 m 0.0001 85 | 3/9
6 h-m-p 0.0049 0.5345 2.7808 ------------.. | 3/9
7 h-m-p 0.0000 0.0002 125.3933 +++ 295.967858 m 0.0002 120 | 4/9
8 h-m-p 0.0090 0.6348 2.5638 -------------.. | 4/9
9 h-m-p 0.0000 0.0001 103.4939 ++ 294.443877 m 0.0001 155 | 5/9
10 h-m-p 0.0042 0.7954 2.4513 ------------.. | 5/9
11 h-m-p 0.0000 0.0003 73.3972 +++ 293.080059 m 0.0003 190 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 293.080059 m 8.0000 202 | 6/9
13 h-m-p 0.1223 8.0000 0.0001 -----Y 293.080059 0 0.0000 222
Out..
lnL = -293.080059
223 lfun, 2453 eigenQcodon, 13380 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.061727 0.025242 0.049169 0.081156 0.101539 0.084111 20.419432 0.900000 0.247434 1.205925 1.300105
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.491139
np = 11
lnL0 = -320.868445
Iterating by ming2
Initial: fx= 320.868445
x= 0.06173 0.02524 0.04917 0.08116 0.10154 0.08411 20.41943 0.90000 0.24743 1.20592 1.30010
1 h-m-p 0.0000 0.0004 157.9462 +++ 311.146680 m 0.0004 17 | 1/11
2 h-m-p 0.0003 0.0016 82.1355 ++ 302.706412 m 0.0016 31 | 2/11
3 h-m-p 0.0000 0.0001 1057.2063 ++ 298.984143 m 0.0001 45 | 3/11
4 h-m-p 0.0021 0.0105 27.1461 ++ 296.281111 m 0.0105 59 | 4/11
5 h-m-p 0.0000 0.0001 775.1111 ++ 295.764491 m 0.0001 73 | 5/11
6 h-m-p 0.0000 0.0000 17566.4686 ++ 295.547126 m 0.0000 87 | 6/11
7 h-m-p 0.0015 0.0168 39.2448 -----------.. | 6/11
8 h-m-p 0.0000 0.0005 71.1492 +++ 293.080037 m 0.0005 125 | 7/11
9 h-m-p 0.3658 8.0000 0.0000 +++ 293.080037 m 8.0000 140 | 7/11
10 h-m-p 0.0006 0.2841 1.5973 +++++ 293.080024 m 0.2841 161 | 8/11
11 h-m-p 0.1886 1.1922 0.3774 --------------Y 293.080024 0 0.0000 189 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 ---Y 293.080024 0 0.0000 209
Out..
lnL = -293.080024
210 lfun, 2520 eigenQcodon, 13860 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -293.081625 S = -293.078777 -0.001247
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:11
did 20 / 39 patterns 0:11
did 30 / 39 patterns 0:11
did 39 / 39 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=74
NC_011896_1_WP_010908738_1_2295_MLBR_RS10875 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
NC_002677_1_NP_302418_1_1290_ML2155 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP
**************************************************
NC_011896_1_WP_010908738_1_2295_MLBR_RS10875 FGDLVFPVPADDLPYVHPVTVVNR
NC_002677_1_NP_302418_1_1290_ML2155 FGDLVFPVPADDLPYVHPVTVVNR
NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395 FGDLVFPVPADDLPYVHPVTVVNR
NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815 FGDLVFPVPADDLPYVHPVTVVNR
NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780 FGDLVFPVPADDLPYVHPVTVVNR
NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105 FGDLVFPVPADDLPYVHPVTVVNR
************************
>NC_011896_1_WP_010908738_1_2295_MLBR_RS10875 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA CCCGGTTACTGTTGTTAACCGG >NC_002677_1_NP_302418_1_1290_ML2155 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA CCCGGTTACTGTTGTTAACCGG >NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA CCCGGTTACTGTTGTTAACCGG >NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA CCCGGTTACTGTTGTTAACCGG >NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA CCCGGTTACTGTTGTTAACCGG >NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105 ATGAAATCTGTAAACTACTATGTCGTGGCTGACATTGCTAAGAGCAAGGC GCATAAAAGCAGATACGTAGACAACGGCTGGCCGACGACTGATCCAGACC ACCACGCTGTAAGCGAATTGGTGACCGATTGCGCCGGTGCGTTATCGCCA TTCGGCGACCTGGTGTTTCCGGTGCCCGCTGACGACCTGCCCTACGTGCA CCCGGTTACTGTTGTTAACCGG
