--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:20:22 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2330/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -475.80 -479.78
2 -475.77 -478.79
--------------------------------------
TOTAL -475.78 -479.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896916 0.087322 0.370933 1.457565 0.875507 751.00 751.00 0.999
r(A<->C){all} 0.183677 0.022151 0.000114 0.482824 0.147896 40.95 79.30 1.002
r(A<->G){all} 0.159398 0.017169 0.000048 0.422441 0.121792 83.75 90.27 1.007
r(A<->T){all} 0.159292 0.019978 0.000180 0.446940 0.117717 132.31 136.26 1.025
r(C<->G){all} 0.166973 0.019992 0.000001 0.451292 0.127337 33.20 37.18 1.005
r(C<->T){all} 0.160702 0.017660 0.000022 0.430492 0.128308 61.49 68.66 1.000
r(G<->T){all} 0.169958 0.020326 0.000141 0.456089 0.135783 76.64 86.79 1.000
pi(A){all} 0.221681 0.000490 0.179711 0.265898 0.220640 581.15 606.85 0.999
pi(C){all} 0.277890 0.000584 0.235069 0.329259 0.277744 647.27 683.39 0.999
pi(G){all} 0.320766 0.000621 0.269885 0.368745 0.321101 440.38 532.53 0.999
pi(T){all} 0.179663 0.000430 0.138360 0.218627 0.178983 555.25 568.80 0.999
alpha{1,2} 0.395459 0.201685 0.000254 1.294811 0.232791 455.43 480.82 0.999
alpha{3} 0.467129 0.259371 0.000282 1.521322 0.298061 542.84 580.32 1.001
pinvar{all} 0.995169 0.000034 0.983668 0.999998 0.997124 517.94 586.76 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -452.8941
Model 2: PositiveSelection -452.894102
Model 0: one-ratio -452.894102
Model 3: discrete -452.893985
Model 7: beta -452.893985
Model 8: beta&w>1 -452.894113
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 3.999999989900971E-6
Model 8 vs 7 2.5600000003578316E-4
>C1
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
>C2
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
>C3
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
>C4
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
>C5
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
>C6
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=116
C1 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
C2 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
C3 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
C4 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
C5 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
C6 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
**************************************************
C1 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
C2 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
C3 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
C4 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
C5 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
C6 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
**************************************************
C1 RPTAPPPTPPTYMAGT
C2 RPTAPPPTPPTYMAGT
C3 RPTAPPPTPPTYMAGT
C4 RPTAPPPTPPTYMAGT
C5 RPTAPPPTPPTYMAGT
C6 RPTAPPPTPPTYMAGT
****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 116 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 116 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3480]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3480]--->[3480]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.458 Mb, Max= 30.643 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
C2 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
C3 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
C4 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
C5 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
C6 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
**************************************************
C1 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
C2 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
C3 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
C4 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
C5 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
C6 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
**************************************************
C1 RPTAPPPTPPTYMAGT
C2 RPTAPPPTPPTYMAGT
C3 RPTAPPPTPPTYMAGT
C4 RPTAPPPTPPTYMAGT
C5 RPTAPPPTPPTYMAGT
C6 RPTAPPPTPPTYMAGT
****************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
C2 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
C3 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
C4 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
C5 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
C6 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
**************************************************
C1 GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
C2 GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
C3 GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
C4 GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
C5 GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
C6 GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
**************************************************
C1 ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
C2 ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
C3 ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
C4 ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
C5 ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
C6 ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
**************************************************
C1 GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
C2 GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
C3 GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
C4 GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
C5 GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
C6 GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
**************************************************
C1 TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
C2 TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
C3 TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
C4 TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
C5 TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
C6 TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
**************************************************
C1 AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
C2 AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
C3 AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
C4 AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
C5 AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
C6 AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
**************************************************
C1 CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
C2 CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
C3 CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
C4 CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
C5 CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
C6 CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
************************************************
>C1
ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
>C2
ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
>C3
ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
>C4
ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
>C5
ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
>C6
ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT
GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC
ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA
GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT
TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC
AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG
CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
>C1
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
>C2
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
>C3
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
>C4
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
>C5
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
>C6
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
RPTAPPPTPPTYMAGT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 348 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857569
Setting output file names to "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1437909047
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5244580233
Seed = 2092463664
Swapseed = 1579857569
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -778.840684 -- -24.965149
Chain 2 -- -778.840684 -- -24.965149
Chain 3 -- -778.840565 -- -24.965149
Chain 4 -- -778.840565 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -778.840639 -- -24.965149
Chain 2 -- -778.840639 -- -24.965149
Chain 3 -- -778.840639 -- -24.965149
Chain 4 -- -778.840684 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-778.841] (-778.841) (-778.841) (-778.841) * [-778.841] (-778.841) (-778.841) (-778.841)
500 -- [-483.707] (-484.337) (-492.754) (-490.102) * (-488.430) (-488.006) [-494.773] (-491.278) -- 0:00:00
1000 -- [-481.757] (-487.447) (-484.572) (-496.029) * (-483.361) (-489.080) [-480.589] (-489.019) -- 0:00:00
1500 -- (-486.073) [-485.756] (-485.739) (-487.952) * (-489.321) (-483.523) (-484.486) [-488.458] -- 0:00:00
2000 -- [-485.030] (-487.864) (-488.304) (-485.324) * [-481.474] (-489.760) (-489.625) (-481.345) -- 0:00:00
2500 -- (-492.469) (-483.852) [-480.298] (-484.203) * (-479.154) [-485.175] (-481.025) (-486.001) -- 0:00:00
3000 -- [-484.554] (-491.988) (-480.370) (-491.326) * (-494.122) (-481.281) (-485.428) [-484.946] -- 0:00:00
3500 -- (-490.344) (-485.757) [-493.683] (-488.012) * (-484.582) (-486.207) (-481.845) [-483.312] -- 0:00:00
4000 -- (-485.598) [-482.999] (-492.575) (-482.192) * [-480.694] (-485.954) (-488.343) (-496.461) -- 0:00:00
4500 -- (-482.389) (-490.447) (-481.379) [-483.670] * (-484.505) (-482.688) [-477.051] (-485.870) -- 0:00:00
5000 -- (-489.687) (-483.747) [-481.507] (-492.082) * [-484.020] (-485.963) (-491.642) (-487.067) -- 0:00:00
Average standard deviation of split frequencies: 0.071425
5500 -- (-483.492) [-490.839] (-485.155) (-486.552) * (-480.832) [-489.320] (-484.472) (-487.932) -- 0:00:00
6000 -- (-485.766) [-483.922] (-482.000) (-483.261) * (-484.197) (-483.914) [-482.627] (-489.832) -- 0:00:00
6500 -- (-489.026) [-484.072] (-492.985) (-494.859) * (-489.174) (-482.839) [-486.765] (-482.595) -- 0:00:00
7000 -- (-490.427) [-480.243] (-488.315) (-482.453) * (-483.851) [-486.637] (-489.499) (-488.458) -- 0:00:00
7500 -- [-489.557] (-486.163) (-488.224) (-483.102) * (-487.130) (-491.356) (-485.137) [-482.851] -- 0:00:00
8000 -- (-488.723) (-486.327) [-488.702] (-476.751) * (-479.925) (-483.989) [-485.343] (-488.892) -- 0:00:00
8500 -- (-490.567) (-485.918) (-488.371) [-479.109] * (-484.849) (-489.493) [-483.006] (-482.762) -- 0:00:00
9000 -- (-487.364) (-483.196) [-484.880] (-477.348) * (-483.260) (-482.334) [-483.333] (-483.868) -- 0:00:00
9500 -- (-481.157) (-489.850) (-483.142) [-477.992] * (-483.512) [-480.035] (-482.616) (-487.886) -- 0:00:00
10000 -- (-482.928) (-482.983) [-476.717] (-475.038) * [-487.215] (-491.730) (-488.515) (-491.781) -- 0:00:00
Average standard deviation of split frequencies: 0.079970
10500 -- [-484.901] (-486.770) (-475.741) (-475.959) * [-481.345] (-485.646) (-485.432) (-485.461) -- 0:00:46
11000 -- (-484.608) (-493.684) [-476.453] (-477.369) * (-484.340) (-480.791) (-482.204) [-483.215] -- 0:00:44
11500 -- (-494.833) (-492.978) (-479.572) [-476.305] * (-482.089) (-486.950) (-483.403) [-484.975] -- 0:00:42
12000 -- (-486.535) [-481.519] (-475.519) (-477.692) * [-479.253] (-489.746) (-490.301) (-483.474) -- 0:00:40
12500 -- [-488.124] (-493.690) (-475.641) (-475.461) * (-486.304) (-491.448) (-490.653) [-479.841] -- 0:00:39
13000 -- [-487.305] (-498.200) (-476.266) (-477.881) * (-482.856) (-484.264) [-486.869] (-479.183) -- 0:00:37
13500 -- (-479.112) (-483.628) [-475.065] (-479.106) * [-484.668] (-497.204) (-484.056) (-487.009) -- 0:00:36
14000 -- (-480.948) (-477.414) (-479.497) [-475.657] * (-491.676) (-499.118) [-487.667] (-485.766) -- 0:00:34
14500 -- (-485.746) (-477.468) [-476.861] (-478.357) * [-488.392] (-489.681) (-483.072) (-491.483) -- 0:00:33
15000 -- (-486.054) (-476.586) [-478.440] (-476.752) * (-485.674) (-482.386) [-487.651] (-486.081) -- 0:00:32
Average standard deviation of split frequencies: 0.051172
15500 -- (-490.001) [-476.811] (-479.751) (-478.009) * [-485.346] (-488.276) (-487.971) (-483.863) -- 0:00:31
16000 -- [-484.523] (-475.273) (-479.150) (-476.943) * (-480.080) (-490.665) (-488.020) [-485.329] -- 0:00:30
16500 -- [-484.362] (-475.919) (-476.855) (-475.806) * (-480.099) [-487.251] (-483.515) (-492.004) -- 0:00:29
17000 -- (-484.303) (-476.929) [-478.454] (-478.375) * (-488.219) (-483.925) [-482.765] (-480.795) -- 0:00:28
17500 -- (-485.374) [-476.377] (-476.243) (-481.232) * (-484.990) [-486.177] (-487.920) (-486.566) -- 0:00:27
18000 -- (-485.363) (-477.839) [-475.564] (-476.406) * (-482.428) (-480.634) (-486.752) [-481.991] -- 0:00:26
18500 -- (-500.926) (-476.941) [-477.068] (-477.807) * [-484.481] (-485.142) (-481.446) (-491.086) -- 0:00:26
19000 -- (-489.833) (-480.331) [-478.113] (-475.612) * (-479.399) [-483.447] (-484.146) (-484.586) -- 0:00:25
19500 -- (-488.208) [-479.605] (-477.947) (-481.516) * (-483.298) (-481.761) (-487.442) [-475.835] -- 0:00:24
20000 -- [-481.707] (-479.543) (-478.017) (-476.646) * (-484.090) [-486.324] (-484.866) (-474.803) -- 0:00:24
Average standard deviation of split frequencies: 0.070964
20500 -- [-482.698] (-475.359) (-479.506) (-476.324) * (-489.573) (-481.987) [-477.949] (-476.607) -- 0:00:23
21000 -- (-489.444) (-478.555) [-476.522] (-477.283) * (-485.324) (-486.533) (-484.353) [-477.079] -- 0:00:22
21500 -- (-503.446) [-481.194] (-476.593) (-479.413) * (-488.320) [-480.986] (-491.473) (-475.886) -- 0:00:22
22000 -- (-496.753) (-475.597) [-475.050] (-482.933) * (-483.740) (-486.631) (-485.568) [-475.669] -- 0:00:21
22500 -- (-482.989) (-475.929) [-475.286] (-478.180) * (-486.832) [-486.352] (-489.627) (-478.416) -- 0:00:21
23000 -- [-475.337] (-475.996) (-476.147) (-475.007) * [-486.783] (-489.094) (-494.014) (-478.831) -- 0:00:20
23500 -- (-476.590) (-475.314) [-476.447] (-477.460) * (-489.753) (-489.553) (-493.820) [-476.405] -- 0:00:20
24000 -- (-477.248) [-475.904] (-475.993) (-477.275) * (-485.769) (-475.926) (-497.119) [-475.228] -- 0:00:19
24500 -- (-481.988) [-475.296] (-476.374) (-476.945) * (-483.873) (-477.256) (-493.141) [-476.727] -- 0:00:19
25000 -- (-478.100) (-477.767) (-476.338) [-476.459] * [-486.132] (-476.584) (-487.502) (-477.520) -- 0:00:19
Average standard deviation of split frequencies: 0.040795
25500 -- (-477.091) [-476.226] (-477.363) (-477.400) * (-486.311) (-479.008) [-486.538] (-478.271) -- 0:00:18
26000 -- (-475.243) (-476.442) [-475.644] (-474.636) * (-487.719) (-478.367) [-475.273] (-475.509) -- 0:00:18
26500 -- (-477.173) [-476.458] (-475.250) (-476.989) * [-487.003] (-476.619) (-477.332) (-474.986) -- 0:00:17
27000 -- (-476.444) [-474.196] (-474.645) (-475.516) * (-483.879) (-477.047) (-478.360) [-475.139] -- 0:00:17
27500 -- (-478.064) (-477.262) (-475.515) [-477.290] * (-482.647) [-475.798] (-474.988) (-480.492) -- 0:00:34
28000 -- (-478.279) [-476.749] (-481.192) (-479.557) * [-486.402] (-475.459) (-475.009) (-477.754) -- 0:00:33
28500 -- (-475.816) (-475.705) (-477.981) [-476.362] * (-487.704) [-475.634] (-476.374) (-474.727) -- 0:00:33
29000 -- (-477.011) (-479.974) (-475.993) [-477.367] * (-486.340) (-477.817) (-477.848) [-476.007] -- 0:00:32
29500 -- (-476.035) (-477.320) (-475.371) [-477.737] * (-484.349) (-475.247) [-477.609] (-476.829) -- 0:00:31
30000 -- (-475.415) (-475.715) (-476.867) [-475.225] * (-485.781) [-474.616] (-478.338) (-476.662) -- 0:00:31
Average standard deviation of split frequencies: 0.045307
30500 -- [-476.959] (-475.905) (-477.094) (-474.764) * (-482.519) (-478.525) [-476.368] (-475.807) -- 0:00:30
31000 -- (-481.396) [-475.314] (-476.024) (-475.105) * (-489.357) (-475.786) (-480.340) [-476.760] -- 0:00:30
31500 -- (-476.294) [-476.168] (-477.192) (-476.115) * [-485.356] (-475.822) (-478.684) (-478.423) -- 0:00:29
32000 -- (-477.917) (-475.271) [-474.562] (-480.325) * (-488.049) (-479.143) (-482.945) [-476.741] -- 0:00:29
32500 -- [-478.067] (-478.142) (-479.813) (-474.918) * (-483.670) (-476.564) (-475.262) [-474.932] -- 0:00:28
33000 -- [-475.991] (-482.664) (-475.229) (-476.442) * (-489.686) (-475.547) [-476.978] (-476.299) -- 0:00:28
33500 -- (-480.772) (-479.942) [-475.592] (-475.597) * [-487.738] (-477.924) (-476.334) (-474.999) -- 0:00:27
34000 -- (-477.687) (-478.045) [-481.667] (-475.669) * (-488.046) (-477.855) [-476.802] (-475.832) -- 0:00:27
34500 -- (-477.163) (-477.845) (-476.331) [-477.487] * (-485.272) [-477.913] (-475.960) (-477.550) -- 0:00:26
35000 -- (-478.328) [-475.147] (-479.084) (-479.706) * [-484.476] (-475.918) (-482.894) (-474.887) -- 0:00:26
Average standard deviation of split frequencies: 0.041351
35500 -- (-478.693) [-479.477] (-475.890) (-475.693) * (-481.095) (-479.882) [-475.030] (-478.130) -- 0:00:26
36000 -- (-478.692) [-479.113] (-475.676) (-475.757) * [-485.514] (-480.617) (-475.430) (-477.295) -- 0:00:25
36500 -- (-477.366) [-479.254] (-476.063) (-479.051) * [-488.567] (-479.994) (-480.692) (-479.363) -- 0:00:25
37000 -- [-475.143] (-479.397) (-476.495) (-476.255) * (-486.445) (-475.875) [-479.115] (-476.453) -- 0:00:25
37500 -- [-474.348] (-477.318) (-477.176) (-476.054) * (-486.127) [-474.808] (-476.311) (-477.631) -- 0:00:24
38000 -- (-478.910) (-477.452) [-477.823] (-478.128) * (-489.839) [-475.066] (-475.065) (-475.685) -- 0:00:24
38500 -- [-475.381] (-475.952) (-475.497) (-475.857) * (-487.200) (-477.375) (-475.484) [-478.726] -- 0:00:23
39000 -- (-475.144) (-476.866) [-476.033] (-482.011) * (-487.040) (-478.417) [-479.062] (-477.182) -- 0:00:23
39500 -- (-476.389) [-475.095] (-479.739) (-476.537) * (-482.918) [-481.502] (-475.723) (-475.210) -- 0:00:23
40000 -- (-476.027) (-476.341) (-475.990) [-477.666] * [-482.816] (-475.036) (-475.907) (-483.454) -- 0:00:23
Average standard deviation of split frequencies: 0.032568
40500 -- (-478.534) [-476.395] (-474.380) (-480.573) * (-491.567) [-474.881] (-477.231) (-475.758) -- 0:00:22
41000 -- (-480.591) (-477.012) [-474.689] (-479.232) * [-486.315] (-476.485) (-474.347) (-475.339) -- 0:00:22
41500 -- (-480.256) (-475.472) (-476.162) [-475.655] * (-491.670) (-474.814) [-474.885] (-476.057) -- 0:00:22
42000 -- (-476.031) [-478.948] (-475.055) (-476.110) * (-485.544) [-474.844] (-475.702) (-475.521) -- 0:00:21
42500 -- [-475.245] (-478.648) (-474.719) (-479.935) * (-482.429) (-476.566) [-481.030] (-476.916) -- 0:00:21
43000 -- (-475.487) [-475.532] (-474.903) (-475.658) * (-500.309) (-475.636) (-475.857) [-475.448] -- 0:00:21
43500 -- (-477.475) [-474.267] (-475.009) (-476.163) * (-477.294) [-475.828] (-475.446) (-475.626) -- 0:00:20
44000 -- (-475.252) [-477.306] (-477.853) (-474.967) * (-480.463) (-477.939) [-477.018] (-477.164) -- 0:00:20
44500 -- (-476.793) [-476.157] (-476.895) (-477.005) * [-475.761] (-474.765) (-479.848) (-481.333) -- 0:00:30
45000 -- (-474.146) (-477.498) (-475.043) [-477.005] * (-475.305) (-474.695) [-477.034] (-475.255) -- 0:00:30
Average standard deviation of split frequencies: 0.029719
45500 -- [-477.832] (-476.929) (-474.819) (-477.911) * (-475.766) [-476.705] (-478.187) (-477.969) -- 0:00:29
46000 -- (-477.858) [-474.354] (-475.858) (-477.855) * (-476.267) (-476.642) (-478.161) [-474.224] -- 0:00:29
46500 -- (-480.588) [-475.729] (-476.641) (-474.221) * (-475.512) [-475.144] (-479.630) (-477.238) -- 0:00:29
47000 -- (-476.885) (-474.922) (-480.427) [-477.027] * (-476.356) (-475.792) (-478.015) [-476.253] -- 0:00:28
47500 -- (-478.900) (-480.280) (-474.521) [-475.856] * (-476.167) (-475.907) (-479.029) [-480.764] -- 0:00:28
48000 -- (-478.045) (-475.063) (-475.373) [-476.172] * (-476.622) (-476.724) [-475.261] (-476.113) -- 0:00:28
48500 -- [-475.256] (-478.372) (-478.093) (-479.172) * (-477.935) (-479.024) (-477.086) [-476.775] -- 0:00:27
49000 -- (-477.651) (-477.132) (-476.905) [-478.163] * (-475.572) (-479.669) [-477.475] (-474.387) -- 0:00:27
49500 -- [-477.383] (-474.727) (-480.022) (-480.337) * [-477.795] (-476.153) (-476.316) (-475.955) -- 0:00:27
50000 -- [-475.931] (-474.426) (-475.686) (-476.280) * (-478.613) (-477.934) [-474.858] (-474.695) -- 0:00:27
Average standard deviation of split frequencies: 0.031457
50500 -- (-479.140) (-475.410) (-477.921) [-476.316] * (-476.431) (-474.417) [-474.820] (-475.984) -- 0:00:26
51000 -- [-480.806] (-475.674) (-477.498) (-478.741) * (-478.731) (-474.375) [-478.427] (-478.322) -- 0:00:26
51500 -- (-479.712) (-476.520) (-475.299) [-478.422] * (-478.365) [-475.218] (-477.268) (-478.953) -- 0:00:26
52000 -- (-484.601) (-478.362) [-478.774] (-476.380) * (-478.054) (-478.015) (-474.664) [-475.822] -- 0:00:25
52500 -- [-483.057] (-475.846) (-474.300) (-476.717) * [-474.925] (-480.371) (-477.734) (-477.742) -- 0:00:25
53000 -- [-476.905] (-477.771) (-474.751) (-474.288) * (-474.650) (-475.409) [-475.748] (-478.597) -- 0:00:25
53500 -- (-474.812) (-476.825) [-476.940] (-474.531) * [-474.739] (-477.276) (-480.281) (-476.154) -- 0:00:25
54000 -- (-474.602) (-477.566) [-477.758] (-478.017) * (-475.298) (-477.330) [-476.201] (-479.343) -- 0:00:24
54500 -- (-475.883) (-474.834) (-476.097) [-476.647] * (-474.844) (-477.110) (-478.445) [-478.776] -- 0:00:24
55000 -- (-476.245) (-475.743) [-475.795] (-475.791) * (-477.874) [-478.626] (-476.896) (-476.093) -- 0:00:24
Average standard deviation of split frequencies: 0.032830
55500 -- [-475.939] (-475.414) (-480.345) (-478.795) * (-474.451) [-477.441] (-478.971) (-477.801) -- 0:00:24
56000 -- (-475.914) (-475.145) [-475.069] (-475.608) * (-474.779) [-474.883] (-478.629) (-476.048) -- 0:00:23
56500 -- (-477.588) (-474.854) [-476.076] (-475.517) * (-476.373) (-475.806) (-477.849) [-476.826] -- 0:00:23
57000 -- (-478.305) (-475.509) (-480.896) [-478.563] * [-474.871] (-475.357) (-474.874) (-475.365) -- 0:00:23
57500 -- (-480.110) (-476.151) [-478.809] (-477.206) * (-474.334) (-474.858) (-477.578) [-476.285] -- 0:00:23
58000 -- (-477.893) (-476.217) (-477.705) [-478.335] * (-475.126) (-476.976) [-475.896] (-476.923) -- 0:00:22
58500 -- [-475.287] (-477.159) (-475.531) (-476.821) * (-475.196) (-477.779) [-477.702] (-476.861) -- 0:00:22
59000 -- (-474.665) (-476.610) (-475.337) [-477.503] * (-476.747) (-479.993) [-475.383] (-481.991) -- 0:00:22
59500 -- [-477.265] (-477.773) (-476.497) (-478.960) * [-479.883] (-477.886) (-479.778) (-478.193) -- 0:00:22
60000 -- [-476.358] (-477.232) (-478.822) (-476.747) * [-477.190] (-478.697) (-477.226) (-480.312) -- 0:00:22
Average standard deviation of split frequencies: 0.030673
60500 -- [-476.235] (-479.054) (-480.963) (-478.718) * (-479.877) (-475.035) [-478.028] (-477.742) -- 0:00:21
61000 -- [-475.510] (-481.203) (-474.507) (-474.794) * [-476.292] (-476.852) (-476.389) (-475.674) -- 0:00:21
61500 -- [-477.032] (-478.302) (-475.270) (-476.804) * [-476.144] (-478.164) (-476.564) (-477.950) -- 0:00:28
62000 -- (-476.858) (-476.475) [-475.053] (-478.880) * (-476.300) (-477.489) [-479.146] (-476.527) -- 0:00:28
62500 -- [-476.857] (-478.216) (-478.637) (-482.523) * (-478.024) (-474.404) (-475.881) [-475.903] -- 0:00:28
63000 -- (-476.249) (-482.717) (-480.617) [-477.890] * (-476.668) (-476.613) (-477.871) [-474.800] -- 0:00:27
63500 -- (-475.065) (-477.061) (-481.950) [-475.348] * (-477.968) [-478.256] (-475.517) (-477.840) -- 0:00:27
64000 -- [-475.247] (-474.934) (-475.541) (-476.814) * (-477.503) [-475.357] (-475.573) (-474.807) -- 0:00:27
64500 -- (-474.304) [-475.004] (-478.425) (-475.216) * (-476.681) (-475.451) (-476.292) [-474.922] -- 0:00:27
65000 -- [-474.782] (-476.689) (-474.285) (-476.114) * (-474.904) (-475.768) (-474.654) [-474.605] -- 0:00:26
Average standard deviation of split frequencies: 0.028946
65500 -- (-475.239) (-475.805) (-475.649) [-475.967] * (-475.002) (-476.414) (-475.938) [-476.985] -- 0:00:26
66000 -- (-475.009) (-476.753) [-477.025] (-480.188) * [-476.153] (-476.676) (-475.001) (-474.791) -- 0:00:26
66500 -- (-475.581) (-478.262) [-475.909] (-480.369) * [-475.373] (-475.156) (-476.050) (-476.445) -- 0:00:26
67000 -- (-476.458) (-476.958) [-476.236] (-478.758) * [-476.907] (-476.016) (-476.741) (-476.049) -- 0:00:25
67500 -- (-476.980) (-479.263) (-476.375) [-480.319] * (-479.336) (-479.543) [-477.019] (-477.570) -- 0:00:25
68000 -- [-476.328] (-475.039) (-474.410) (-480.570) * (-476.997) (-477.670) (-476.284) [-477.021] -- 0:00:25
68500 -- (-475.078) [-475.425] (-474.851) (-475.740) * (-476.365) (-476.320) (-480.120) [-474.972] -- 0:00:25
69000 -- (-483.121) [-475.632] (-475.575) (-476.355) * (-476.111) [-476.280] (-477.349) (-474.566) -- 0:00:24
69500 -- (-474.297) (-481.122) [-481.100] (-477.809) * (-475.554) (-484.585) (-475.839) [-475.595] -- 0:00:24
70000 -- (-477.548) (-475.640) [-476.042] (-479.159) * (-475.532) (-483.640) [-478.760] (-474.696) -- 0:00:24
Average standard deviation of split frequencies: 0.030896
70500 -- (-479.917) [-475.808] (-476.364) (-479.092) * (-476.422) (-480.859) (-477.579) [-475.442] -- 0:00:24
71000 -- (-477.621) (-476.313) [-475.088] (-475.660) * (-474.777) [-478.911] (-476.261) (-475.135) -- 0:00:24
71500 -- (-476.626) (-475.599) (-477.115) [-481.173] * [-475.243] (-475.584) (-475.269) (-474.445) -- 0:00:23
72000 -- [-477.204] (-476.703) (-480.135) (-477.341) * (-476.749) (-477.162) (-475.836) [-477.002] -- 0:00:23
72500 -- (-477.904) (-475.527) (-478.035) [-477.409] * (-475.850) [-475.045] (-476.011) (-474.780) -- 0:00:23
73000 -- (-477.128) [-475.115] (-475.769) (-478.147) * (-475.283) (-478.620) (-476.916) [-475.446] -- 0:00:23
73500 -- [-478.769] (-474.827) (-475.105) (-475.396) * (-476.092) [-474.420] (-476.109) (-475.565) -- 0:00:23
74000 -- (-477.117) (-481.164) (-477.052) [-476.556] * (-476.898) (-477.166) (-475.198) [-477.118] -- 0:00:23
74500 -- (-478.142) (-477.551) (-477.342) [-475.877] * [-475.733] (-477.879) (-475.675) (-475.465) -- 0:00:22
75000 -- (-474.632) [-474.910] (-476.119) (-479.764) * (-480.215) [-476.963] (-476.089) (-475.766) -- 0:00:22
Average standard deviation of split frequencies: 0.026051
75500 -- [-476.433] (-475.429) (-476.086) (-474.450) * (-477.063) (-478.004) [-477.199] (-476.017) -- 0:00:22
76000 -- (-477.370) (-475.602) [-481.809] (-477.526) * [-475.941] (-475.254) (-477.170) (-476.466) -- 0:00:22
76500 -- [-476.309] (-475.794) (-476.193) (-481.020) * [-477.040] (-475.885) (-475.530) (-478.348) -- 0:00:22
77000 -- (-476.690) (-476.550) (-475.649) [-477.108] * (-476.642) (-480.511) (-477.711) [-476.685] -- 0:00:21
77500 -- (-478.695) (-479.184) (-478.550) [-476.458] * (-476.057) [-476.977] (-476.231) (-475.934) -- 0:00:21
78000 -- (-475.965) (-475.219) [-478.500] (-476.014) * (-478.151) (-476.541) (-478.495) [-478.550] -- 0:00:21
78500 -- [-475.197] (-477.492) (-478.726) (-474.770) * [-476.002] (-475.756) (-477.584) (-474.523) -- 0:00:26
79000 -- (-475.823) (-479.877) [-475.247] (-475.720) * [-474.552] (-475.648) (-475.807) (-475.040) -- 0:00:26
79500 -- [-476.383] (-478.029) (-476.590) (-477.587) * (-477.168) (-481.290) (-476.193) [-474.739] -- 0:00:26
80000 -- [-475.364] (-483.053) (-475.813) (-475.167) * (-476.630) (-477.407) [-483.652] (-477.855) -- 0:00:26
Average standard deviation of split frequencies: 0.031492
80500 -- (-477.738) (-479.689) (-476.260) [-475.222] * (-477.580) (-475.583) [-477.766] (-477.032) -- 0:00:26
81000 -- (-481.041) (-476.639) [-476.161] (-476.587) * (-475.732) [-477.388] (-475.580) (-476.207) -- 0:00:25
81500 -- (-476.130) (-478.244) [-480.980] (-477.726) * [-474.914] (-480.058) (-474.473) (-475.445) -- 0:00:25
82000 -- (-475.648) (-476.303) (-479.588) [-475.903] * (-475.991) (-478.271) (-474.670) [-476.673] -- 0:00:25
82500 -- [-476.378] (-474.929) (-475.246) (-476.102) * [-479.365] (-478.521) (-476.842) (-476.239) -- 0:00:25
83000 -- (-477.315) (-474.964) [-475.990] (-476.949) * (-475.973) [-477.304] (-477.598) (-476.234) -- 0:00:25
83500 -- (-475.490) (-475.283) (-475.016) [-476.893] * (-475.483) (-477.846) [-475.181] (-476.367) -- 0:00:24
84000 -- (-474.864) (-475.378) [-474.681] (-479.063) * [-476.171] (-478.159) (-478.087) (-480.467) -- 0:00:24
84500 -- (-474.127) (-482.433) (-475.358) [-474.735] * [-478.121] (-474.602) (-482.270) (-474.430) -- 0:00:24
85000 -- (-476.871) (-474.712) (-477.746) [-476.094] * (-474.961) (-479.308) (-482.369) [-474.944] -- 0:00:24
Average standard deviation of split frequencies: 0.030292
85500 -- (-477.396) [-476.764] (-476.154) (-477.456) * [-475.682] (-482.492) (-478.703) (-482.828) -- 0:00:24
86000 -- (-474.062) (-480.360) (-477.053) [-474.516] * (-475.876) (-478.726) [-478.678] (-478.710) -- 0:00:24
86500 -- (-475.112) (-476.151) [-475.592] (-476.595) * (-478.635) [-474.953] (-479.976) (-480.281) -- 0:00:23
87000 -- (-478.399) [-475.998] (-475.334) (-476.274) * [-475.311] (-474.936) (-476.474) (-475.199) -- 0:00:23
87500 -- (-477.123) [-475.813] (-476.290) (-475.456) * (-480.391) [-474.802] (-475.685) (-475.323) -- 0:00:23
88000 -- (-475.815) (-476.915) (-477.469) [-475.088] * (-480.309) (-477.092) (-476.946) [-477.754] -- 0:00:23
88500 -- (-475.233) (-477.001) [-475.654] (-477.305) * [-477.464] (-477.362) (-476.193) (-475.342) -- 0:00:23
89000 -- (-477.157) [-479.384] (-478.184) (-479.742) * (-481.588) (-477.913) [-475.270] (-477.175) -- 0:00:23
89500 -- [-479.870] (-476.916) (-475.615) (-475.853) * (-479.104) (-475.892) (-475.969) [-474.919] -- 0:00:22
90000 -- (-477.747) (-475.657) [-474.666] (-475.235) * (-476.015) (-479.691) (-475.728) [-476.604] -- 0:00:22
Average standard deviation of split frequencies: 0.029554
90500 -- (-476.733) [-477.518] (-475.157) (-476.068) * [-479.962] (-477.377) (-481.336) (-474.989) -- 0:00:22
91000 -- (-477.455) (-476.294) [-476.037] (-475.277) * (-476.416) [-475.308] (-476.154) (-478.869) -- 0:00:22
91500 -- (-478.431) (-475.536) (-475.925) [-475.180] * (-477.283) (-475.814) [-478.847] (-477.605) -- 0:00:22
92000 -- (-477.293) (-481.505) [-480.524] (-476.312) * [-477.551] (-478.102) (-477.167) (-479.356) -- 0:00:22
92500 -- (-476.396) (-479.472) [-474.982] (-476.965) * (-475.190) [-477.064] (-475.362) (-478.999) -- 0:00:22
93000 -- (-477.660) (-478.264) (-474.842) [-476.936] * (-477.851) [-478.635] (-478.147) (-479.711) -- 0:00:21
93500 -- (-475.316) [-475.557] (-476.431) (-478.145) * (-475.186) [-476.088] (-483.128) (-482.609) -- 0:00:21
94000 -- [-475.454] (-477.379) (-476.249) (-479.466) * (-475.794) (-481.960) [-475.722] (-484.604) -- 0:00:21