>NC_011896_1_WP_010908738_1_2295_MLBR_RS10875 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP FGDLVFPVPADDLPYVHPVTVVNR >NC_002677_1_NP_302418_1_1290_ML2155 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP FGDLVFPVPADDLPYVHPVTVVNR >NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP FGDLVFPVPADDLPYVHPVTVVNR >NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP FGDLVFPVPADDLPYVHPVTVVNR >NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP FGDLVFPVPADDLPYVHPVTVVNR >NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105 MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSP FGDLVFPVPADDLPYVHPVTVVNR
#NEXUS
[ID: 5089128628]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908738_1_2295_MLBR_RS10875
NC_002677_1_NP_302418_1_1290_ML2155
NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395
NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815
NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780
NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908738_1_2295_MLBR_RS10875,
2 NC_002677_1_NP_302418_1_1290_ML2155,
3 NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395,
4 NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815,
5 NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780,
6 NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06766318,2:0.07029942,3:0.07255651,4:0.07103153,5:0.0666094,6:0.06763785);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06766318,2:0.07029942,3:0.07255651,4:0.07103153,5:0.0666094,6:0.06763785);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -308.38 -311.15
2 -308.40 -312.58
--------------------------------------
TOTAL -308.39 -312.10
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.885931 0.090625 0.380769 1.508894 0.850759 702.69 726.85 1.000
r(A<->C){all} 0.166357 0.020241 0.000521 0.442132 0.127278 63.85 110.62 1.004
r(A<->G){all} 0.155798 0.016190 0.000006 0.399550 0.122229 52.93 106.05 1.008
r(A<->T){all} 0.166821 0.019351 0.000401 0.462733 0.130261 116.00 119.93 1.015
r(C<->G){all} 0.166465 0.019220 0.000141 0.437338 0.133497 105.46 144.44 1.003
r(C<->T){all} 0.195185 0.021309 0.000047 0.488666 0.166595 59.46 94.28 1.001
r(G<->T){all} 0.149374 0.016711 0.000120 0.411998 0.113781 87.88 105.01 1.000
pi(A){all} 0.230133 0.000764 0.178248 0.284969 0.228372 528.48 559.75 1.000
pi(C){all} 0.274402 0.000866 0.216810 0.329046 0.273752 498.70 571.10 1.000
pi(G){all} 0.274359 0.000887 0.216742 0.329853 0.273962 543.25 587.65 1.002
pi(T){all} 0.221106 0.000798 0.168479 0.279196 0.220694 673.97 712.48 1.000
alpha{1,2} 0.398940 0.207939 0.000409 1.363686 0.235392 487.34 526.48 1.001
alpha{3} 0.463759 0.241861 0.000113 1.470444 0.289739 553.80 594.88 0.999
pinvar{all} 0.992392 0.000096 0.975042 0.999986 0.995602 596.81 673.91 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2155/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 74
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 2 2 2 2 2 2 | CAC 3 3 3 3 3 3 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 3 3 3 3 3 3 | CAG 0 0 0 0 0 0 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 0 0 0 0 0 0 | ACC 1 1 1 1 1 1 | AAC 3 3 3 3 3 3 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 4 4 4 4 4 4 | Asp GAT 2 2 2 2 2 2 | Gly GGT 1 1 1 1 1 1
GTC 1 1 1 1 1 1 | GCC 1 1 1 1 1 1 | GAC 6 6 6 6 6 6 | GGC 2 2 2 2 2 2
GTA 3 3 3 3 3 3 | GCA 0 0 0 0 0 0 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 5 5 5 5 5 5 | GCG 2 2 2 2 2 2 | GAG 0 0 0 0 0 0 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908738_1_2295_MLBR_RS10875
position 1: T:0.16216 C:0.18919 A:0.22973 G:0.41892
position 2: T:0.27027 C:0.27027 A:0.32432 G:0.13514
position 3: T:0.22973 C:0.36486 A:0.13514 G:0.27027
Average T:0.22072 C:0.27477 A:0.22973 G:0.27477
#2: NC_002677_1_NP_302418_1_1290_ML2155
position 1: T:0.16216 C:0.18919 A:0.22973 G:0.41892
position 2: T:0.27027 C:0.27027 A:0.32432 G:0.13514
position 3: T:0.22973 C:0.36486 A:0.13514 G:0.27027
Average T:0.22072 C:0.27477 A:0.22973 G:0.27477
#3: NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395
position 1: T:0.16216 C:0.18919 A:0.22973 G:0.41892