94500 -- (-477.115) (-477.522) [-476.003] (-481.241) * [-477.331] (-478.344) (-476.083) (-479.813) -- 0:00:21
95000 -- (-483.462) (-475.598) [-476.349] (-476.872) * (-480.894) (-474.736) (-477.678) [-477.002] -- 0:00:21
Average standard deviation of split frequencies: 0.028687
95500 -- (-477.195) [-476.702] (-477.563) (-477.260) * (-475.578) (-477.733) [-475.381] (-475.969) -- 0:00:25
96000 -- (-477.572) (-480.062) (-475.380) [-474.478] * [-475.288] (-479.287) (-475.260) (-477.685) -- 0:00:25
96500 -- (-475.222) (-478.858) [-476.263] (-474.880) * (-474.907) (-477.412) (-477.915) [-476.087] -- 0:00:25
97000 -- (-476.263) (-478.154) (-477.706) [-474.583] * [-476.191] (-481.804) (-478.638) (-475.012) -- 0:00:24
97500 -- (-474.451) [-475.322] (-476.603) (-477.889) * (-478.096) (-475.170) (-478.426) [-476.907] -- 0:00:24
98000 -- [-475.283] (-476.875) (-477.366) (-476.957) * [-478.898] (-475.298) (-478.054) (-476.705) -- 0:00:24
98500 -- (-474.960) (-477.824) (-474.804) [-476.534] * (-479.120) (-474.587) [-478.287] (-476.022) -- 0:00:24
99000 -- [-474.765] (-476.249) (-476.762) (-474.766) * (-477.860) (-477.104) [-476.489] (-475.251) -- 0:00:24
99500 -- (-478.178) (-475.749) (-475.174) [-474.731] * [-476.177] (-476.672) (-477.123) (-476.726) -- 0:00:24
100000 -- (-479.918) (-480.165) (-475.062) [-475.468] * (-479.070) [-478.951] (-477.276) (-474.487) -- 0:00:24
Average standard deviation of split frequencies: 0.026995
100500 -- (-476.320) (-477.353) (-475.507) [-475.050] * (-476.228) (-476.806) (-477.001) [-474.206] -- 0:00:23
101000 -- (-478.131) (-477.325) [-476.475] (-478.002) * (-479.406) [-478.524] (-480.155) (-476.894) -- 0:00:23
101500 -- (-476.606) (-477.468) [-476.714] (-480.086) * (-476.666) (-476.809) (-480.675) [-477.295] -- 0:00:23
102000 -- (-477.198) (-477.448) (-474.693) [-476.887] * (-476.515) (-478.687) (-479.242) [-476.852] -- 0:00:23
102500 -- (-476.972) (-475.597) (-474.773) [-477.094] * (-475.761) (-477.451) (-477.047) [-475.681] -- 0:00:23
103000 -- (-476.603) (-476.175) (-476.194) [-475.298] * (-476.074) [-476.333] (-475.308) (-478.953) -- 0:00:23
103500 -- (-475.082) (-479.080) [-476.705] (-474.819) * (-475.890) (-477.244) (-477.041) [-480.107] -- 0:00:22
104000 -- (-475.920) [-475.937] (-475.092) (-477.842) * (-476.547) [-478.605] (-482.622) (-478.899) -- 0:00:22
104500 -- (-475.154) [-476.595] (-476.276) (-479.903) * (-476.550) (-475.519) [-479.798] (-475.925) -- 0:00:22
105000 -- (-475.125) (-475.744) [-475.433] (-478.710) * (-475.512) [-477.170] (-481.912) (-474.728) -- 0:00:22
Average standard deviation of split frequencies: 0.025279
105500 -- [-475.524] (-478.430) (-475.809) (-474.835) * (-477.241) (-477.352) [-479.704] (-475.439) -- 0:00:22
106000 -- (-476.469) [-475.097] (-476.240) (-476.745) * (-481.015) (-478.144) (-474.975) [-475.443] -- 0:00:22
106500 -- (-475.334) (-484.788) (-476.027) [-476.409] * (-480.456) (-479.108) [-475.334] (-478.116) -- 0:00:22
107000 -- (-479.845) (-476.794) (-475.605) [-475.599] * (-482.928) (-478.591) (-476.992) [-477.405] -- 0:00:22
107500 -- (-476.050) (-482.955) (-474.974) [-474.891] * (-476.358) (-477.821) (-476.133) [-479.909] -- 0:00:21
108000 -- (-476.036) (-483.356) [-477.343] (-476.905) * (-479.722) (-478.543) [-475.040] (-475.447) -- 0:00:21
108500 -- [-477.593] (-480.352) (-474.951) (-478.632) * (-475.004) (-479.551) [-475.135] (-475.739) -- 0:00:21
109000 -- (-476.671) (-483.060) [-477.608] (-479.619) * (-475.469) [-476.404] (-475.862) (-477.621) -- 0:00:21
109500 -- (-475.629) (-477.903) [-477.861] (-476.098) * (-475.422) (-477.057) (-478.041) [-479.463] -- 0:00:21
110000 -- [-477.896] (-481.866) (-477.504) (-475.531) * (-478.057) (-475.620) (-479.349) [-477.242] -- 0:00:21
Average standard deviation of split frequencies: 0.025355
110500 -- [-475.827] (-476.945) (-475.878) (-481.639) * [-477.918] (-475.353) (-480.644) (-477.519) -- 0:00:21
111000 -- (-475.978) (-478.772) [-474.791] (-480.806) * (-478.495) [-475.624] (-476.714) (-477.208) -- 0:00:21
111500 -- [-476.265] (-476.337) (-474.899) (-475.327) * (-475.916) [-474.610] (-475.076) (-474.762) -- 0:00:20
112000 -- (-474.897) (-474.630) [-476.765] (-475.315) * (-478.474) [-475.785] (-475.013) (-475.717) -- 0:00:20
112500 -- (-480.750) (-475.488) [-474.986] (-475.514) * (-478.118) [-475.140] (-475.422) (-477.950) -- 0:00:20
113000 -- [-477.149] (-478.090) (-479.041) (-478.434) * (-476.803) [-475.628] (-477.208) (-475.384) -- 0:00:23
113500 -- (-476.475) [-478.945] (-476.352) (-474.971) * (-476.378) (-477.418) [-478.408] (-480.209) -- 0:00:23
114000 -- [-477.502] (-479.914) (-474.825) (-477.672) * (-479.607) (-477.392) [-478.350] (-480.786) -- 0:00:23
114500 -- (-479.160) (-474.642) (-476.732) [-479.458] * (-478.148) [-481.511] (-476.545) (-479.224) -- 0:00:23
115000 -- (-480.075) (-480.785) [-474.943] (-475.266) * [-477.014] (-478.523) (-477.011) (-482.372) -- 0:00:23
Average standard deviation of split frequencies: 0.027164
115500 -- (-476.636) [-476.489] (-475.475) (-475.572) * (-477.477) [-474.421] (-476.039) (-483.473) -- 0:00:23
116000 -- (-475.191) (-478.926) (-479.559) [-475.818] * (-480.108) [-475.001] (-474.911) (-481.260) -- 0:00:23
116500 -- (-475.997) (-475.176) (-482.939) [-475.519] * [-475.530] (-475.263) (-475.243) (-478.906) -- 0:00:23
117000 -- (-478.394) [-476.513] (-475.791) (-478.943) * (-475.236) (-475.142) [-475.267] (-479.104) -- 0:00:22
117500 -- (-475.377) (-480.287) (-476.077) [-478.565] * (-478.798) (-476.578) (-474.845) [-474.921] -- 0:00:22
118000 -- (-475.290) (-476.862) [-477.857] (-479.756) * (-478.166) (-477.542) [-478.472] (-480.580) -- 0:00:22
118500 -- (-476.333) (-478.287) [-479.395] (-477.322) * [-478.668] (-478.571) (-474.623) (-478.002) -- 0:00:22
119000 -- (-475.214) [-474.869] (-482.435) (-474.690) * (-480.313) (-476.243) [-474.871] (-476.974) -- 0:00:22
119500 -- (-475.338) (-477.943) [-475.961] (-477.785) * (-477.850) (-475.202) (-475.532) [-477.785] -- 0:00:22
120000 -- [-477.574] (-475.400) (-476.279) (-476.920) * [-475.516] (-477.212) (-479.513) (-476.445) -- 0:00:22
Average standard deviation of split frequencies: 0.024879
120500 -- [-478.317] (-477.573) (-476.642) (-479.277) * (-478.122) (-475.929) (-475.945) [-478.463] -- 0:00:22
121000 -- (-476.806) [-476.147] (-476.952) (-479.237) * (-478.512) (-478.910) (-475.686) [-482.028] -- 0:00:21
121500 -- (-475.125) (-476.962) [-476.721] (-476.578) * [-475.142] (-474.496) (-476.061) (-477.000) -- 0:00:21
122000 -- (-481.887) (-480.277) [-475.325] (-476.676) * (-477.074) (-475.177) (-475.543) [-475.461] -- 0:00:21
122500 -- (-476.513) (-475.484) [-476.542] (-475.830) * [-475.870] (-475.440) (-474.366) (-474.752) -- 0:00:21
123000 -- (-478.212) (-474.473) [-477.142] (-475.490) * (-478.056) (-474.474) (-478.832) [-476.501] -- 0:00:21
123500 -- (-476.694) (-475.366) [-475.283] (-476.283) * (-480.312) (-474.759) [-475.165] (-475.987) -- 0:00:21
124000 -- (-475.526) [-476.233] (-484.437) (-475.527) * (-476.449) [-476.198] (-478.919) (-474.937) -- 0:00:21
124500 -- (-475.480) (-477.314) (-476.381) [-475.226] * (-475.827) [-476.371] (-476.197) (-477.729) -- 0:00:21
125000 -- (-475.673) (-476.659) [-475.574] (-478.125) * (-474.389) (-476.275) [-478.370] (-476.760) -- 0:00:21
Average standard deviation of split frequencies: 0.022635
125500 -- (-477.178) (-477.617) [-476.546] (-476.072) * (-474.388) (-475.422) (-477.150) [-478.487] -- 0:00:20
126000 -- [-474.933] (-475.466) (-475.304) (-476.218) * (-474.860) (-474.697) [-477.650] (-477.828) -- 0:00:20
126500 -- (-476.513) [-476.123] (-477.619) (-476.021) * (-475.182) [-477.552] (-474.735) (-476.758) -- 0:00:20
127000 -- [-474.872] (-479.621) (-480.187) (-477.765) * (-478.213) (-478.110) [-475.074] (-477.739) -- 0:00:20
127500 -- [-475.736] (-480.257) (-475.101) (-474.195) * (-478.966) (-478.930) (-476.244) [-478.454] -- 0:00:20
128000 -- (-476.323) (-477.303) (-477.540) [-475.160] * (-476.463) (-479.728) (-480.600) [-475.227] -- 0:00:20
128500 -- [-476.976] (-475.248) (-474.742) (-475.299) * (-476.382) (-476.207) (-474.578) [-477.875] -- 0:00:20
129000 -- (-478.767) (-477.635) (-476.972) [-476.051] * (-478.547) (-476.782) (-474.633) [-478.782] -- 0:00:23
129500 -- [-476.407] (-476.186) (-475.670) (-476.793) * [-476.579] (-477.329) (-475.363) (-476.313) -- 0:00:22
130000 -- (-476.565) (-477.579) (-476.734) [-476.888] * (-475.321) (-478.514) (-476.671) [-476.741] -- 0:00:22
Average standard deviation of split frequencies: 0.022785
130500 -- (-481.412) (-479.109) (-476.329) [-482.422] * (-478.865) [-476.174] (-476.495) (-476.114) -- 0:00:22
131000 -- (-479.129) (-477.081) [-475.831] (-474.627) * (-478.057) (-476.613) [-476.294] (-477.761) -- 0:00:22
131500 -- (-474.716) (-477.921) (-476.304) [-474.845] * (-476.977) (-478.641) [-476.609] (-475.691) -- 0:00:22
132000 -- (-475.181) (-475.338) [-474.152] (-479.672) * (-476.106) (-478.369) (-480.083) [-476.416] -- 0:00:22
132500 -- (-477.838) [-474.956] (-474.747) (-478.176) * (-475.828) (-479.756) (-474.704) [-477.300] -- 0:00:22
133000 -- [-475.583] (-475.758) (-474.770) (-475.169) * (-474.648) (-475.497) [-476.237] (-477.912) -- 0:00:22
133500 -- (-475.338) [-477.988] (-474.892) (-474.835) * [-477.726] (-474.428) (-474.123) (-475.015) -- 0:00:21
134000 -- (-476.991) [-477.079] (-474.597) (-475.892) * (-476.731) (-475.146) (-476.886) [-476.132] -- 0:00:21
134500 -- (-475.393) [-474.828] (-478.171) (-477.470) * (-474.553) [-478.630] (-476.720) (-478.090) -- 0:00:21
135000 -- (-474.436) [-476.849] (-478.521) (-475.631) * [-477.842] (-475.938) (-476.414) (-478.759) -- 0:00:21
Average standard deviation of split frequencies: 0.020980
135500 -- (-475.361) [-479.459] (-482.416) (-475.829) * (-476.125) (-478.276) [-475.137] (-479.706) -- 0:00:21
136000 -- (-477.756) (-478.218) [-478.966] (-475.657) * (-475.010) (-474.432) [-483.103] (-478.452) -- 0:00:21
136500 -- (-476.169) [-478.115] (-477.405) (-475.902) * (-475.697) (-475.334) [-478.416] (-475.216) -- 0:00:21
137000 -- (-477.886) (-479.045) (-475.088) [-477.005] * (-477.007) [-475.759] (-475.616) (-478.567) -- 0:00:21
137500 -- (-477.260) (-475.981) (-474.639) [-479.131] * (-477.796) (-476.484) (-480.777) [-475.258] -- 0:00:21
138000 -- (-476.011) (-476.542) (-477.154) [-476.638] * (-479.583) [-475.829] (-476.287) (-479.701) -- 0:00:20
138500 -- (-476.932) (-476.275) [-475.479] (-476.662) * (-482.692) (-479.062) [-475.518] (-479.239) -- 0:00:20
139000 -- (-476.501) (-477.581) [-477.905] (-476.451) * [-477.332] (-475.522) (-474.759) (-476.538) -- 0:00:20
139500 -- (-478.116) [-479.913] (-480.656) (-480.842) * (-482.166) (-474.710) [-476.324] (-477.696) -- 0:00:20
140000 -- (-478.059) (-478.489) [-482.096] (-476.897) * (-481.396) [-475.159] (-478.550) (-475.600) -- 0:00:20
Average standard deviation of split frequencies: 0.019225
140500 -- [-477.856] (-476.941) (-476.730) (-476.662) * [-476.797] (-475.246) (-476.508) (-474.821) -- 0:00:20
141000 -- [-474.919] (-475.719) (-479.312) (-475.887) * (-477.496) (-476.283) (-478.923) [-480.969] -- 0:00:20
141500 -- (-475.893) [-475.847] (-478.970) (-477.862) * [-476.909] (-480.792) (-477.018) (-480.863) -- 0:00:20
142000 -- (-477.531) (-477.089) (-477.790) [-476.600] * (-479.648) [-476.308] (-478.173) (-477.314) -- 0:00:20
142500 -- (-480.721) [-478.369] (-475.741) (-477.327) * [-478.260] (-477.388) (-477.027) (-478.530) -- 0:00:20
143000 -- (-476.186) (-479.016) (-478.046) [-475.773] * [-478.705] (-478.875) (-479.876) (-476.800) -- 0:00:19
143500 -- [-475.875] (-482.440) (-482.351) (-475.394) * (-476.248) (-477.102) (-476.070) [-480.439] -- 0:00:22
144000 -- (-475.607) [-476.201] (-477.234) (-476.893) * (-477.658) (-476.878) [-477.455] (-481.975) -- 0:00:22
144500 -- [-478.067] (-476.142) (-475.880) (-474.821) * [-476.006] (-480.467) (-476.263) (-480.300) -- 0:00:22
145000 -- (-477.980) [-476.477] (-476.138) (-475.190) * (-476.407) (-475.907) (-476.671) [-474.738] -- 0:00:22
Average standard deviation of split frequencies: 0.016314
145500 -- [-476.781] (-475.579) (-480.009) (-475.894) * (-476.291) [-475.186] (-476.295) (-478.481) -- 0:00:21
146000 -- (-475.997) [-475.730] (-480.074) (-475.308) * (-476.270) (-479.663) (-478.041) [-477.183] -- 0:00:21
146500 -- [-475.288] (-477.820) (-478.298) (-474.887) * (-477.727) [-476.083] (-477.469) (-482.992) -- 0:00:21
147000 -- (-476.721) (-474.902) [-482.413] (-474.145) * (-478.282) (-480.062) [-481.908] (-478.856) -- 0:00:21
147500 -- (-482.510) [-475.242] (-481.120) (-476.066) * (-476.392) (-475.384) (-477.071) [-476.951] -- 0:00:21
148000 -- (-479.005) (-474.911) [-479.016] (-480.180) * (-477.215) [-478.932] (-474.792) (-475.951) -- 0:00:21
148500 -- (-480.555) (-474.664) [-476.450] (-480.941) * (-474.991) (-480.289) (-474.870) [-475.735] -- 0:00:21
149000 -- [-479.915] (-475.465) (-474.282) (-476.382) * (-475.184) (-477.273) [-474.274] (-477.683) -- 0:00:21
149500 -- (-479.188) (-474.865) (-476.573) [-475.535] * (-476.038) [-478.921] (-475.219) (-476.288) -- 0:00:21
150000 -- [-476.580] (-477.004) (-475.400) (-479.773) * (-474.345) (-478.360) (-475.242) [-476.593] -- 0:00:21
Average standard deviation of split frequencies: 0.016138
150500 -- (-479.746) (-474.508) (-476.560) [-475.827] * (-477.818) [-475.861] (-475.012) (-474.616) -- 0:00:20
151000 -- (-479.574) [-477.560] (-475.800) (-477.338) * (-475.334) [-475.474] (-475.234) (-477.639) -- 0:00:20
151500 -- (-475.982) [-478.686] (-480.966) (-475.576) * (-475.807) (-475.836) (-476.232) [-475.887] -- 0:00:20
152000 -- [-476.183] (-474.136) (-479.121) (-475.097) * (-475.131) (-476.472) [-474.365] (-478.512) -- 0:00:20
152500 -- [-477.086] (-474.215) (-475.862) (-476.268) * (-474.540) (-475.908) [-475.362] (-477.614) -- 0:00:20
153000 -- (-476.921) (-477.195) (-483.808) [-476.141] * (-476.701) [-476.234] (-476.524) (-476.487) -- 0:00:20
153500 -- [-476.004] (-477.038) (-479.626) (-474.876) * (-474.433) (-475.715) (-475.867) [-475.593] -- 0:00:20
154000 -- (-479.252) [-478.417] (-477.257) (-479.985) * (-474.229) (-475.720) [-475.246] (-475.100) -- 0:00:20
154500 -- (-480.800) [-476.614] (-476.137) (-477.403) * [-474.228] (-475.797) (-475.097) (-475.362) -- 0:00:20
155000 -- [-474.856] (-477.851) (-476.260) (-475.884) * (-474.402) (-478.253) [-476.492] (-479.011) -- 0:00:20
Average standard deviation of split frequencies: 0.017495
155500 -- (-483.024) [-477.886] (-474.490) (-477.050) * (-476.713) (-478.781) (-476.156) [-474.887] -- 0:00:19
156000 -- (-474.620) (-476.637) [-475.560] (-475.596) * (-477.644) (-476.351) (-475.540) [-476.485] -- 0:00:19
156500 -- [-475.676] (-477.289) (-476.533) (-475.964) * (-477.273) (-480.354) (-476.701) [-479.976] -- 0:00:19
157000 -- [-475.525] (-477.588) (-475.320) (-475.053) * (-476.118) [-476.616] (-482.385) (-475.327) -- 0:00:19
157500 -- [-476.129] (-479.365) (-480.107) (-476.344) * (-475.100) (-475.136) [-477.300] (-477.074) -- 0:00:19
158000 -- (-479.579) (-477.610) (-476.978) [-475.741] * [-476.829] (-476.775) (-479.261) (-476.975) -- 0:00:19
158500 -- [-478.465] (-476.790) (-476.526) (-477.421) * (-477.302) [-478.525] (-476.602) (-478.164) -- 0:00:19
159000 -- [-479.278] (-476.694) (-476.730) (-477.792) * (-476.321) [-474.701] (-476.652) (-480.477) -- 0:00:19
159500 -- (-475.603) (-475.575) (-479.424) [-477.274] * (-477.006) (-476.163) (-476.224) [-478.389] -- 0:00:19
160000 -- [-475.806] (-475.720) (-476.618) (-477.397) * [-476.322] (-478.004) (-475.083) (-476.214) -- 0:00:19