position 2: T:0.27027 C:0.27027 A:0.32432 G:0.13514
position 3: T:0.22973 C:0.36486 A:0.13514 G:0.27027
Average T:0.22072 C:0.27477 A:0.22973 G:0.27477
#4: NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815
position 1: T:0.16216 C:0.18919 A:0.22973 G:0.41892
position 2: T:0.27027 C:0.27027 A:0.32432 G:0.13514
position 3: T:0.22973 C:0.36486 A:0.13514 G:0.27027
Average T:0.22072 C:0.27477 A:0.22973 G:0.27477
#5: NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780
position 1: T:0.16216 C:0.18919 A:0.22973 G:0.41892
position 2: T:0.27027 C:0.27027 A:0.32432 G:0.13514
position 3: T:0.22973 C:0.36486 A:0.13514 G:0.27027
Average T:0.22072 C:0.27477 A:0.22973 G:0.27477
#6: NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105
position 1: T:0.16216 C:0.18919 A:0.22973 G:0.41892
position 2: T:0.27027 C:0.27027 A:0.32432 G:0.13514
position 3: T:0.22973 C:0.36486 A:0.13514 G:0.27027
Average T:0.22072 C:0.27477 A:0.22973 G:0.27477
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 6 | TCC 0 | TAC 18 | TGC 6
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 0
CTC 0 | CCC 12 | CAC 18 | CGC 0
CTA 0 | CCA 12 | Gln Q CAA 0 | CGA 0
CTG 12 | CCG 18 | CAG 0 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 0
ATC 0 | ACC 6 | AAC 18 | AGC 18
ATA 0 | ACA 0 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 6 | ACG 6 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 24 | Asp D GAT 12 | Gly G GGT 6
GTC 6 | GCC 6 | GAC 36 | GGC 12
GTA 18 | GCA 0 | Glu E GAA 6 | GGA 0
GTG 30 | GCG 12 | GAG 0 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16216 C:0.18919 A:0.22973 G:0.41892
position 2: T:0.27027 C:0.27027 A:0.32432 G:0.13514
position 3: T:0.22973 C:0.36486 A:0.13514 G:0.27027
Average T:0.22072 C:0.27477 A:0.22973 G:0.27477
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -293.080036 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299997 1.300105
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908738_1_2295_MLBR_RS10875: 0.000004, NC_002677_1_NP_302418_1_1290_ML2155: 0.000004, NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395: 0.000004, NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815: 0.000004, NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780: 0.000004, NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30000
omega (dN/dS) = 1.30010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 175.6 46.4 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 175.6 46.4 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 175.6 46.4 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 175.6 46.4 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 175.6 46.4 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 175.6 46.4 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -293.080038 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.360159 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908738_1_2295_MLBR_RS10875: 0.000004, NC_002677_1_NP_302418_1_1290_ML2155: 0.000004, NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395: 0.000004, NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815: 0.000004, NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780: 0.000004, NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.36016
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 166.5 55.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 166.5 55.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 166.5 55.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 166.5 55.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 166.5 55.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 166.5 55.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -293.080059 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.354277 0.665111 0.201727 0.000018 1.514178