Average standard deviation of split frequencies: 0.016300
160500 -- [-476.722] (-478.034) (-477.779) (-477.371) * (-477.065) (-475.635) [-478.415] (-475.739) -- 0:00:21
161000 -- (-476.694) (-476.080) (-477.354) [-479.751] * (-478.428) (-474.793) (-475.179) [-476.675] -- 0:00:21
161500 -- (-474.896) (-480.144) (-477.323) [-477.433] * (-477.984) [-478.567] (-475.695) (-479.553) -- 0:00:20
162000 -- (-475.163) (-475.895) [-474.397] (-476.139) * (-477.058) (-479.752) [-475.701] (-477.005) -- 0:00:20
162500 -- (-474.835) (-475.222) (-476.888) [-476.092] * (-476.708) (-476.124) [-475.836] (-476.064) -- 0:00:20
163000 -- [-479.114] (-475.478) (-478.277) (-476.958) * (-477.394) (-477.055) (-482.028) [-478.950] -- 0:00:20
163500 -- (-476.472) (-474.856) (-477.240) [-476.469] * (-476.906) [-476.911] (-475.690) (-478.684) -- 0:00:20
164000 -- (-478.373) [-478.130] (-477.131) (-478.063) * [-477.479] (-476.704) (-474.968) (-476.077) -- 0:00:20
164500 -- (-477.252) (-475.026) [-475.670] (-475.086) * (-478.882) [-475.222] (-475.703) (-475.859) -- 0:00:20
165000 -- [-476.388] (-478.531) (-477.082) (-474.763) * (-478.755) [-477.090] (-481.625) (-478.070) -- 0:00:20
Average standard deviation of split frequencies: 0.018234
165500 -- (-475.451) (-477.812) [-474.866] (-476.844) * [-476.633] (-475.166) (-476.929) (-477.104) -- 0:00:20
166000 -- (-477.677) (-476.942) (-475.773) [-477.104] * (-478.480) (-477.440) [-478.050] (-476.833) -- 0:00:20
166500 -- (-474.459) (-477.064) [-477.177] (-478.823) * (-480.135) (-482.912) (-481.231) [-477.110] -- 0:00:20
167000 -- (-474.872) (-476.126) [-482.089] (-475.962) * (-477.974) (-478.614) [-477.417] (-476.740) -- 0:00:19
167500 -- (-478.126) (-477.788) [-477.044] (-476.396) * (-476.609) (-474.948) (-480.222) [-476.062] -- 0:00:19
168000 -- (-479.583) (-477.726) (-476.846) [-479.919] * (-475.736) (-475.186) [-476.463] (-476.090) -- 0:00:19
168500 -- (-475.424) (-480.823) [-476.726] (-477.745) * (-476.563) (-475.373) (-475.152) [-474.571] -- 0:00:19
169000 -- (-476.484) [-476.483] (-477.825) (-477.799) * [-476.498] (-476.720) (-479.066) (-477.075) -- 0:00:19
169500 -- (-478.764) (-475.507) [-474.741] (-480.100) * (-476.539) (-475.288) (-475.477) [-476.120] -- 0:00:19
170000 -- (-476.933) (-476.846) [-476.062] (-475.179) * (-475.969) (-477.122) [-478.699] (-475.161) -- 0:00:19
Average standard deviation of split frequencies: 0.017009
170500 -- [-481.002] (-479.955) (-474.514) (-480.004) * (-474.980) (-480.968) (-480.223) [-474.592] -- 0:00:19
171000 -- (-480.728) (-477.712) (-481.875) [-478.069] * [-476.084] (-475.677) (-478.656) (-476.608) -- 0:00:19
171500 -- [-475.191] (-480.222) (-477.139) (-478.733) * (-475.593) (-475.814) [-476.010] (-477.531) -- 0:00:19
172000 -- (-475.672) (-476.350) (-475.983) [-475.278] * [-474.666] (-475.416) (-474.775) (-477.901) -- 0:00:19
172500 -- [-475.122] (-475.886) (-476.527) (-475.419) * (-475.157) (-475.683) [-475.572] (-478.046) -- 0:00:18
173000 -- (-474.574) [-478.076] (-483.787) (-477.570) * (-476.647) (-475.792) (-476.788) [-475.289] -- 0:00:18
173500 -- (-476.627) [-475.212] (-477.154) (-479.706) * (-477.284) [-476.813] (-476.372) (-474.298) -- 0:00:18
174000 -- (-476.146) (-475.387) [-479.253] (-480.547) * (-478.994) (-477.308) (-475.579) [-476.007] -- 0:00:18
174500 -- [-479.684] (-477.056) (-476.323) (-476.867) * (-476.604) (-476.631) [-476.122] (-475.888) -- 0:00:18
175000 -- (-477.146) (-478.607) [-479.003] (-478.061) * (-476.337) [-477.475] (-474.702) (-478.794) -- 0:00:18
Average standard deviation of split frequencies: 0.015930
175500 -- (-476.292) [-474.443] (-477.286) (-476.655) * (-479.469) (-477.020) [-475.804] (-479.830) -- 0:00:18
176000 -- (-476.847) (-474.499) (-482.918) [-475.614] * (-476.346) (-474.908) [-476.192] (-480.186) -- 0:00:18
176500 -- (-476.703) (-474.236) [-474.900] (-476.730) * [-475.858] (-474.763) (-476.250) (-476.272) -- 0:00:18
177000 -- [-476.620] (-476.776) (-481.532) (-479.846) * [-474.895] (-476.432) (-475.024) (-475.490) -- 0:00:20
177500 -- (-477.876) (-476.410) [-476.592] (-480.239) * (-477.690) (-476.516) (-477.793) [-474.984] -- 0:00:19
178000 -- (-476.029) (-477.827) (-478.196) [-476.096] * (-480.495) [-477.101] (-475.167) (-474.857) -- 0:00:19
178500 -- [-477.189] (-479.873) (-474.967) (-475.035) * (-474.495) (-477.060) (-480.433) [-474.641] -- 0:00:19
179000 -- (-475.967) (-475.680) [-475.083] (-479.125) * (-475.319) [-476.241] (-475.183) (-478.565) -- 0:00:19
179500 -- (-476.459) [-474.562] (-474.562) (-477.137) * (-478.477) [-476.810] (-476.608) (-476.681) -- 0:00:19
180000 -- (-475.767) [-475.350] (-474.573) (-476.976) * (-476.695) (-478.452) [-475.359] (-478.415) -- 0:00:19
Average standard deviation of split frequencies: 0.016754
180500 -- [-475.814] (-476.128) (-474.652) (-477.801) * (-477.590) (-475.334) [-477.016] (-474.808) -- 0:00:19
181000 -- (-476.537) [-476.443] (-477.862) (-476.893) * (-476.487) (-477.326) (-476.368) [-479.594] -- 0:00:19
181500 -- (-479.558) (-475.140) (-477.193) [-475.389] * (-476.538) (-474.561) (-477.231) [-478.021] -- 0:00:19
182000 -- [-474.980] (-475.488) (-476.666) (-475.007) * (-475.022) [-476.521] (-476.322) (-475.348) -- 0:00:19
182500 -- (-477.462) [-477.512] (-478.692) (-479.896) * (-474.940) (-476.032) [-476.016] (-476.868) -- 0:00:19
183000 -- (-475.901) (-476.390) [-474.727] (-476.539) * (-475.160) (-476.108) [-475.618] (-477.886) -- 0:00:19
183500 -- [-475.689] (-479.491) (-475.280) (-476.397) * (-475.526) (-475.201) (-475.057) [-475.316] -- 0:00:18
184000 -- (-476.627) (-478.453) [-475.770] (-475.385) * (-476.172) (-476.144) (-476.412) [-477.266] -- 0:00:18
184500 -- (-479.908) (-476.878) (-476.129) [-478.630] * (-474.770) [-477.234] (-484.269) (-479.426) -- 0:00:18
185000 -- (-477.591) [-475.200] (-479.536) (-476.409) * (-476.584) [-477.528] (-474.840) (-476.932) -- 0:00:18
Average standard deviation of split frequencies: 0.015086
185500 -- (-479.506) (-478.581) [-476.098] (-477.122) * (-476.204) (-477.808) (-480.280) [-477.083] -- 0:00:18
186000 -- (-476.649) (-479.272) (-476.882) [-477.498] * (-478.664) (-475.191) (-480.932) [-475.495] -- 0:00:18
186500 -- [-476.226] (-479.221) (-475.863) (-474.482) * [-476.237] (-475.083) (-477.343) (-476.686) -- 0:00:18
187000 -- (-474.632) (-476.453) [-476.536] (-475.858) * [-476.435] (-476.133) (-480.292) (-475.764) -- 0:00:18
187500 -- (-474.907) (-477.225) (-476.763) [-475.849] * (-476.090) [-475.077] (-487.017) (-478.186) -- 0:00:18
188000 -- [-476.971] (-476.271) (-477.881) (-476.525) * [-476.401] (-477.712) (-486.234) (-476.187) -- 0:00:18
188500 -- (-474.732) (-477.131) [-476.488] (-477.149) * (-477.594) (-476.969) [-478.253] (-476.374) -- 0:00:18
189000 -- [-477.545] (-476.781) (-477.444) (-482.616) * [-476.204] (-477.308) (-479.800) (-475.670) -- 0:00:18
189500 -- (-477.435) [-476.055] (-474.964) (-476.397) * (-474.974) (-477.803) [-479.062] (-476.398) -- 0:00:18
190000 -- (-475.889) [-475.173] (-476.068) (-475.018) * [-475.342] (-480.547) (-476.820) (-482.691) -- 0:00:17
Average standard deviation of split frequencies: 0.014560
190500 -- (-474.785) (-478.980) (-478.362) [-477.938] * (-475.731) (-477.784) (-474.920) [-475.866] -- 0:00:17
191000 -- (-475.890) (-475.037) [-474.854] (-475.139) * (-477.046) (-480.112) [-475.192] (-476.421) -- 0:00:17
191500 -- (-474.861) (-474.507) (-476.052) [-475.583] * (-476.906) [-479.234] (-475.550) (-479.750) -- 0:00:17
192000 -- (-476.515) (-476.019) (-478.558) [-476.420] * (-475.518) (-478.640) (-482.335) [-476.922] -- 0:00:17
192500 -- (-480.292) (-475.097) [-478.862] (-476.357) * (-476.033) (-476.237) [-476.766] (-475.108) -- 0:00:17
193000 -- (-474.470) [-474.566] (-477.499) (-477.634) * [-475.510] (-475.280) (-475.828) (-478.645) -- 0:00:17
193500 -- (-477.392) [-475.713] (-481.459) (-476.050) * [-475.051] (-475.737) (-479.376) (-476.857) -- 0:00:17
194000 -- (-474.860) (-475.479) (-478.059) [-475.454] * (-476.873) [-476.132] (-478.873) (-475.207) -- 0:00:18
194500 -- (-476.797) [-476.308] (-475.947) (-481.102) * [-476.067] (-477.996) (-479.293) (-476.412) -- 0:00:18
195000 -- (-475.722) [-478.463] (-479.387) (-481.841) * (-477.404) (-474.712) [-477.041] (-476.621) -- 0:00:18
Average standard deviation of split frequencies: 0.013291
195500 -- (-478.079) (-475.981) [-476.040] (-475.283) * (-476.235) [-476.795] (-475.667) (-478.833) -- 0:00:18
196000 -- (-477.774) [-476.215] (-475.806) (-476.751) * (-478.375) [-475.699] (-476.564) (-475.111) -- 0:00:18
196500 -- (-476.792) (-475.787) (-476.954) [-474.523] * (-477.135) [-474.735] (-478.700) (-476.074) -- 0:00:18
197000 -- (-476.240) (-475.568) [-478.407] (-476.881) * (-477.301) (-474.585) [-479.920] (-474.537) -- 0:00:18
197500 -- (-476.866) [-476.344] (-475.424) (-478.366) * [-475.945] (-474.691) (-477.547) (-477.592) -- 0:00:18
198000 -- (-480.436) (-477.687) [-478.255] (-478.780) * (-477.016) (-475.548) [-477.875] (-477.271) -- 0:00:18
198500 -- [-480.485] (-475.949) (-476.180) (-477.984) * (-476.865) [-478.068] (-478.707) (-474.672) -- 0:00:18
199000 -- (-478.389) (-476.563) [-476.307] (-476.337) * (-476.960) (-476.501) [-481.536] (-477.170) -- 0:00:18
199500 -- [-475.328] (-477.039) (-475.768) (-476.104) * [-476.695] (-474.973) (-478.220) (-474.834) -- 0:00:18
200000 -- (-480.127) (-482.914) (-476.404) [-475.070] * (-476.125) (-478.082) (-476.292) [-474.543] -- 0:00:18
Average standard deviation of split frequencies: 0.013312
200500 -- (-477.991) (-478.616) [-478.046] (-475.263) * (-474.678) [-476.678] (-475.572) (-475.788) -- 0:00:17
201000 -- (-475.369) (-475.747) [-476.181] (-476.517) * (-476.494) (-476.799) (-478.099) [-476.248] -- 0:00:17
201500 -- [-474.617] (-478.767) (-475.849) (-474.117) * [-477.714] (-477.893) (-475.169) (-480.653) -- 0:00:17
202000 -- (-475.815) (-477.945) (-476.340) [-477.458] * [-477.277] (-475.109) (-474.970) (-476.474) -- 0:00:17
202500 -- (-475.191) (-477.602) [-476.200] (-479.349) * (-478.463) (-477.680) (-474.300) [-479.532] -- 0:00:17
203000 -- [-475.834] (-482.332) (-475.203) (-479.593) * (-480.184) (-474.949) [-477.509] (-474.970) -- 0:00:17
203500 -- (-476.840) (-475.008) (-480.438) [-476.438] * [-475.704] (-475.418) (-478.760) (-476.016) -- 0:00:17
204000 -- [-478.382] (-479.168) (-476.151) (-477.468) * [-475.285] (-479.269) (-475.458) (-479.954) -- 0:00:17
204500 -- (-476.912) (-484.710) [-476.689] (-478.124) * (-475.629) (-476.284) (-480.324) [-475.912] -- 0:00:17
205000 -- (-477.534) (-480.666) (-476.587) [-476.186] * [-476.995] (-477.670) (-480.317) (-478.331) -- 0:00:17
Average standard deviation of split frequencies: 0.014212
205500 -- (-477.759) (-475.712) (-475.875) [-478.964] * (-475.569) (-478.973) [-476.145] (-477.451) -- 0:00:17
206000 -- (-476.706) (-477.704) (-478.301) [-475.200] * [-474.719] (-476.952) (-477.440) (-475.108) -- 0:00:17
206500 -- (-476.321) (-478.879) (-474.997) [-474.947] * [-476.549] (-476.384) (-474.313) (-477.940) -- 0:00:17
207000 -- (-476.350) (-476.438) (-476.151) [-474.880] * (-474.786) [-476.592] (-477.622) (-476.081) -- 0:00:16
207500 -- [-475.993] (-478.450) (-474.769) (-478.763) * [-474.944] (-475.217) (-475.899) (-477.353) -- 0:00:16
208000 -- (-477.357) (-477.113) (-479.186) [-475.281] * [-475.558] (-479.633) (-476.749) (-477.105) -- 0:00:16
208500 -- (-479.466) (-475.901) [-476.747] (-474.937) * (-476.619) [-476.366] (-477.558) (-477.373) -- 0:00:16
209000 -- (-475.657) [-476.324] (-476.976) (-475.933) * (-475.171) (-477.417) (-476.560) [-475.050] -- 0:00:16
209500 -- (-474.274) [-474.635] (-476.884) (-476.605) * (-475.130) [-474.922] (-474.747) (-477.285) -- 0:00:16
210000 -- [-474.407] (-475.425) (-475.906) (-478.637) * [-474.814] (-476.211) (-474.816) (-481.100) -- 0:00:16
Average standard deviation of split frequencies: 0.014296
210500 -- (-475.492) [-476.466] (-479.417) (-475.450) * (-475.136) (-474.683) (-474.531) [-475.858] -- 0:00:17
211000 -- (-476.291) (-479.455) [-476.373] (-476.514) * (-475.440) (-476.501) [-482.453] (-475.182) -- 0:00:17
211500 -- (-478.178) (-477.067) [-477.935] (-479.747) * (-476.540) (-480.895) (-476.150) [-477.795] -- 0:00:17
212000 -- (-476.950) (-475.826) [-474.888] (-478.745) * (-474.626) (-474.797) [-479.002] (-479.253) -- 0:00:17
212500 -- (-477.091) (-480.019) (-475.711) [-474.660] * (-474.313) (-476.104) (-477.882) [-475.525] -- 0:00:17
213000 -- (-474.618) (-475.417) [-475.044] (-477.052) * (-476.415) (-477.147) (-481.935) [-476.628] -- 0:00:17
213500 -- [-475.233] (-474.875) (-475.884) (-474.883) * (-475.967) [-475.240] (-479.239) (-477.845) -- 0:00:17
214000 -- (-475.375) [-479.860] (-474.203) (-474.868) * (-477.504) (-477.334) [-477.758] (-478.995) -- 0:00:17
214500 -- [-476.642] (-474.143) (-475.492) (-475.097) * (-475.444) [-475.743] (-474.262) (-474.227) -- 0:00:17
215000 -- (-476.760) [-476.658] (-477.481) (-475.324) * [-474.670] (-476.327) (-477.663) (-475.932) -- 0:00:17
Average standard deviation of split frequencies: 0.014186
215500 -- (-479.655) [-475.974] (-475.812) (-474.368) * (-474.577) (-474.552) (-477.689) [-475.398] -- 0:00:17
216000 -- (-477.003) (-476.484) [-475.814] (-475.906) * (-475.362) (-476.050) (-484.696) [-475.821] -- 0:00:17
216500 -- (-475.768) (-476.385) [-476.076] (-477.877) * [-476.569] (-475.717) (-477.285) (-476.872) -- 0:00:17
217000 -- (-474.914) [-476.165] (-476.131) (-478.635) * (-476.000) [-474.644] (-475.431) (-475.549) -- 0:00:16
217500 -- [-474.865] (-476.844) (-475.619) (-479.125) * (-477.552) (-475.524) (-478.058) [-475.230] -- 0:00:16
218000 -- (-477.041) (-478.643) [-478.039] (-479.159) * (-475.067) (-475.024) (-475.596) [-476.124] -- 0:00:16
218500 -- (-474.544) (-482.294) [-476.533] (-481.027) * (-477.801) (-477.903) (-479.044) [-477.400] -- 0:00:16
219000 -- (-477.064) (-476.048) (-475.963) [-476.604] * (-480.791) [-475.700] (-476.696) (-477.173) -- 0:00:16
219500 -- (-476.929) (-476.116) (-476.853) [-476.394] * (-474.841) (-476.154) [-477.951] (-475.683) -- 0:00:16
220000 -- (-476.873) (-475.083) [-476.331] (-476.220) * [-475.580] (-477.803) (-479.624) (-478.131) -- 0:00:16
Average standard deviation of split frequencies: 0.014361
220500 -- [-475.590] (-479.499) (-475.409) (-474.707) * [-475.050] (-477.213) (-476.456) (-477.090) -- 0:00:16
221000 -- [-475.318] (-477.481) (-476.974) (-474.306) * [-474.759] (-475.502) (-476.960) (-475.665) -- 0:00:16
221500 -- [-475.234] (-488.241) (-475.782) (-475.087) * (-478.280) [-478.200] (-477.629) (-478.291) -- 0:00:16
222000 -- (-480.044) (-481.687) [-476.216] (-476.659) * (-476.453) (-477.920) (-475.012) [-475.996] -- 0:00:16
222500 -- [-477.489] (-481.079) (-476.252) (-475.200) * (-476.249) (-476.203) [-475.432] (-474.995) -- 0:00:16
223000 -- [-475.837] (-482.069) (-474.971) (-475.379) * (-478.335) (-474.243) [-476.405] (-477.746) -- 0:00:16
223500 -- (-474.809) (-482.463) (-477.176) [-474.921] * [-474.792] (-475.462) (-479.736) (-475.507) -- 0:00:16
224000 -- (-474.992) [-477.600] (-476.282) (-478.835) * (-476.630) [-474.965] (-475.300) (-474.773) -- 0:00:16
224500 -- [-475.502] (-474.788) (-480.418) (-479.348) * (-479.212) [-474.959] (-477.183) (-479.468) -- 0:00:15
225000 -- (-474.964) (-475.888) [-475.197] (-475.161) * [-475.094] (-476.289) (-477.323) (-483.291) -- 0:00:15
Average standard deviation of split frequencies: 0.013790