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908738_1_2295_MLBR_RS10875: 0.000004, NC_002677_1_NP_302418_1_1290_ML2155: 0.000004, NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395: 0.000004, NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815: 0.000004, NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780: 0.000004, NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.35428
MLEs of dN/dS (w) for site classes (K=3)
p: 0.66511 0.20173 0.13316
w: 0.00002 1.00000 1.51418
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 166.5 55.5 0.4034 0.0000 0.0000 0.0 0.0
7..2 0.000 166.5 55.5 0.4034 0.0000 0.0000 0.0 0.0
7..3 0.000 166.5 55.5 0.4034 0.0000 0.0000 0.0 0.0
7..4 0.000 166.5 55.5 0.4034 0.0000 0.0000 0.0 0.0
7..5 0.000 166.5 55.5 0.4034 0.0000 0.0000 0.0 0.0
7..6 0.000 166.5 55.5 0.4034 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908738_1_2295_MLBR_RS10875)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908738_1_2295_MLBR_RS10875)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -293.079996 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 20.419430 0.000000 0.000000 0.000001 18.995415 68.640862
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908738_1_2295_MLBR_RS10875: 0.000004, NC_002677_1_NP_302418_1_1290_ML2155: 0.000004, NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395: 0.000004, NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815: 0.000004, NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780: 0.000004, NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 20.41943
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 18.99542 68.64086
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 150.0 72.0 68.6409 0.0000 0.0000 0.0 0.0
7..2 0.000 150.0 72.0 68.6409 0.0000 0.0000 0.0 0.0
7..3 0.000 150.0 72.0 68.6409 0.0000 0.0000 0.0 0.0
7..4 0.000 150.0 72.0 68.6409 0.0000 0.0000 0.0 0.0
7..5 0.000 150.0 72.0 68.6409 0.0000 0.0000 0.0 0.0
7..6 0.000 150.0 72.0 68.6409 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908738_1_2295_MLBR_RS10875)
Pr(w>1) post mean +- SE for w
1 M 1.000** 68.641
2 K 1.000** 68.641
3 S 1.000** 68.641
4 V 1.000** 68.641
5 N 1.000** 68.641
6 Y 1.000** 68.641
7 Y 1.000** 68.641
8 V 1.000** 68.641
9 V 1.000** 68.641
10 A 1.000** 68.641
11 D 1.000** 68.641
12 I 1.000** 68.641
13 A 1.000** 68.641
14 K 1.000** 68.641
15 S 1.000** 68.641
16 K 1.000** 68.641
17 A 1.000** 68.641
18 H 1.000** 68.641
19 K 1.000** 68.641
20 S 1.000** 68.641
21 R 1.000** 68.641
22 Y 1.000** 68.641
23 V 1.000** 68.641
24 D 1.000** 68.641
25 N 1.000** 68.641
26 G 1.000** 68.641
27 W 1.000** 68.641
28 P 1.000** 68.641
29 T 1.000** 68.641
30 T 1.000** 68.641
31 D 1.000** 68.641
32 P 1.000** 68.641
33 D 1.000** 68.641
34 H 1.000** 68.641
35 H 1.000** 68.641
36 A 1.000** 68.641
37 V 1.000** 68.641
38 S 1.000** 68.641
39 E 1.000** 68.641
40 L 1.000** 68.641
41 V 1.000** 68.641
42 T 1.000** 68.641
43 D 1.000** 68.641
44 C 1.000** 68.641
45 A 1.000** 68.641
46 G 1.000** 68.641
47 A 1.000** 68.641
48 L 1.000** 68.641
49 S 1.000** 68.641
50 P 1.000** 68.641
51 F 1.000** 68.641
52 G 1.000** 68.641
53 D 1.000** 68.641
54 L 1.000** 68.641
55 V 1.000** 68.641
56 F 1.000** 68.641
57 P 1.000** 68.641
58 V 1.000** 68.641
59 P 1.000** 68.641
60 A 1.000** 68.641
61 D 1.000** 68.641
62 D 1.000** 68.641
63 L 1.000** 68.641
64 P 1.000** 68.641
65 Y 1.000** 68.641
66 V 1.000** 68.641
67 H 1.000** 68.641
68 P 1.000** 68.641
69 V 1.000** 68.641
70 T 1.000** 68.641
71 V 1.000** 68.641
72 V 1.000** 68.641
73 N 1.000** 68.641
74 R 1.000** 68.641
Note: more than one w>1. Check rst for details
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -293.080059 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 20.419432 0.739891 1.158370