225500 -- [-478.962] (-476.102) (-480.472) (-479.029) * (-475.215) (-478.514) (-475.446) [-478.273] -- 0:00:15
226000 -- (-476.742) (-478.292) [-480.451] (-474.272) * (-478.472) (-475.840) [-475.045] (-476.445) -- 0:00:15
226500 -- (-475.193) [-478.663] (-478.710) (-478.962) * [-475.786] (-478.780) (-476.588) (-477.804) -- 0:00:15
227000 -- [-476.621] (-476.153) (-476.278) (-481.504) * (-477.292) (-479.521) (-478.714) [-477.412] -- 0:00:15
227500 -- (-476.011) (-479.719) [-477.069] (-476.580) * (-478.055) (-477.476) (-478.254) [-478.379] -- 0:00:16
228000 -- [-475.073] (-479.964) (-475.430) (-476.326) * (-476.837) [-477.871] (-478.216) (-486.369) -- 0:00:16
228500 -- (-475.019) [-476.653] (-478.754) (-476.208) * [-474.581] (-477.954) (-475.130) (-478.370) -- 0:00:16
229000 -- [-476.956] (-474.847) (-475.054) (-477.892) * (-476.076) (-476.270) [-479.535] (-477.199) -- 0:00:16
229500 -- (-478.315) (-476.852) [-476.656] (-476.300) * (-474.892) [-478.311] (-477.899) (-475.492) -- 0:00:16
230000 -- (-477.066) (-477.526) [-475.260] (-475.188) * (-476.868) (-475.861) [-475.570] (-478.395) -- 0:00:16
Average standard deviation of split frequencies: 0.015628
230500 -- (-475.692) (-476.495) (-474.632) [-477.363] * (-476.693) (-478.029) (-475.675) [-478.678] -- 0:00:16
231000 -- (-475.188) (-479.792) [-477.773] (-477.078) * (-477.284) (-477.019) [-476.400] (-479.232) -- 0:00:16
231500 -- (-479.948) [-477.112] (-477.157) (-477.569) * [-476.550] (-477.072) (-476.765) (-474.407) -- 0:00:16
232000 -- [-477.463] (-479.998) (-475.904) (-481.206) * (-476.172) (-474.605) (-477.823) [-479.199] -- 0:00:16
232500 -- [-476.356] (-477.422) (-475.026) (-480.238) * (-475.433) (-475.867) (-483.493) [-474.788] -- 0:00:16
233000 -- (-476.484) (-479.470) (-477.736) [-477.671] * (-474.546) (-476.655) [-475.637] (-478.475) -- 0:00:16
233500 -- [-475.207] (-475.658) (-474.876) (-476.186) * (-477.466) (-481.371) (-477.368) [-476.159] -- 0:00:15
234000 -- (-476.238) (-477.263) (-475.596) [-478.585] * (-479.862) [-475.487] (-475.119) (-475.679) -- 0:00:15
234500 -- [-476.927] (-475.589) (-474.676) (-476.095) * [-479.707] (-476.550) (-476.847) (-476.937) -- 0:00:15
235000 -- (-474.555) (-474.348) (-475.009) [-477.129] * (-478.180) [-475.403] (-476.342) (-475.542) -- 0:00:15
Average standard deviation of split frequencies: 0.015862
235500 -- (-476.442) (-474.557) (-476.783) [-476.141] * (-475.845) (-476.353) (-477.629) [-475.092] -- 0:00:15
236000 -- (-477.298) (-474.648) [-478.335] (-476.409) * (-475.966) (-484.267) [-479.025] (-476.901) -- 0:00:15
236500 -- (-476.809) (-477.110) (-476.072) [-476.426] * [-475.077] (-476.224) (-475.246) (-477.548) -- 0:00:15
237000 -- [-475.814] (-485.355) (-475.997) (-477.791) * (-479.721) [-476.882] (-475.521) (-474.361) -- 0:00:15
237500 -- [-475.774] (-483.963) (-477.781) (-475.061) * (-481.062) (-476.662) (-474.861) [-475.248] -- 0:00:15
238000 -- (-475.595) (-479.202) [-475.714] (-478.767) * (-475.439) (-477.187) (-476.987) [-475.711] -- 0:00:15
238500 -- [-477.186] (-478.145) (-475.692) (-476.634) * (-475.542) [-476.786] (-478.357) (-479.137) -- 0:00:15
239000 -- (-475.967) (-476.592) (-475.209) [-475.255] * (-474.454) (-476.490) [-475.726] (-476.330) -- 0:00:15
239500 -- (-475.086) (-476.889) (-480.074) [-474.958] * [-474.993] (-476.915) (-478.449) (-475.822) -- 0:00:15
240000 -- (-477.558) (-477.051) (-476.439) [-475.243] * (-476.782) [-476.331] (-476.685) (-475.638) -- 0:00:15
Average standard deviation of split frequencies: 0.014518
240500 -- [-474.638] (-475.242) (-478.029) (-476.553) * [-476.688] (-476.001) (-476.485) (-477.104) -- 0:00:15
241000 -- (-477.030) (-476.744) (-476.805) [-475.259] * (-476.158) [-475.218] (-478.544) (-474.861) -- 0:00:15
241500 -- (-476.661) (-479.902) [-476.299] (-474.584) * (-474.978) (-476.442) [-476.943] (-477.399) -- 0:00:14
242000 -- (-478.947) (-474.849) (-479.703) [-476.552] * (-477.862) (-478.694) (-477.267) [-476.405] -- 0:00:14
242500 -- (-481.023) (-477.117) [-478.367] (-477.115) * (-477.482) (-478.078) (-478.021) [-476.334] -- 0:00:14
243000 -- [-475.293] (-476.371) (-475.637) (-479.477) * [-475.297] (-475.172) (-476.927) (-476.683) -- 0:00:14
243500 -- (-479.311) (-474.862) (-474.815) [-476.126] * (-477.310) (-479.144) (-476.102) [-475.251] -- 0:00:14
244000 -- (-481.700) [-476.548] (-475.486) (-476.694) * [-475.056] (-484.414) (-477.519) (-474.763) -- 0:00:14
244500 -- (-475.153) [-475.003] (-475.680) (-477.512) * (-479.814) (-483.598) (-479.033) [-474.821] -- 0:00:15
245000 -- [-474.845] (-474.802) (-479.021) (-475.823) * (-477.680) (-476.649) [-475.150] (-477.367) -- 0:00:15
Average standard deviation of split frequencies: 0.014992
245500 -- (-474.501) (-478.192) (-478.380) [-474.874] * [-477.496] (-477.346) (-476.992) (-476.402) -- 0:00:15
246000 -- (-475.113) [-476.573] (-476.317) (-476.625) * (-482.191) (-477.319) [-475.035] (-479.942) -- 0:00:15
246500 -- (-474.827) [-474.309] (-475.403) (-476.759) * [-476.143] (-477.103) (-476.086) (-478.028) -- 0:00:15
247000 -- (-478.241) (-476.938) (-475.599) [-474.506] * (-476.298) (-475.688) (-475.144) [-477.273] -- 0:00:15
247500 -- (-476.952) (-475.673) [-475.294] (-479.292) * [-475.436] (-475.645) (-480.204) (-477.156) -- 0:00:15
248000 -- [-475.854] (-477.669) (-477.503) (-478.451) * [-475.301] (-478.096) (-477.437) (-477.956) -- 0:00:15
248500 -- (-484.861) (-479.468) (-479.208) [-476.443] * [-475.362] (-481.185) (-478.866) (-483.205) -- 0:00:15
249000 -- (-482.138) [-474.982] (-479.881) (-475.079) * [-476.886] (-479.572) (-479.008) (-476.879) -- 0:00:15
249500 -- [-479.003] (-475.895) (-476.869) (-477.526) * (-480.075) [-477.479] (-474.525) (-476.916) -- 0:00:15
250000 -- (-477.463) (-477.776) (-476.491) [-476.337] * (-476.999) (-475.400) (-475.712) [-474.822] -- 0:00:15
Average standard deviation of split frequencies: 0.015633
250500 -- [-474.758] (-478.487) (-476.819) (-476.701) * (-475.916) (-476.625) (-476.982) [-475.070] -- 0:00:14
251000 -- (-475.374) [-475.444] (-477.979) (-475.313) * (-479.205) (-476.519) (-475.070) [-476.851] -- 0:00:14
251500 -- (-475.971) (-477.501) (-476.626) [-475.564] * (-475.298) (-474.284) [-476.121] (-474.470) -- 0:00:14
252000 -- (-477.389) (-476.297) (-478.284) [-476.314] * (-476.012) (-476.829) (-477.345) [-475.417] -- 0:00:14
252500 -- (-475.706) [-476.528] (-478.053) (-475.212) * (-478.966) (-476.522) (-476.004) [-474.309] -- 0:00:14
253000 -- (-480.530) [-474.987] (-477.416) (-474.692) * (-477.630) (-474.748) (-476.175) [-474.691] -- 0:00:14
253500 -- (-476.654) (-476.613) (-477.338) [-474.497] * (-477.943) (-475.034) [-477.287] (-478.001) -- 0:00:14
254000 -- [-475.861] (-475.556) (-477.219) (-475.269) * (-484.707) [-475.557] (-474.974) (-475.783) -- 0:00:14
254500 -- (-475.799) [-476.313] (-479.292) (-480.436) * [-478.753] (-477.563) (-477.166) (-477.291) -- 0:00:14
255000 -- (-475.193) (-475.337) [-476.488] (-478.358) * (-475.585) [-475.469] (-476.274) (-478.481) -- 0:00:14
Average standard deviation of split frequencies: 0.014041
255500 -- [-481.455] (-475.847) (-475.830) (-477.850) * (-477.531) (-476.234) (-476.161) [-475.723] -- 0:00:14
256000 -- (-486.319) (-475.908) (-477.665) [-475.522] * [-475.339] (-478.753) (-477.306) (-477.571) -- 0:00:14
256500 -- [-478.048] (-474.840) (-477.503) (-478.013) * (-476.358) (-478.460) [-479.576] (-478.875) -- 0:00:14
257000 -- (-474.982) (-477.102) [-476.216] (-475.547) * (-476.956) (-477.172) (-479.283) [-475.321] -- 0:00:14
257500 -- [-477.668] (-480.320) (-478.055) (-476.068) * (-477.136) (-475.612) [-477.526] (-474.834) -- 0:00:14
258000 -- (-479.964) [-477.055] (-474.486) (-478.032) * (-475.941) (-477.138) [-476.206] (-475.620) -- 0:00:14
258500 -- (-479.354) (-476.229) [-474.734] (-479.370) * [-475.237] (-476.989) (-474.768) (-477.215) -- 0:00:14
259000 -- (-478.026) (-477.050) [-476.511] (-474.652) * (-475.825) (-479.823) [-476.548] (-476.175) -- 0:00:13
259500 -- (-477.209) [-476.224] (-476.980) (-481.075) * (-476.357) (-476.813) (-475.446) [-479.679] -- 0:00:13
260000 -- [-477.799] (-477.198) (-478.458) (-477.682) * [-475.828] (-475.097) (-476.680) (-475.155) -- 0:00:13
Average standard deviation of split frequencies: 0.014807
260500 -- (-475.166) (-477.715) [-475.761] (-477.868) * [-477.099] (-478.440) (-477.408) (-476.448) -- 0:00:13
261000 -- (-479.143) (-476.582) [-476.968] (-475.667) * (-476.317) (-476.615) (-474.826) [-475.467] -- 0:00:13
261500 -- (-477.578) (-478.943) (-474.944) [-477.661] * (-476.308) [-476.573] (-475.531) (-475.920) -- 0:00:14
262000 -- (-479.259) (-477.645) [-476.899] (-477.226) * (-477.182) (-478.958) (-476.336) [-476.701] -- 0:00:14
262500 -- (-476.237) [-478.201] (-476.212) (-478.361) * (-474.434) (-474.916) (-476.440) [-474.858] -- 0:00:14
263000 -- (-477.048) (-476.045) (-476.532) [-474.949] * [-475.057] (-475.398) (-480.118) (-479.359) -- 0:00:14
263500 -- (-475.418) (-484.147) (-475.018) [-477.309] * (-476.387) (-475.616) [-475.229] (-475.843) -- 0:00:14
264000 -- (-474.643) (-480.378) (-475.608) [-476.198] * [-475.427] (-476.483) (-476.683) (-478.529) -- 0:00:14
264500 -- (-474.070) (-475.592) [-478.192] (-475.412) * (-478.169) (-476.164) [-476.499] (-479.552) -- 0:00:14
265000 -- [-475.179] (-481.686) (-478.520) (-475.140) * (-475.544) (-476.185) (-476.861) [-474.931] -- 0:00:14
Average standard deviation of split frequencies: 0.014953
265500 -- [-475.039] (-474.197) (-477.349) (-475.988) * (-475.331) (-476.536) (-475.775) [-475.083] -- 0:00:14
266000 -- (-476.899) [-475.716] (-476.749) (-475.694) * (-475.375) (-475.194) [-477.661] (-476.357) -- 0:00:14
266500 -- (-476.702) [-477.124] (-476.372) (-478.196) * (-475.099) (-474.280) [-474.515] (-477.801) -- 0:00:14
267000 -- (-477.238) (-477.101) (-475.228) [-478.163] * (-475.528) (-478.129) [-476.403] (-477.230) -- 0:00:13
267500 -- [-475.280] (-475.706) (-479.007) (-477.058) * (-475.614) (-477.889) (-474.710) [-477.865] -- 0:00:13
268000 -- (-478.897) [-475.038] (-478.165) (-475.328) * (-476.525) [-474.430] (-476.177) (-476.557) -- 0:00:13
268500 -- (-478.924) [-475.370] (-476.310) (-475.443) * (-483.132) (-476.864) [-475.311] (-477.174) -- 0:00:13
269000 -- (-480.870) [-477.889] (-476.172) (-474.785) * (-478.509) [-475.426] (-480.726) (-475.712) -- 0:00:13
269500 -- (-479.960) (-479.791) (-474.646) [-476.384] * (-476.782) (-476.190) (-479.895) [-474.537] -- 0:00:13
270000 -- (-480.966) (-479.615) (-477.288) [-476.030] * [-475.713] (-476.245) (-476.739) (-475.495) -- 0:00:13
Average standard deviation of split frequencies: 0.014913
270500 -- (-475.530) (-477.419) [-477.541] (-476.939) * (-475.860) (-479.061) [-476.419] (-475.926) -- 0:00:13
271000 -- [-475.252] (-476.132) (-477.268) (-480.388) * (-477.030) (-479.045) [-475.946] (-476.018) -- 0:00:13
271500 -- (-475.656) [-477.489] (-476.162) (-488.006) * (-477.927) (-479.052) [-474.523] (-477.817) -- 0:00:13
272000 -- [-475.095] (-475.853) (-474.249) (-476.062) * (-475.342) (-477.430) (-475.992) [-475.273] -- 0:00:13
272500 -- (-475.460) (-484.855) (-478.472) [-476.888] * (-476.206) (-479.542) [-474.574] (-476.299) -- 0:00:13
273000 -- (-475.545) (-475.374) (-475.633) [-475.937] * (-476.219) (-475.772) (-475.429) [-476.535] -- 0:00:13
273500 -- (-474.447) (-477.863) (-475.834) [-475.042] * (-475.827) [-475.112] (-479.350) (-477.235) -- 0:00:13
274000 -- (-480.256) (-478.011) [-477.591] (-476.886) * [-475.710] (-476.233) (-477.406) (-475.553) -- 0:00:13
274500 -- [-480.137] (-478.210) (-477.522) (-474.589) * (-476.836) [-476.600] (-474.818) (-479.474) -- 0:00:13
275000 -- (-476.248) (-476.880) (-476.721) [-477.648] * [-476.089] (-476.733) (-479.069) (-477.095) -- 0:00:13
Average standard deviation of split frequencies: 0.015052
275500 -- (-475.362) [-479.111] (-475.017) (-478.045) * [-474.894] (-475.919) (-479.975) (-479.378) -- 0:00:13
276000 -- (-477.640) (-477.783) (-474.314) [-475.086] * [-475.814] (-477.868) (-477.233) (-480.421) -- 0:00:12
276500 -- [-475.244] (-482.881) (-474.797) (-479.046) * (-475.376) (-476.908) (-475.829) [-477.161] -- 0:00:12
277000 -- (-474.878) (-475.616) (-476.186) [-475.730] * (-476.341) (-482.339) (-474.951) [-476.080] -- 0:00:12
277500 -- (-478.001) (-482.141) [-475.332] (-474.928) * [-475.096] (-477.748) (-475.865) (-475.499) -- 0:00:12
278000 -- (-477.275) [-478.146] (-476.065) (-476.615) * (-476.883) (-483.924) [-475.207] (-478.005) -- 0:00:12
278500 -- [-475.379] (-476.656) (-479.515) (-479.092) * (-475.765) [-475.559] (-476.222) (-474.755) -- 0:00:13
279000 -- [-475.145] (-478.028) (-476.041) (-478.316) * (-477.361) [-475.212] (-475.990) (-477.178) -- 0:00:13
279500 -- (-475.186) [-476.322] (-477.652) (-477.966) * (-479.449) (-476.097) (-474.839) [-475.078] -- 0:00:13
280000 -- (-475.395) (-474.538) (-477.174) [-476.763] * [-482.668] (-476.355) (-477.716) (-483.030) -- 0:00:13
Average standard deviation of split frequencies: 0.015851
280500 -- (-476.664) [-474.543] (-477.456) (-476.768) * (-475.597) (-477.969) (-477.156) [-478.978] -- 0:00:13
281000 -- [-477.177] (-474.409) (-477.107) (-476.369) * [-474.965] (-475.662) (-477.152) (-476.682) -- 0:00:13
281500 -- [-475.699] (-475.348) (-479.559) (-475.296) * (-475.803) (-476.723) (-476.127) [-475.085] -- 0:00:13
282000 -- (-475.409) (-475.509) (-481.921) [-475.382] * (-475.564) (-476.291) [-476.951] (-477.766) -- 0:00:13
282500 -- [-475.571] (-476.820) (-477.744) (-474.386) * [-474.834] (-476.497) (-478.144) (-477.017) -- 0:00:13
283000 -- (-474.938) (-481.506) [-477.931] (-481.789) * (-479.738) (-481.045) (-481.052) [-481.987] -- 0:00:13
283500 -- (-475.317) (-478.443) [-478.170] (-475.426) * (-474.742) [-477.089] (-481.146) (-476.767) -- 0:00:12
284000 -- (-475.195) [-476.766] (-477.420) (-475.268) * (-475.581) (-478.179) (-475.336) [-474.848] -- 0:00:12
284500 -- (-478.430) [-476.116] (-482.096) (-478.489) * (-476.410) [-477.030] (-480.447) (-476.435) -- 0:00:12
285000 -- (-476.880) (-474.058) [-477.333] (-476.541) * [-474.701] (-475.076) (-477.316) (-481.841) -- 0:00:12
Average standard deviation of split frequencies: 0.014834
285500 -- (-476.060) [-477.601] (-482.542) (-474.996) * (-475.392) [-475.253] (-476.364) (-476.424) -- 0:00:12
286000 -- (-476.656) [-475.160] (-476.840) (-474.747) * [-475.240] (-477.007) (-478.208) (-476.201) -- 0:00:12
286500 -- (-477.938) (-475.762) (-475.837) [-478.240] * (-474.520) (-475.718) (-476.950) [-476.122] -- 0:00:12
287000 -- (-477.589) (-475.169) [-477.044] (-481.997) * [-474.341] (-478.486) (-477.948) (-480.542) -- 0:00:12
287500 -- (-475.620) (-476.652) (-478.234) [-482.755] * (-477.258) (-476.623) [-476.579] (-479.875) -- 0:00:12
288000 -- [-476.219] (-476.943) (-477.788) (-480.435) * [-478.668] (-479.807) (-478.677) (-478.518) -- 0:00:12
288500 -- [-475.723] (-482.153) (-474.840) (-480.139) * [-476.549] (-478.109) (-475.342) (-475.680) -- 0:00:12
289000 -- (-478.420) (-483.186) [-477.468] (-478.371) * (-477.861) (-479.182) [-474.706] (-478.494) -- 0:00:12
289500 -- (-476.989) (-484.789) [-477.501] (-475.694) * (-475.011) (-476.246) [-478.190] (-477.465) -- 0:00:12
290000 -- (-478.380) (-475.649) [-476.327] (-476.597) * (-475.234) (-483.874) [-474.525] (-475.182) -- 0:00:12
Average standard deviation of split frequencies: 0.014900
290500 -- (-474.352) (-475.276) (-480.656) [-476.062] * (-477.036) (-475.528) [-477.292] (-481.278) -- 0:00:12
291000 -- (-475.318) (-477.340) [-476.734] (-476.779) * (-475.222) (-479.601) [-477.990] (-478.666) -- 0:00:12
291500 -- [-474.335] (-476.457) (-474.634) (-477.271) * (-477.626) (-475.736) [-474.766] (-480.886) -- 0:00:12
292000 -- (-474.080) [-477.159] (-477.467) (-476.279) * (-482.037) (-476.031) [-475.448] (-476.528) -- 0:00:12
292500 -- [-477.992] (-475.815) (-479.485) (-478.079) * (-477.495) (-475.964) [-477.532] (-476.324) -- 0:00:12
293000 -- (-475.284) (-475.249) (-478.672) [-476.586] * (-476.093) [-476.738] (-477.300) (-474.457) -- 0:00:12
293500 -- (-476.845) [-476.988] (-477.234) (-476.067) * [-482.860] (-475.395) (-476.913) (-477.268) -- 0:00:11
294000 -- (-475.316) (-474.811) [-479.116] (-475.743) * (-480.489) [-475.470] (-476.412) (-477.434) -- 0:00:11
294500 -- (-475.259) [-476.098] (-476.549) (-477.170) * (-478.845) (-478.094) (-480.590) [-476.193] -- 0:00:11
295000 -- [-475.521] (-482.977) (-476.522) (-476.782) * [-478.410] (-476.642) (-478.335) (-479.997) -- 0:00:12
Average standard deviation of split frequencies: 0.015926
295500 -- (-476.706) [-478.444] (-476.700) (-475.636) * [-478.330] (-477.720) (-478.197) (-475.746) -- 0:00:12
296000 -- [-475.123] (-479.525) (-477.463) (-474.337) * (-477.737) (-476.676) [-478.136] (-475.112) -- 0:00:12
296500 -- (-475.665) (-478.283) [-475.650] (-475.162) * (-476.938) [-475.719] (-474.995) (-476.439) -- 0:00:12
297000 -- (-475.256) (-476.732) [-478.153] (-475.762) * (-474.243) (-478.963) [-475.845] (-477.269) -- 0:00:12
297500 -- (-479.385) (-476.144) [-477.088] (-475.931) * [-475.136] (-474.472) (-478.557) (-476.498) -- 0:00:12
298000 -- (-474.843) [-479.354] (-475.645) (-475.035) * (-478.562) [-476.971] (-477.197) (-476.356) -- 0:00:12
298500 -- (-477.764) (-477.272) (-475.900) [-475.569] * (-475.135) (-475.869) (-475.963) [-474.746] -- 0:00:12
299000 -- (-475.017) [-479.814] (-474.600) (-474.300) * (-478.189) [-476.554] (-478.415) (-477.195) -- 0:00:12
299500 -- (-477.478) (-477.048) (-477.374) [-476.853] * [-474.740] (-476.219) (-474.460) (-476.286) -- 0:00:12
300000 -- (-477.013) (-476.430) (-475.288) [-475.297] * (-478.461) (-474.841) [-474.514] (-476.972) -- 0:00:12
Average standard deviation of split frequencies: 0.015581
300500 -- [-477.121] (-475.781) (-476.635) (-474.790) * (-475.814) (-475.132) (-476.887) [-476.216] -- 0:00:11
301000 -- (-478.145) (-475.732) (-474.766) [-475.888] * (-477.141) [-474.588] (-478.551) (-477.298) -- 0:00:11
301500 -- (-478.246) (-478.485) [-475.787] (-476.833) * (-474.922) [-475.421] (-476.731) (-475.963) -- 0:00:11
302000 -- [-477.909] (-475.527) (-474.801) (-476.963) * (-474.539) (-474.328) [-475.387] (-478.904) -- 0:00:11
302500 -- [-476.278] (-476.257) (-475.347) (-480.967) * (-477.978) [-475.487] (-477.532) (-479.058) -- 0:00:11
303000 -- (-478.801) (-477.862) [-474.865] (-477.987) * (-475.793) (-477.088) (-475.632) [-475.009] -- 0:00:11
303500 -- [-481.220] (-475.912) (-474.457) (-477.133) * (-476.698) (-475.795) [-475.411] (-476.901) -- 0:00:11
304000 -- [-477.018] (-478.013) (-477.744) (-476.343) * [-475.697] (-475.914) (-476.945) (-477.214) -- 0:00:11
304500 -- [-485.841] (-475.369) (-477.574) (-476.583) * [-475.096] (-478.307) (-477.895) (-475.131) -- 0:00:11
305000 -- (-477.688) (-477.754) [-475.184] (-476.413) * [-476.175] (-476.218) (-478.707) (-476.195) -- 0:00:11
Average standard deviation of split frequencies: 0.015405
305500 -- (-475.520) (-484.771) [-476.332] (-475.696) * [-477.731] (-475.709) (-477.623) (-474.239) -- 0:00:11
306000 -- (-483.734) (-480.026) (-475.098) [-476.678] * (-479.577) [-479.283] (-480.152) (-476.290) -- 0:00:11
306500 -- (-479.229) (-475.409) (-478.820) [-475.107] * (-475.535) [-475.129] (-474.293) (-476.713) -- 0:00:11
307000 -- (-475.596) [-476.376] (-475.391) (-478.587) * [-477.171] (-476.413) (-476.540) (-478.658) -- 0:00:11
307500 -- (-476.377) [-474.726] (-474.535) (-476.333) * (-475.933) [-476.712] (-475.395) (-474.790) -- 0:00:11
308000 -- (-476.997) [-475.051] (-474.619) (-479.180) * (-477.153) (-475.498) [-476.089] (-476.871) -- 0:00:11
308500 -- (-474.782) [-477.281] (-476.393) (-477.897) * (-474.691) (-477.589) (-475.597) [-475.438] -- 0:00:11
309000 -- (-475.473) (-478.812) [-477.733] (-476.024) * (-474.489) (-479.718) [-475.028] (-475.716) -- 0:00:11
309500 -- (-475.853) (-474.607) (-477.482) [-475.158] * (-475.879) (-477.087) (-479.434) [-476.283] -- 0:00:11
310000 -- (-476.739) [-477.232] (-475.380) (-478.328) * (-475.892) (-477.255) [-476.624] (-477.573) -- 0:00:11
Average standard deviation of split frequencies: 0.014638
310500 -- [-477.709] (-477.373) (-475.777) (-475.826) * (-478.102) (-478.022) (-476.857) [-478.941] -- 0:00:11
311000 -- (-474.803) [-475.192] (-477.930) (-474.392) * (-480.440) (-478.014) [-474.487] (-478.016) -- 0:00:11
311500 -- [-474.484] (-477.836) (-477.849) (-474.349) * (-486.263) (-479.461) (-475.643) [-476.904] -- 0:00:11
312000 -- (-477.710) (-475.589) [-478.576] (-479.067) * (-486.593) (-477.969) [-477.345] (-476.920) -- 0:00:11
312500 -- (-474.759) (-475.914) (-475.577) [-478.251] * (-476.215) (-475.951) (-478.588) [-476.286] -- 0:00:11
313000 -- [-476.052] (-475.579) (-475.570) (-477.140) * (-476.054) [-475.812] (-477.226) (-474.864) -- 0:00:11
313500 -- (-476.990) (-477.725) (-475.699) [-478.647] * (-475.836) (-475.268) (-477.919) [-479.173] -- 0:00:11
314000 -- (-480.545) (-475.759) [-476.706] (-476.574) * (-475.042) (-475.305) [-474.336] (-480.586) -- 0:00:11
314500 -- [-476.672] (-476.104) (-477.293) (-476.077) * (-476.954) [-475.038] (-474.264) (-477.512) -- 0:00:11
315000 -- (-475.272) (-476.131) [-476.190] (-474.403) * (-478.437) (-476.867) (-476.438) [-479.303] -- 0:00:11
Average standard deviation of split frequencies: 0.014304
315500 -- (-476.952) [-475.984] (-476.607) (-474.282) * (-478.090) [-477.555] (-476.812) (-477.355) -- 0:00:11
316000 -- (-477.517) (-475.978) [-476.452] (-476.408) * (-479.328) [-477.458] (-477.252) (-474.628) -- 0:00:11
316500 -- (-476.499) [-477.118] (-480.521) (-479.120) * (-476.930) (-475.710) (-478.847) [-474.854] -- 0:00:11
317000 -- (-478.707) [-474.595] (-477.754) (-475.820) * (-478.293) [-477.091] (-475.062) (-477.863) -- 0:00:10
317500 -- (-477.061) (-477.762) [-477.424] (-474.677) * [-474.881] (-479.497) (-477.973) (-476.514) -- 0:00:10
318000 -- (-476.482) (-479.875) (-478.080) [-476.329] * [-474.881] (-477.721) (-474.565) (-477.991) -- 0:00:10
318500 -- (-474.367) (-474.963) (-478.451) [-475.014] * (-478.883) (-476.373) [-479.298] (-475.587) -- 0:00:10
319000 -- (-477.448) (-481.922) [-475.693] (-476.904) * [-475.484] (-474.958) (-480.317) (-478.154) -- 0:00:10
319500 -- (-474.397) (-477.987) [-474.396] (-475.575) * (-475.188) [-474.834] (-482.516) (-476.021) -- 0:00:10
320000 -- (-477.468) (-476.271) (-475.217) [-476.542] * [-475.325] (-476.068) (-479.243) (-475.146) -- 0:00:10
Average standard deviation of split frequencies: 0.014268
320500 -- (-477.956) (-474.583) (-475.068) [-477.582] * (-475.268) (-474.898) [-475.035] (-475.218) -- 0:00:10
321000 -- (-475.519) (-474.793) (-483.637) [-476.122] * [-475.319] (-474.494) (-475.463) (-475.180) -- 0:00:10
321500 -- (-476.381) (-474.807) [-475.285] (-475.071) * [-474.517] (-474.249) (-476.833) (-477.440) -- 0:00:10
322000 -- (-475.238) [-475.013] (-475.969) (-477.803) * (-475.978) [-475.715] (-476.780) (-476.821) -- 0:00:10
322500 -- (-475.514) (-475.846) [-479.096] (-477.410) * (-477.306) [-478.557] (-476.319) (-475.524) -- 0:00:10
323000 -- [-474.518] (-475.991) (-476.050) (-477.747) * [-475.373] (-476.547) (-480.768) (-479.428) -- 0:00:10
323500 -- (-479.206) [-475.177] (-476.841) (-476.247) * [-474.851] (-477.985) (-475.828) (-477.537) -- 0:00:10
324000 -- (-475.179) [-475.579] (-478.169) (-476.411) * (-476.062) [-475.669] (-478.147) (-477.536) -- 0:00:10
324500 -- [-477.414] (-475.662) (-479.054) (-475.455) * [-476.638] (-475.858) (-475.455) (-482.000) -- 0:00:10
325000 -- (-474.917) [-474.169] (-477.159) (-476.969) * (-474.703) [-477.814] (-477.523) (-475.242) -- 0:00:10
Average standard deviation of split frequencies: 0.015566
325500 -- [-476.426] (-477.366) (-477.739) (-478.252) * (-475.936) [-478.378] (-479.224) (-475.892) -- 0:00:10
326000 -- (-476.054) [-476.177] (-475.982) (-476.599) * (-478.775) (-477.246) [-476.762] (-477.346) -- 0:00:10
326500 -- (-479.251) [-477.183] (-475.802) (-475.313) * [-477.997] (-479.497) (-476.565) (-476.183) -- 0:00:10
327000 -- (-477.395) (-478.041) [-476.338] (-476.219) * (-476.849) (-476.252) (-476.734) [-475.052] -- 0:00:10
327500 -- [-476.310] (-476.257) (-476.129) (-475.330) * (-476.843) (-476.757) [-475.611] (-475.601) -- 0:00:10
328000 -- (-479.376) [-476.513] (-474.477) (-474.816) * (-476.962) (-479.353) (-475.478) [-476.768] -- 0:00:10
328500 -- (-487.296) (-481.712) (-475.615) [-477.324] * (-478.457) (-475.458) (-476.367) [-476.296] -- 0:00:10
329000 -- (-481.439) (-477.837) [-476.888] (-475.993) * (-480.518) (-477.244) [-476.145] (-477.331) -- 0:00:10
329500 -- (-477.116) (-479.317) [-477.338] (-475.671) * (-476.172) (-478.498) [-480.467] (-475.586) -- 0:00:10
330000 -- (-477.364) (-477.055) (-475.955) [-474.485] * (-475.344) (-476.630) (-478.643) [-476.344] -- 0:00:10
Average standard deviation of split frequencies: 0.016216
330500 -- [-475.572] (-474.392) (-474.284) (-476.254) * (-478.768) (-476.296) [-475.760] (-476.566) -- 0:00:10
331000 -- (-476.377) (-476.829) (-475.564) [-476.064] * (-474.514) (-475.937) (-475.519) [-475.641] -- 0:00:10
331500 -- (-476.293) [-476.615] (-476.390) (-476.952) * (-474.441) (-479.206) (-478.929) [-477.438] -- 0:00:10
332000 -- [-474.105] (-480.751) (-476.106) (-476.540) * (-475.273) (-478.936) [-475.481] (-474.986) -- 0:00:10
332500 -- (-474.105) (-476.511) (-478.740) [-476.294] * (-476.279) (-478.767) [-475.741] (-474.754) -- 0:00:10
333000 -- (-474.882) [-475.922] (-479.809) (-479.157) * (-476.019) (-477.544) (-475.442) [-475.923] -- 0:00:10
333500 -- (-476.335) [-477.102] (-478.312) (-480.280) * (-478.505) (-475.231) (-476.011) [-476.885] -- 0:00:09
334000 -- (-475.517) [-474.610] (-475.565) (-474.999) * (-476.345) (-477.365) [-475.889] (-475.456) -- 0:00:09
334500 -- (-479.343) (-475.155) (-476.561) [-475.203] * (-478.707) [-474.517] (-475.854) (-475.950) -- 0:00:09
335000 -- (-475.207) (-478.720) (-475.194) [-476.187] * [-476.659] (-475.066) (-476.802) (-476.437) -- 0:00:09
Average standard deviation of split frequencies: 0.015696
335500 -- (-477.269) (-475.690) (-478.471) [-476.428] * [-476.711] (-474.989) (-479.339) (-475.681) -- 0:00:09
336000 -- (-477.904) (-475.535) [-478.801] (-476.850) * (-477.354) (-475.678) [-478.084] (-475.461) -- 0:00:09
336500 -- (-480.387) (-476.169) [-480.925] (-475.321) * (-476.856) (-475.412) [-481.206] (-475.712) -- 0:00:09
337000 -- (-476.496) (-475.231) [-477.801] (-475.362) * (-480.530) (-475.326) (-475.202) [-479.351] -- 0:00:09
337500 -- (-476.515) (-474.817) (-475.663) [-477.069] * (-478.292) [-476.406] (-477.321) (-483.230) -- 0:00:09
338000 -- (-478.076) (-474.728) [-478.067] (-475.256) * [-477.055] (-475.770) (-476.012) (-482.504) -- 0:00:09
338500 -- [-478.694] (-475.915) (-477.757) (-477.620) * (-475.848) [-476.227] (-475.206) (-480.056) -- 0:00:09
339000 -- (-480.144) (-479.567) [-475.739] (-476.236) * (-475.355) (-474.805) [-474.978] (-475.005) -- 0:00:09
339500 -- (-478.237) (-479.214) [-478.003] (-476.751) * (-479.100) (-477.188) (-476.486) [-477.065] -- 0:00:09
340000 -- [-474.271] (-475.047) (-476.244) (-475.882) * (-474.794) (-476.392) (-475.999) [-476.025] -- 0:00:09
Average standard deviation of split frequencies: 0.015221
340500 -- (-476.282) (-477.339) [-475.213] (-477.228) * (-476.121) [-474.615] (-478.577) (-476.548) -- 0:00:09
341000 -- (-476.119) [-475.831] (-483.141) (-476.051) * (-477.893) (-477.749) (-476.958) [-475.391] -- 0:00:09
341500 -- [-480.879] (-476.238) (-482.049) (-475.369) * (-475.421) (-475.399) (-478.967) [-475.575] -- 0:00:09
342000 -- (-477.285) (-474.988) [-477.206] (-476.984) * (-477.030) (-475.729) [-476.966] (-481.072) -- 0:00:09
342500 -- (-476.078) (-475.157) [-476.025] (-475.663) * [-475.346] (-476.794) (-477.159) (-478.621) -- 0:00:09
343000 -- (-478.576) (-478.551) (-476.011) [-474.918] * [-475.013] (-476.474) (-474.401) (-475.014) -- 0:00:09
343500 -- (-477.698) [-475.038] (-475.305) (-475.768) * (-476.511) (-475.713) (-480.989) [-475.236] -- 0:00:09
344000 -- (-475.741) (-479.733) [-476.029] (-478.636) * (-475.585) (-478.475) (-475.664) [-475.687] -- 0:00:09
344500 -- [-474.746] (-478.241) (-476.918) (-477.105) * (-476.788) [-477.899] (-478.278) (-480.795) -- 0:00:09
345000 -- (-474.244) (-478.853) (-477.559) [-476.641] * [-476.455] (-475.989) (-480.765) (-476.472) -- 0:00:09
Average standard deviation of split frequencies: 0.015067
345500 -- [-475.780] (-476.013) (-477.788) (-475.877) * (-477.979) (-477.410) (-481.093) [-476.395] -- 0:00:09
346000 -- (-476.556) [-476.381] (-476.526) (-475.755) * (-478.059) (-475.555) [-479.352] (-476.865) -- 0:00:09
346500 -- (-477.625) (-475.385) [-480.490] (-476.935) * (-474.709) (-476.461) [-474.947] (-475.544) -- 0:00:09
347000 -- (-477.099) [-476.468] (-474.778) (-478.206) * [-474.806] (-474.958) (-478.094) (-475.591) -- 0:00:09
347500 -- (-475.837) (-481.690) [-474.604] (-475.273) * [-474.868] (-476.023) (-477.489) (-477.835) -- 0:00:09
348000 -- (-476.545) [-476.821] (-476.682) (-476.482) * [-474.819] (-476.796) (-476.224) (-478.902) -- 0:00:09
348500 -- (-479.386) [-476.022] (-475.900) (-479.794) * (-475.186) (-477.753) [-475.390] (-475.407) -- 0:00:09
349000 -- (-483.773) (-478.396) (-478.164) [-475.617] * [-476.348] (-477.666) (-475.976) (-476.648) -- 0:00:09
349500 -- (-476.655) (-477.004) (-474.891) [-475.056] * (-474.807) [-479.112] (-475.429) (-475.265) -- 0:00:09
350000 -- (-475.132) (-474.820) [-475.377] (-476.736) * (-475.389) (-475.524) (-478.303) [-474.241] -- 0:00:09
Average standard deviation of split frequencies: 0.015964
350500 -- (-475.442) (-474.877) (-476.945) [-476.165] * (-477.115) (-477.481) [-476.096] (-476.407) -- 0:00:08
351000 -- (-475.211) (-477.175) (-476.613) [-475.751] * (-475.536) (-477.078) [-474.704] (-475.326) -- 0:00:08
351500 -- (-474.886) (-478.709) [-476.756] (-477.665) * (-476.399) (-475.356) [-475.569] (-476.093) -- 0:00:08
352000 -- [-477.956] (-477.406) (-475.544) (-479.634) * (-475.083) [-478.935] (-475.036) (-474.421) -- 0:00:08
352500 -- [-477.253] (-478.154) (-476.722) (-476.726) * (-475.393) [-474.163] (-474.478) (-476.447) -- 0:00:08
353000 -- (-475.262) (-478.408) (-474.974) [-476.311] * (-475.119) (-477.556) (-478.080) [-474.906] -- 0:00:08
353500 -- (-476.733) [-477.400] (-474.844) (-477.586) * (-477.100) (-477.671) (-484.007) [-474.963] -- 0:00:08
354000 -- (-477.004) (-476.791) [-481.897] (-475.771) * (-480.108) (-477.361) [-477.318] (-479.383) -- 0:00:08
354500 -- (-474.499) (-481.900) (-478.636) [-477.956] * (-474.974) (-478.338) [-477.308] (-479.440) -- 0:00:08
355000 -- (-476.859) (-478.706) [-477.532] (-482.053) * (-475.427) (-475.260) (-476.584) [-480.591] -- 0:00:08
Average standard deviation of split frequencies: 0.015476
355500 -- (-474.972) (-476.934) (-476.136) [-477.230] * [-477.747] (-477.098) (-475.865) (-477.336) -- 0:00:08
356000 -- [-481.512] (-475.730) (-478.066) (-475.957) * (-476.034) [-477.751] (-475.416) (-476.822) -- 0:00:08