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908738_1_2295_MLBR_RS10875: 0.000004, NC_002677_1_NP_302418_1_1290_ML2155: 0.000004, NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395: 0.000004, NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815: 0.000004, NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780: 0.000004, NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 20.41943
Parameters in M7 (beta):
p = 0.73989 q = 1.15837
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.01486 0.06591 0.13231 0.21016 0.29797 0.39526 0.50218 0.61968 0.75022 0.90120
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 150.0 72.0 0.3890 0.0000 0.0000 0.0 0.0
7..2 0.000 150.0 72.0 0.3890 0.0000 0.0000 0.0 0.0
7..3 0.000 150.0 72.0 0.3890 0.0000 0.0000 0.0 0.0
7..4 0.000 150.0 72.0 0.3890 0.0000 0.0000 0.0 0.0
7..5 0.000 150.0 72.0 0.3890 0.0000 0.0000 0.0 0.0
7..6 0.000 150.0 72.0 0.3890 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -293.080024 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 20.418362 0.000010 0.005000 1.223752 1.449877
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908738_1_2295_MLBR_RS10875: 0.000004, NC_002677_1_NP_302418_1_1290_ML2155: 0.000004, NZ_LVXE01000011_1_WP_010908738_1_368_A3216_RS05395: 0.000004, NZ_LYPH01000017_1_WP_010908738_1_598_A8144_RS02815: 0.000004, NZ_CP029543_1_WP_010908738_1_2316_DIJ64_RS11780: 0.000004, NZ_AP014567_1_WP_010908738_1_2381_JK2ML_RS12105: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 20.41836
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.22375
(p1 = 0.99999) w = 1.44988
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 1.44988
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 150.0 72.0 1.4499 0.0000 0.0000 0.0 0.0
7..2 0.000 150.0 72.0 1.4499 0.0000 0.0000 0.0 0.0
7..3 0.000 150.0 72.0 1.4499 0.0000 0.0000 0.0 0.0
7..4 0.000 150.0 72.0 1.4499 0.0000 0.0000 0.0 0.0
7..5 0.000 150.0 72.0 1.4499 0.0000 0.0000 0.0 0.0
7..6 0.000 150.0 72.0 1.4499 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908738_1_2295_MLBR_RS10875)
Pr(w>1) post mean +- SE for w
1 M 1.000** 1.450
2 K 1.000** 1.450
3 S 1.000** 1.450
4 V 1.000** 1.450
5 N 1.000** 1.450
6 Y 1.000** 1.450
7 Y 1.000** 1.450
8 V 1.000** 1.450
9 V 1.000** 1.450
10 A 1.000** 1.450
11 D 1.000** 1.450
12 I 1.000** 1.450
13 A 1.000** 1.450
14 K 1.000** 1.450
15 S 1.000** 1.450
16 K 1.000** 1.450
17 A 1.000** 1.450
18 H 1.000** 1.450
19 K 1.000** 1.450
20 S 1.000** 1.450
21 R 1.000** 1.450
22 Y 1.000** 1.450
23 V 1.000** 1.450
24 D 1.000** 1.450
25 N 1.000** 1.450
26 G 1.000** 1.450
27 W 1.000** 1.450
28 P 1.000** 1.450
29 T 1.000** 1.450
30 T 1.000** 1.450
31 D 1.000** 1.450
32 P 1.000** 1.450
33 D 1.000** 1.450
34 H 1.000** 1.450
35 H 1.000** 1.450
36 A 1.000** 1.450
37 V 1.000** 1.450
38 S 1.000** 1.450
39 E 1.000** 1.450
40 L 1.000** 1.450
41 V 1.000** 1.450
42 T 1.000** 1.450
43 D 1.000** 1.450
44 C 1.000** 1.450
45 A 1.000** 1.450
46 G 1.000** 1.450
47 A 1.000** 1.450
48 L 1.000** 1.450
49 S 1.000** 1.450
50 P 1.000** 1.450
51 F 1.000** 1.450
52 G 1.000** 1.450
53 D 1.000** 1.450
54 L 1.000** 1.450
55 V 1.000** 1.450
56 F 1.000** 1.450
57 P 1.000** 1.450
58 V 1.000** 1.450
59 P 1.000** 1.450
60 A 1.000** 1.450
61 D 1.000** 1.450
62 D 1.000** 1.450
63 L 1.000** 1.450
64 P 1.000** 1.450
65 Y 1.000** 1.450
66 V 1.000** 1.450
67 H 1.000** 1.450
68 P 1.000** 1.450
69 V 1.000** 1.450
70 T 1.000** 1.450
71 V 1.000** 1.450
72 V 1.000** 1.450
73 N 1.000** 1.450
74 R 1.000** 1.450
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908738_1_2295_MLBR_RS10875)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:11
Model 1: NearlyNeutral -293.080038 Model 2: PositiveSelection -293.080059 Model 0: one-ratio -293.080036 Model 3: discrete -293.079996 Model 7: beta -293.080059 Model 8: beta&w>1 -293.080024 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 4.200000000764703E-5 Model 8 vs 7 7.000000005064066E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