356500 -- [-477.596] (-477.714) (-476.670) (-475.991) * (-482.480) (-475.375) [-476.572] (-475.799) -- 0:00:08
357000 -- (-476.244) (-474.250) [-477.105] (-475.076) * (-477.155) (-479.526) [-475.146] (-475.476) -- 0:00:08
357500 -- (-479.514) (-479.308) (-476.543) [-475.133] * (-477.099) (-478.344) [-476.133] (-474.923) -- 0:00:08
358000 -- (-480.945) (-478.041) (-479.826) [-479.415] * (-475.105) [-476.801] (-475.248) (-479.218) -- 0:00:08
358500 -- (-475.607) (-477.764) [-475.665] (-476.313) * (-475.148) [-475.815] (-474.453) (-475.967) -- 0:00:08
359000 -- (-478.160) (-475.511) (-475.322) [-476.650] * (-479.325) [-476.562] (-476.050) (-480.690) -- 0:00:08
359500 -- (-477.934) (-481.079) (-476.192) [-476.264] * [-479.657] (-476.611) (-482.547) (-477.493) -- 0:00:08
360000 -- (-481.670) (-480.093) [-475.095] (-476.313) * (-476.489) (-476.562) (-477.520) [-482.002] -- 0:00:08
Average standard deviation of split frequencies: 0.015521
360500 -- (-481.485) (-481.026) (-475.504) [-476.488] * (-481.891) (-475.510) (-475.905) [-478.843] -- 0:00:08
361000 -- (-481.981) (-476.847) (-478.590) [-475.964] * [-479.974] (-476.837) (-474.590) (-477.970) -- 0:00:08
361500 -- [-477.938] (-474.432) (-475.283) (-476.540) * (-475.402) [-476.739] (-474.482) (-480.119) -- 0:00:08
362000 -- [-477.150] (-475.144) (-479.034) (-476.836) * (-475.483) (-480.272) [-476.198] (-477.554) -- 0:00:08
362500 -- [-476.838] (-478.875) (-476.170) (-476.849) * (-478.068) (-479.447) [-477.988] (-475.191) -- 0:00:08
363000 -- (-476.238) [-475.644] (-476.282) (-477.917) * [-475.418] (-481.655) (-479.193) (-476.314) -- 0:00:08
363500 -- (-478.567) [-477.977] (-477.027) (-475.434) * [-476.035] (-475.244) (-478.036) (-474.829) -- 0:00:08
364000 -- (-475.286) (-476.252) (-480.402) [-475.514] * (-475.042) [-475.768] (-480.193) (-477.775) -- 0:00:08
364500 -- (-476.567) (-474.489) [-476.401] (-475.194) * [-475.363] (-483.335) (-477.753) (-477.922) -- 0:00:08
365000 -- (-479.196) (-475.017) (-475.756) [-476.778] * [-476.555] (-477.137) (-476.329) (-478.536) -- 0:00:08
Average standard deviation of split frequencies: 0.015617
365500 -- (-476.959) [-474.251] (-478.186) (-476.711) * (-475.209) (-476.304) [-476.361] (-477.059) -- 0:00:08
366000 -- (-478.906) (-475.828) [-474.683] (-478.294) * (-476.351) (-476.054) (-480.463) [-475.694] -- 0:00:08
366500 -- (-479.411) [-475.353] (-476.395) (-479.211) * (-475.946) (-478.301) (-479.042) [-475.771] -- 0:00:08
367000 -- [-476.827] (-475.246) (-478.305) (-480.341) * (-476.643) (-476.308) (-483.359) [-475.352] -- 0:00:07
367500 -- (-477.219) [-476.825] (-476.090) (-480.542) * (-479.992) (-475.232) (-476.755) [-476.998] -- 0:00:07
368000 -- (-477.910) (-476.301) [-478.412] (-481.668) * (-478.098) (-474.798) (-480.149) [-474.782] -- 0:00:07
368500 -- (-479.820) (-477.041) [-475.462] (-475.736) * (-477.834) (-476.668) (-479.196) [-475.880] -- 0:00:07
369000 -- (-474.794) [-476.934] (-475.674) (-474.496) * (-477.222) (-475.385) [-475.527] (-477.147) -- 0:00:07
369500 -- (-475.984) [-480.230] (-477.179) (-475.374) * (-476.835) (-474.756) (-475.230) [-475.912] -- 0:00:07
370000 -- (-475.651) (-476.828) (-476.184) [-475.895] * (-475.796) (-481.119) (-474.372) [-475.282] -- 0:00:07
Average standard deviation of split frequencies: 0.014864
370500 -- (-474.049) (-478.591) [-480.058] (-474.920) * (-475.959) [-476.485] (-474.781) (-475.916) -- 0:00:07
371000 -- (-475.738) (-477.279) (-474.462) [-474.575] * (-476.512) (-476.369) [-475.332] (-476.761) -- 0:00:07
371500 -- (-477.484) (-476.000) [-475.773] (-474.449) * (-477.145) (-477.874) [-475.541] (-474.533) -- 0:00:07
372000 -- [-477.252] (-475.519) (-476.527) (-475.245) * [-476.570] (-475.199) (-476.915) (-474.653) -- 0:00:07
372500 -- (-476.971) (-477.425) [-477.658] (-476.294) * [-476.915] (-474.471) (-475.748) (-477.838) -- 0:00:07
373000 -- [-479.844] (-477.220) (-475.861) (-475.031) * (-477.781) (-475.359) [-474.079] (-480.132) -- 0:00:07
373500 -- [-475.559] (-476.024) (-478.740) (-476.517) * [-481.236] (-476.248) (-474.236) (-475.929) -- 0:00:07
374000 -- (-476.066) (-479.335) (-480.855) [-478.229] * (-476.494) [-476.937] (-475.051) (-480.432) -- 0:00:07
374500 -- (-477.947) [-475.707] (-476.317) (-479.294) * (-474.747) [-477.838] (-475.693) (-474.574) -- 0:00:07
375000 -- [-476.938] (-477.396) (-475.563) (-479.490) * (-476.813) (-479.450) (-476.946) [-477.413] -- 0:00:07
Average standard deviation of split frequencies: 0.015750
375500 -- (-476.216) (-476.315) (-475.335) [-478.847] * [-477.676] (-478.691) (-488.538) (-475.617) -- 0:00:07
376000 -- (-475.125) [-474.342] (-477.104) (-482.001) * (-477.307) (-476.728) [-479.203] (-477.659) -- 0:00:07
376500 -- (-475.493) (-481.743) (-477.686) [-478.746] * (-478.524) [-479.855] (-477.053) (-476.632) -- 0:00:07
377000 -- (-475.510) [-482.592] (-475.842) (-476.409) * (-476.943) (-475.702) (-475.145) [-483.205] -- 0:00:07
377500 -- [-477.309] (-481.969) (-474.470) (-479.455) * (-478.665) [-475.205] (-476.601) (-483.160) -- 0:00:07
378000 -- (-476.267) [-475.838] (-477.800) (-478.315) * [-478.614] (-475.709) (-476.239) (-479.059) -- 0:00:07
378500 -- (-474.819) (-477.160) (-478.754) [-479.847] * (-475.910) (-477.318) [-476.240] (-474.360) -- 0:00:07
379000 -- (-479.644) (-475.281) [-477.965] (-478.113) * [-476.176] (-474.157) (-475.998) (-474.146) -- 0:00:07
379500 -- [-480.268] (-475.717) (-476.547) (-475.132) * (-476.681) (-475.707) [-475.503] (-476.199) -- 0:00:07
380000 -- [-475.221] (-476.979) (-475.373) (-478.652) * (-475.873) (-480.836) (-476.194) [-475.825] -- 0:00:07
Average standard deviation of split frequencies: 0.015867
380500 -- (-477.733) (-474.801) [-476.223] (-476.674) * (-476.382) (-479.761) [-476.685] (-474.851) -- 0:00:07
381000 -- [-479.701] (-475.282) (-475.869) (-481.877) * (-475.485) [-475.315] (-475.437) (-482.315) -- 0:00:07
381500 -- (-476.107) (-476.050) (-477.386) [-478.815] * (-474.938) [-475.259] (-476.310) (-478.460) -- 0:00:07
382000 -- (-477.121) (-478.261) [-479.026] (-477.240) * [-477.073] (-476.596) (-474.817) (-475.918) -- 0:00:07
382500 -- (-478.386) (-476.705) [-474.534] (-474.925) * [-475.625] (-477.078) (-475.836) (-477.353) -- 0:00:07
383000 -- (-474.964) (-474.611) [-475.143] (-477.871) * (-479.864) [-475.521] (-479.033) (-479.991) -- 0:00:07
383500 -- (-477.948) [-475.283] (-481.440) (-476.238) * [-477.088] (-482.771) (-476.080) (-475.986) -- 0:00:06
384000 -- (-476.307) (-476.666) (-477.927) [-476.004] * (-477.676) [-476.945] (-479.053) (-475.893) -- 0:00:06
384500 -- (-474.261) [-475.076] (-475.398) (-476.825) * [-477.047] (-474.823) (-478.513) (-477.216) -- 0:00:06
385000 -- [-475.708] (-478.297) (-477.977) (-474.427) * [-476.266] (-475.802) (-475.775) (-475.052) -- 0:00:06
Average standard deviation of split frequencies: 0.014583
385500 -- [-475.907] (-476.534) (-476.660) (-474.870) * [-481.494] (-477.048) (-477.149) (-475.072) -- 0:00:06
386000 -- (-476.430) (-478.111) [-475.190] (-475.541) * (-477.650) (-475.458) (-476.541) [-474.872] -- 0:00:06
386500 -- (-475.339) (-478.479) [-475.814] (-480.638) * (-475.196) (-474.848) (-476.042) [-476.808] -- 0:00:06
387000 -- (-476.459) (-481.817) (-475.767) [-474.817] * (-475.226) [-475.559] (-479.724) (-476.499) -- 0:00:06
387500 -- [-475.451] (-477.877) (-481.721) (-476.805) * [-476.792] (-476.410) (-474.655) (-474.643) -- 0:00:06
388000 -- (-478.226) (-475.428) [-479.838] (-476.177) * (-478.475) [-477.200] (-477.177) (-474.941) -- 0:00:06
388500 -- (-477.278) [-475.426] (-478.748) (-478.469) * [-475.534] (-481.093) (-479.368) (-479.120) -- 0:00:06
389000 -- [-475.588] (-474.990) (-478.616) (-474.987) * (-478.862) (-480.015) [-476.640] (-478.271) -- 0:00:06
389500 -- (-477.860) (-475.373) (-476.949) [-480.931] * (-478.591) [-478.085] (-477.546) (-475.511) -- 0:00:06
390000 -- (-475.883) [-476.157] (-477.624) (-476.173) * (-477.775) (-478.706) [-475.691] (-479.575) -- 0:00:06
Average standard deviation of split frequencies: 0.014267
390500 -- (-478.107) [-475.924] (-475.418) (-478.161) * (-476.563) [-476.988] (-476.112) (-474.723) -- 0:00:06
391000 -- (-478.365) [-476.102] (-476.219) (-475.920) * [-478.019] (-480.863) (-476.448) (-475.045) -- 0:00:06
391500 -- [-475.298] (-474.860) (-478.108) (-476.234) * [-478.267] (-475.992) (-476.012) (-475.070) -- 0:00:06
392000 -- (-476.399) (-476.545) (-479.186) [-476.284] * [-476.335] (-475.038) (-475.695) (-476.274) -- 0:00:06
392500 -- [-476.261] (-479.391) (-480.004) (-476.784) * (-476.956) [-480.718] (-478.311) (-476.586) -- 0:00:06
393000 -- [-475.622] (-480.247) (-475.437) (-475.326) * (-478.682) (-479.478) (-478.990) [-479.290] -- 0:00:06
393500 -- (-476.033) (-475.578) (-474.623) [-475.714] * (-476.921) (-479.605) [-475.023] (-476.024) -- 0:00:06
394000 -- (-474.332) [-478.476] (-476.744) (-476.804) * (-475.369) [-481.350] (-475.168) (-479.723) -- 0:00:06
394500 -- (-476.603) (-476.513) (-475.789) [-474.348] * [-475.892] (-475.781) (-476.030) (-478.434) -- 0:00:06
395000 -- (-474.476) (-475.453) [-475.841] (-476.386) * (-475.733) (-475.302) [-476.526] (-476.913) -- 0:00:06
Average standard deviation of split frequencies: 0.015685
395500 -- (-480.558) (-476.771) [-474.793] (-475.321) * (-478.571) (-476.745) (-479.597) [-474.820] -- 0:00:06
396000 -- (-479.203) [-475.468] (-474.612) (-477.567) * (-475.077) (-475.710) [-478.175] (-474.306) -- 0:00:06
396500 -- (-475.587) (-477.104) (-476.528) [-476.694] * [-476.106] (-476.130) (-474.790) (-474.948) -- 0:00:06
397000 -- (-475.387) (-476.006) (-476.213) [-477.904] * (-476.728) (-477.117) [-478.786] (-476.889) -- 0:00:06
397500 -- (-475.365) (-476.439) [-481.565] (-474.489) * (-474.982) (-476.201) [-475.686] (-474.749) -- 0:00:06
398000 -- (-475.314) (-476.002) (-476.738) [-477.776] * [-475.224] (-474.878) (-476.178) (-475.909) -- 0:00:06
398500 -- [-476.847] (-480.335) (-479.579) (-475.273) * (-474.427) [-477.542] (-475.433) (-477.341) -- 0:00:06
399000 -- [-478.691] (-475.701) (-480.779) (-474.874) * (-477.888) (-482.108) [-480.041] (-477.885) -- 0:00:06
399500 -- (-475.408) (-476.678) (-475.029) [-476.338] * [-475.173] (-480.082) (-474.542) (-475.443) -- 0:00:06
400000 -- (-475.719) (-475.457) (-476.451) [-476.041] * [-475.127] (-476.719) (-476.231) (-475.938) -- 0:00:06
Average standard deviation of split frequencies: 0.016619
400500 -- (-477.538) (-475.086) (-479.935) [-476.715] * (-478.290) (-478.599) (-475.465) [-478.616] -- 0:00:05
401000 -- [-475.453] (-476.445) (-475.915) (-480.281) * (-477.249) [-477.072] (-478.802) (-480.206) -- 0:00:05
401500 -- (-475.251) (-479.141) [-476.109] (-476.525) * (-476.032) (-475.545) [-474.987] (-474.774) -- 0:00:05
402000 -- (-479.163) (-477.673) [-475.971] (-476.434) * (-477.006) (-475.433) [-475.429] (-476.193) -- 0:00:05
402500 -- (-476.595) [-475.237] (-477.396) (-477.132) * (-475.875) [-475.480] (-477.446) (-476.383) -- 0:00:05
403000 -- (-479.333) [-475.933] (-475.385) (-476.551) * (-475.677) [-477.330] (-475.994) (-476.299) -- 0:00:05
403500 -- [-476.880] (-475.392) (-476.370) (-476.173) * [-474.684] (-475.586) (-475.695) (-478.439) -- 0:00:05
404000 -- (-476.288) (-475.879) [-474.962] (-477.637) * (-476.589) [-477.202] (-475.626) (-475.434) -- 0:00:05
404500 -- (-476.651) [-478.321] (-474.564) (-477.165) * (-476.273) (-477.823) (-474.373) [-475.690] -- 0:00:05
405000 -- (-478.827) [-476.474] (-475.612) (-474.719) * (-476.862) (-479.577) [-474.956] (-477.799) -- 0:00:05
Average standard deviation of split frequencies: 0.015777
405500 -- (-479.597) (-475.530) [-476.298] (-476.882) * [-476.298] (-477.060) (-476.226) (-475.685) -- 0:00:05
406000 -- (-477.084) [-474.699] (-474.993) (-478.065) * (-480.645) [-475.003] (-477.507) (-477.334) -- 0:00:05
406500 -- (-475.966) [-481.337] (-474.965) (-476.022) * [-477.012] (-476.014) (-476.490) (-478.931) -- 0:00:05
407000 -- (-475.462) (-476.312) [-475.748] (-476.645) * (-475.345) (-479.103) (-479.059) [-477.678] -- 0:00:05
407500 -- [-474.942] (-476.095) (-474.732) (-476.718) * [-480.705] (-475.684) (-479.254) (-477.107) -- 0:00:05
408000 -- (-477.487) (-475.346) (-475.494) [-476.397] * (-476.278) (-478.641) [-478.842] (-478.163) -- 0:00:05
408500 -- (-479.464) (-475.852) [-474.569] (-476.181) * [-475.342] (-478.892) (-478.631) (-476.391) -- 0:00:05
409000 -- [-476.632] (-478.439) (-476.425) (-481.460) * (-476.760) [-478.823] (-476.448) (-479.994) -- 0:00:05
409500 -- (-474.720) [-475.476] (-479.374) (-475.740) * (-475.503) [-477.128] (-476.515) (-482.890) -- 0:00:05
410000 -- (-475.569) (-480.326) (-479.316) [-475.764] * [-475.182] (-475.841) (-480.046) (-477.441) -- 0:00:05
Average standard deviation of split frequencies: 0.015281
410500 -- (-476.861) (-476.901) [-476.454] (-479.517) * [-475.150] (-475.547) (-475.012) (-477.228) -- 0:00:05
411000 -- (-476.244) [-474.421] (-480.416) (-474.745) * (-474.417) [-476.908] (-476.219) (-477.153) -- 0:00:05
411500 -- (-481.758) [-476.082] (-476.253) (-479.101) * (-475.701) [-475.606] (-476.532) (-478.701) -- 0:00:05
412000 -- (-474.900) [-475.018] (-476.350) (-474.983) * (-474.643) (-477.169) [-474.653] (-476.671) -- 0:00:05
412500 -- (-475.414) (-478.372) [-475.942] (-478.517) * (-476.606) (-478.601) (-475.673) [-477.145] -- 0:00:05
413000 -- (-478.094) [-475.477] (-475.569) (-476.248) * (-474.732) (-476.752) [-477.469] (-476.341) -- 0:00:05
413500 -- (-478.015) (-486.499) (-475.959) [-478.616] * (-476.679) [-475.815] (-476.115) (-476.402) -- 0:00:05
414000 -- [-475.644] (-479.487) (-479.007) (-479.696) * (-479.587) (-479.388) (-475.361) [-475.313] -- 0:00:05
414500 -- [-477.821] (-476.568) (-475.703) (-475.094) * (-476.254) (-477.837) (-476.316) [-475.123] -- 0:00:05
415000 -- (-475.348) (-478.780) [-475.104] (-474.867) * (-476.132) (-474.771) (-478.016) [-478.097] -- 0:00:05
Average standard deviation of split frequencies: 0.014873
415500 -- [-478.340] (-477.603) (-479.159) (-477.609) * (-477.241) (-474.561) (-475.703) [-474.692] -- 0:00:05
416000 -- [-481.780] (-475.748) (-483.197) (-474.707) * (-475.167) (-475.731) [-478.014] (-474.891) -- 0:00:05
416500 -- (-475.598) [-476.096] (-481.836) (-475.978) * (-475.026) (-475.336) (-476.545) [-477.526] -- 0:00:05
417000 -- (-478.222) (-477.149) [-476.527] (-474.589) * [-475.898] (-476.032) (-477.263) (-479.653) -- 0:00:04
417500 -- (-475.955) (-478.307) (-477.166) [-474.347] * (-477.726) [-475.639] (-477.056) (-476.011) -- 0:00:04
418000 -- (-480.110) (-477.342) (-479.591) [-475.916] * (-479.405) [-477.749] (-475.922) (-475.779) -- 0:00:04
418500 -- (-478.937) (-474.387) (-478.492) [-476.662] * (-477.703) (-475.929) (-474.508) [-478.585] -- 0:00:04
419000 -- (-474.881) (-475.293) [-474.954] (-478.033) * [-477.766] (-474.997) (-476.048) (-478.892) -- 0:00:04
419500 -- (-483.493) [-475.588] (-480.852) (-476.562) * [-479.678] (-475.777) (-475.598) (-478.013) -- 0:00:04
420000 -- (-484.350) (-476.698) [-475.805] (-477.210) * [-478.857] (-475.121) (-476.644) (-476.057) -- 0:00:04
Average standard deviation of split frequencies: 0.014498
420500 -- (-475.646) [-476.766] (-476.784) (-478.077) * (-477.219) (-475.082) [-474.604] (-475.030) -- 0:00:04
421000 -- [-474.543] (-476.182) (-482.896) (-479.435) * (-475.350) (-475.301) (-476.658) [-480.365] -- 0:00:04
421500 -- (-474.773) (-477.670) [-476.506] (-478.302) * (-476.066) (-477.900) [-478.661] (-477.292) -- 0:00:04
422000 -- [-475.142] (-474.592) (-477.123) (-480.886) * (-475.278) (-476.878) (-475.077) [-480.473] -- 0:00:04
422500 -- [-479.967] (-474.088) (-478.207) (-480.091) * [-479.466] (-480.201) (-478.202) (-478.537) -- 0:00:04
423000 -- (-478.678) (-474.361) (-475.715) [-476.129] * (-476.539) (-475.968) [-476.841] (-478.205) -- 0:00:04
423500 -- (-476.542) (-479.429) [-475.509] (-479.055) * [-476.249] (-478.122) (-474.983) (-476.199) -- 0:00:04
424000 -- (-477.285) (-475.087) [-475.952] (-479.125) * [-475.742] (-475.672) (-475.060) (-479.827) -- 0:00:04
424500 -- (-477.033) [-475.815] (-475.585) (-475.798) * (-478.107) (-476.703) [-474.213] (-477.752) -- 0:00:04
425000 -- (-474.548) (-476.145) (-474.902) [-475.691] * [-476.203] (-477.458) (-476.768) (-478.685) -- 0:00:04
Average standard deviation of split frequencies: 0.014971
425500 -- (-475.201) (-479.017) [-475.001] (-476.793) * [-474.183] (-481.788) (-475.909) (-477.684) -- 0:00:04
426000 -- (-475.104) (-476.791) [-478.516] (-478.312) * [-476.585] (-477.279) (-475.058) (-481.744) -- 0:00:04
426500 -- [-478.603] (-476.828) (-476.243) (-476.687) * (-478.894) [-474.662] (-475.064) (-480.968) -- 0:00:04
427000 -- (-480.987) (-479.372) [-475.087] (-475.111) * (-478.541) (-476.364) (-479.046) [-476.661] -- 0:00:04
427500 -- (-477.991) (-477.283) (-477.909) [-474.316] * [-477.736] (-475.927) (-478.931) (-477.141) -- 0:00:04
428000 -- (-475.493) (-476.697) [-478.272] (-475.941) * (-475.496) (-475.820) (-475.322) [-476.796] -- 0:00:04
428500 -- (-476.784) (-476.992) [-476.163] (-475.507) * [-474.904] (-476.665) (-477.738) (-481.759) -- 0:00:04
429000 -- (-479.040) (-476.577) [-479.108] (-476.936) * (-475.675) (-478.220) (-475.540) [-474.972] -- 0:00:04
429500 -- (-482.336) (-475.811) (-475.602) [-477.239] * (-474.380) [-475.006] (-481.028) (-475.858) -- 0:00:04
430000 -- (-478.372) (-477.664) [-475.906] (-479.178) * (-476.042) [-475.700] (-479.687) (-474.455) -- 0:00:04
Average standard deviation of split frequencies: 0.014101
430500 -- (-478.291) [-474.050] (-475.260) (-477.763) * (-477.867) (-477.914) (-475.352) [-475.537] -- 0:00:04
431000 -- (-476.475) [-477.216] (-475.709) (-476.521) * (-479.813) (-476.013) (-475.049) [-476.364] -- 0:00:04
431500 -- (-481.031) (-476.329) (-478.996) [-474.614] * (-479.514) (-476.037) [-474.974] (-476.966) -- 0:00:04
432000 -- (-477.148) [-480.560] (-476.279) (-474.659) * [-478.127] (-474.886) (-479.746) (-477.152) -- 0:00:04
432500 -- (-476.987) (-481.537) [-475.987] (-475.043) * [-477.478] (-479.331) (-477.221) (-475.806) -- 0:00:04
433000 -- [-475.984] (-481.312) (-478.011) (-477.031) * (-477.658) (-477.607) [-477.702] (-474.911) -- 0:00:04
433500 -- (-475.558) [-477.767] (-475.556) (-480.677) * (-477.202) (-477.296) (-484.218) [-477.188] -- 0:00:03
434000 -- (-475.857) (-475.340) (-481.058) [-476.728] * (-475.210) (-475.941) (-474.979) [-478.073] -- 0:00:03
434500 -- (-476.019) (-476.272) (-481.333) [-475.407] * (-475.056) (-474.917) [-476.157] (-479.468) -- 0:00:03
435000 -- (-476.435) (-475.405) [-478.045] (-474.785) * [-475.250] (-476.093) (-476.297) (-478.039) -- 0:00:03
Average standard deviation of split frequencies: 0.013992
435500 -- (-480.121) (-475.070) (-475.138) [-475.859] * (-475.032) (-479.106) [-475.857] (-476.448) -- 0:00:03
436000 -- (-478.467) (-474.783) (-474.866) [-475.527] * [-475.118] (-477.843) (-475.670) (-476.476) -- 0:00:03
436500 -- [-474.748] (-477.280) (-476.305) (-476.463) * (-476.122) (-476.879) (-477.064) [-477.849] -- 0:00:03
437000 -- [-477.660] (-478.061) (-478.639) (-477.453) * (-479.889) (-474.854) [-475.247] (-481.161) -- 0:00:03
437500 -- (-479.810) (-477.567) (-476.505) [-475.653] * (-475.713) [-475.411] (-478.550) (-476.668) -- 0:00:03
438000 -- (-476.384) (-479.300) [-478.222] (-477.768) * [-475.386] (-474.790) (-476.484) (-476.125) -- 0:00:03
438500 -- (-483.805) (-477.329) (-480.969) [-474.602] * (-475.665) (-476.669) (-475.842) [-475.925] -- 0:00:03
439000 -- [-475.849] (-475.032) (-476.261) (-474.927) * (-475.445) [-475.606] (-477.878) (-475.046) -- 0:00:03
439500 -- (-475.123) [-474.997] (-474.170) (-474.291) * (-476.222) [-477.299] (-477.611) (-478.895) -- 0:00:03
440000 -- (-475.829) [-476.997] (-474.765) (-476.474) * [-477.193] (-480.784) (-478.088) (-477.037) -- 0:00:03
Average standard deviation of split frequencies: 0.014599
440500 -- [-477.747] (-475.635) (-474.668) (-475.259) * [-475.353] (-477.896) (-476.350) (-478.362) -- 0:00:03
441000 -- (-476.669) [-475.358] (-475.400) (-477.038) * [-476.122] (-475.069) (-476.714) (-475.653) -- 0:00:03
441500 -- (-477.386) (-479.952) (-474.846) [-475.090] * (-474.931) (-475.013) (-476.317) [-475.810] -- 0:00:03
442000 -- (-474.706) [-475.673] (-481.637) (-475.754) * (-474.674) (-482.660) [-474.761] (-475.133) -- 0:00:03
442500 -- [-476.419] (-481.672) (-476.802) (-478.059) * (-480.511) [-475.929] (-475.867) (-474.906) -- 0:00:03
443000 -- [-475.281] (-474.767) (-477.105) (-476.678) * (-476.658) (-475.555) (-475.827) [-475.851] -- 0:00:03
443500 -- (-479.320) [-477.472] (-476.429) (-478.478) * (-475.172) [-475.985] (-478.498) (-475.945) -- 0:00:03
444000 -- (-480.859) (-475.440) (-477.236) [-475.538] * (-475.782) (-475.270) [-478.614] (-476.558) -- 0:00:03
444500 -- (-478.290) (-479.255) [-476.932] (-474.973) * [-476.096] (-476.401) (-476.771) (-478.076) -- 0:00:03
445000 -- (-480.352) [-474.213] (-474.355) (-476.045) * [-478.643] (-477.294) (-478.269) (-476.310) -- 0:00:03
Average standard deviation of split frequencies: 0.014797
445500 -- [-477.207] (-476.254) (-475.988) (-476.029) * [-475.555] (-475.326) (-477.058) (-480.604) -- 0:00:03
446000 -- (-476.458) (-477.135) [-476.602] (-474.766) * (-477.572) (-477.913) (-479.123) [-477.903] -- 0:00:03
446500 -- (-478.243) [-476.270] (-476.539) (-475.019) * [-476.432] (-476.909) (-480.432) (-475.439) -- 0:00:03
447000 -- (-477.755) [-475.132] (-476.283) (-475.348) * (-475.386) (-477.133) [-476.620] (-477.365) -- 0:00:03
447500 -- (-476.334) [-477.737] (-476.154) (-478.150) * (-478.789) (-477.992) (-477.625) [-480.786] -- 0:00:03
448000 -- (-476.964) (-475.110) (-474.981) [-477.218] * (-476.484) [-474.997] (-475.459) (-478.211) -- 0:00:03
448500 -- (-475.650) (-478.322) [-475.195] (-476.146) * (-476.705) (-477.203) [-478.347] (-479.231) -- 0:00:03
449000 -- (-475.187) [-476.971] (-474.826) (-475.645) * (-478.463) (-479.277) [-479.190] (-476.955) -- 0:00:03
449500 -- (-475.960) (-480.461) [-480.986] (-475.249) * (-479.177) [-477.818] (-478.972) (-480.141) -- 0:00:03
450000 -- (-477.377) [-474.985] (-477.554) (-478.998) * [-479.254] (-477.477) (-476.526) (-477.846) -- 0:00:03
Average standard deviation of split frequencies: 0.014152
450500 -- (-476.009) (-476.567) (-478.652) [-480.472] * (-479.375) (-477.479) (-475.844) [-475.893] -- 0:00:02
451000 -- (-475.417) (-479.018) (-476.884) [-475.115] * (-475.875) (-477.063) [-476.528] (-479.749) -- 0:00:02
451500 -- (-477.793) [-474.833] (-477.650) (-480.383) * (-475.954) [-477.766] (-474.321) (-480.624) -- 0:00:02
452000 -- (-478.447) (-474.995) [-477.078] (-476.897) * [-475.167] (-477.690) (-476.997) (-477.435) -- 0:00:02
452500 -- (-477.748) (-478.456) (-480.900) [-474.758] * (-475.769) [-479.851] (-475.580) (-476.148) -- 0:00:02
453000 -- (-475.575) [-475.608] (-476.349) (-474.980) * (-478.568) (-477.016) [-474.355] (-479.800) -- 0:00:02
453500 -- [-474.670] (-475.578) (-475.501) (-476.961) * (-478.631) (-477.033) (-477.406) [-474.629] -- 0:00:02
454000 -- [-477.165] (-477.015) (-480.448) (-475.277) * (-479.449) (-474.725) [-475.991] (-478.553) -- 0:00:02
454500 -- [-476.577] (-478.916) (-476.691) (-474.891) * (-476.365) [-476.388] (-477.178) (-481.877) -- 0:00:02
455000 -- [-475.910] (-477.628) (-477.997) (-475.421) * [-474.757] (-475.395) (-477.916) (-482.898) -- 0:00:02
Average standard deviation of split frequencies: 0.014186
455500 -- (-481.028) (-480.139) [-484.241] (-474.513) * (-476.282) (-477.368) (-475.631) [-478.789] -- 0:00:02
456000 -- [-476.197] (-476.094) (-478.601) (-476.177) * [-477.679] (-476.381) (-480.044) (-478.905) -- 0:00:02
456500 -- (-477.060) (-478.733) [-478.516] (-474.247) * (-476.814) (-475.154) (-479.723) [-479.244] -- 0:00:02
457000 -- (-475.309) (-481.198) (-475.250) [-476.313] * (-475.481) (-475.154) (-476.746) [-477.469] -- 0:00:02
457500 -- (-478.825) [-477.436] (-476.566) (-476.059) * [-474.461] (-477.019) (-477.227) (-476.144) -- 0:00:02
458000 -- (-477.123) (-476.099) (-477.653) [-475.239] * (-474.804) (-478.098) [-477.426] (-477.767) -- 0:00:02
458500 -- (-475.162) [-476.316] (-476.043) (-475.611) * [-476.456] (-474.795) (-478.067) (-477.299) -- 0:00:02
459000 -- (-474.904) (-476.609) (-474.718) [-476.878] * (-475.082) (-479.015) [-478.478] (-475.539) -- 0:00:02
459500 -- (-477.158) (-475.829) [-475.060] (-478.458) * (-479.052) (-476.976) (-477.993) [-475.424] -- 0:00:02
460000 -- (-477.565) (-476.208) (-476.479) [-478.057] * (-476.212) [-476.483] (-479.376) (-477.660) -- 0:00:02
Average standard deviation of split frequencies: 0.014447
460500 -- (-478.286) [-475.664] (-476.353) (-476.339) * [-477.543] (-476.797) (-476.449) (-477.113) -- 0:00:02
461000 -- [-476.769] (-481.778) (-478.322) (-476.030) * [-482.405] (-477.354) (-475.412) (-479.787) -- 0:00:02
461500 -- [-475.410] (-480.650) (-474.184) (-476.137) * [-475.776] (-479.559) (-481.004) (-476.197) -- 0:00:02
462000 -- (-474.887) (-478.196) [-477.508] (-475.608) * (-474.470) (-476.431) (-481.985) [-476.956] -- 0:00:02
462500 -- [-475.007] (-474.495) (-475.928) (-477.539) * (-476.079) (-476.708) [-476.896] (-477.694) -- 0:00:02
463000 -- (-474.557) [-474.677] (-475.334) (-476.555) * (-476.951) [-475.667] (-476.977) (-475.587) -- 0:00:02
463500 -- (-476.898) [-474.743] (-476.317) (-475.622) * [-477.785] (-476.561) (-479.277) (-475.356) -- 0:00:02
464000 -- [-476.570] (-474.818) (-475.428) (-476.821) * [-475.300] (-475.031) (-478.583) (-477.353) -- 0:00:02
464500 -- (-476.444) [-474.575] (-478.284) (-476.262) * (-475.808) (-477.677) [-477.232] (-477.869) -- 0:00:02
465000 -- (-477.116) (-478.383) (-478.553) [-477.214] * (-475.934) (-475.275) (-476.389) [-476.588] -- 0:00:02
Average standard deviation of split frequencies: 0.014216
465500 -- (-477.361) [-475.420] (-475.925) (-475.286) * (-478.434) [-477.707] (-480.791) (-477.989) -- 0:00:02
466000 -- (-475.443) [-478.082] (-478.777) (-475.402) * (-476.840) [-476.342] (-476.592) (-478.818) -- 0:00:02
466500 -- (-475.665) (-477.941) (-478.107) [-480.179] * (-479.245) (-476.774) [-475.758] (-474.049) -- 0:00:02
467000 -- (-474.695) (-479.303) [-475.957] (-477.196) * (-477.063) (-476.346) [-475.162] (-478.284) -- 0:00:01
467500 -- [-475.716] (-475.575) (-475.652) (-475.187) * (-475.498) (-477.343) [-476.159] (-479.220) -- 0:00:01
468000 -- (-475.477) (-476.628) (-476.031) [-477.663] * (-474.879) (-483.836) [-475.228] (-477.257) -- 0:00:01
468500 -- (-475.038) [-475.090] (-475.260) (-474.787) * (-476.511) (-474.694) (-476.577) [-475.527] -- 0:00:01
469000 -- (-475.055) (-478.052) [-475.883] (-475.399) * (-475.351) (-475.882) (-476.683) [-475.920] -- 0:00:01
469500 -- (-475.920) (-477.280) (-475.871) [-477.067] * (-478.138) [-476.784] (-477.322) (-478.238) -- 0:00:01
470000 -- (-475.802) (-479.271) [-477.948] (-478.805) * (-477.024) [-479.097] (-478.949) (-476.457) -- 0:00:01
Average standard deviation of split frequencies: 0.013855
470500 -- (-477.204) [-475.616] (-477.004) (-475.728) * [-478.089] (-476.944) (-477.785) (-476.789) -- 0:00:01
471000 -- (-477.710) (-477.524) [-478.028] (-475.795) * [-478.629] (-475.670) (-476.029) (-474.874) -- 0:00:01
471500 -- [-477.719] (-479.851) (-483.061) (-474.508) * (-479.909) (-478.371) [-475.471] (-475.643) -- 0:00:01
472000 -- [-476.759] (-480.234) (-476.718) (-475.474) * (-478.732) (-479.233) (-478.489) [-475.122] -- 0:00:01
472500 -- [-478.438] (-478.694) (-475.986) (-478.475) * (-480.598) (-480.070) (-477.480) [-478.803] -- 0:00:01
473000 -- [-474.663] (-478.179) (-478.826) (-475.464) * (-479.007) (-477.770) (-479.044) [-476.883] -- 0:00:01
473500 -- (-476.680) [-474.898] (-474.357) (-475.189) * (-474.636) (-475.828) (-477.009) [-476.239] -- 0:00:01
474000 -- (-475.718) (-479.454) (-474.827) [-476.089] * (-475.273) (-476.108) [-474.479] (-478.681) -- 0:00:01
474500 -- (-480.186) [-477.369] (-477.194) (-478.880) * [-478.674] (-480.602) (-475.822) (-476.021) -- 0:00:01
475000 -- (-475.496) [-475.694] (-475.861) (-474.907) * (-477.394) [-476.243] (-479.163) (-476.151) -- 0:00:01
Average standard deviation of split frequencies: 0.013755
475500 -- (-475.375) (-477.009) [-475.302] (-475.260) * (-476.514) [-477.308] (-477.750) (-476.713) -- 0:00:01
476000 -- (-475.712) (-476.402) [-476.623] (-477.534) * [-474.612] (-476.971) (-476.072) (-478.729) -- 0:00:01
476500 -- [-476.521] (-476.534) (-477.527) (-478.944) * [-476.879] (-475.463) (-475.130) (-475.798) -- 0:00:01
477000 -- (-475.980) (-476.234) [-478.387] (-476.721) * (-476.485) [-475.106] (-478.042) (-476.666) -- 0:00:01
477500 -- (-476.047) (-474.696) [-475.896] (-475.571) * (-476.361) [-478.554] (-479.314) (-476.232) -- 0:00:01
478000 -- (-476.747) (-476.186) (-475.426) [-478.291] * (-476.073) (-476.506) (-476.447) [-476.026] -- 0:00:01
478500 -- (-474.529) [-475.221] (-477.105) (-481.286) * (-475.914) (-478.949) (-475.858) [-474.332] -- 0:00:01
479000 -- (-476.411) (-476.177) (-475.695) [-477.693] * (-477.662) (-480.441) (-479.204) [-477.273] -- 0:00:01
479500 -- (-475.099) (-474.555) [-475.933] (-478.111) * (-481.363) [-476.569] (-477.000) (-478.476) -- 0:00:01
480000 -- (-476.539) (-476.439) (-479.346) [-476.589] * (-478.256) [-476.146] (-476.991) (-478.515) -- 0:00:01
Average standard deviation of split frequencies: 0.014112
480500 -- (-480.858) (-474.918) [-474.246] (-477.521) * (-475.880) (-476.216) (-477.112) [-482.412] -- 0:00:01
481000 -- (-475.594) (-474.660) [-474.576] (-478.316) * (-476.822) [-474.728] (-477.587) (-476.712) -- 0:00:01
481500 -- (-474.968) [-475.804] (-477.968) (-475.208) * (-475.982) [-476.423] (-475.598) (-475.775) -- 0:00:01
482000 -- [-477.040] (-479.045) (-475.577) (-475.319) * (-478.504) (-483.787) (-476.298) [-477.490] -- 0:00:01
482500 -- [-475.612] (-475.954) (-474.741) (-479.429) * (-478.203) [-475.469] (-483.900) (-485.397) -- 0:00:01
483000 -- [-476.536] (-475.554) (-479.792) (-481.521) * (-477.021) (-478.513) (-476.574) [-477.061] -- 0:00:01
483500 -- (-475.844) (-476.234) (-480.478) [-474.723] * (-476.708) [-476.831] (-474.935) (-475.297) -- 0:00:00
484000 -- (-476.570) (-476.408) [-476.958] (-476.288) * (-476.851) [-477.827] (-476.904) (-475.497) -- 0:00:00
484500 -- [-475.702] (-476.664) (-474.582) (-474.267) * (-475.291) (-476.853) [-475.487] (-474.189) -- 0:00:00
485000 -- (-478.149) (-478.088) (-478.254) [-474.847] * (-476.126) [-476.785] (-475.327) (-475.710) -- 0:00:00
Average standard deviation of split frequencies: 0.014496
485500 -- (-477.027) (-481.526) (-477.686) [-477.173] * (-475.564) (-476.709) [-477.253] (-474.339) -- 0:00:00
486000 -- (-479.104) (-477.736) (-476.191) [-474.731] * (-474.781) [-476.096] (-475.684) (-474.323) -- 0:00:00
486500 -- (-475.894) (-475.819) (-477.112) [-479.147] * (-478.489) [-476.489] (-481.926) (-476.849) -- 0:00:00
487000 -- (-475.949) [-475.274] (-477.151) (-481.029) * (-480.942) [-476.030] (-476.572) (-476.587) -- 0:00:00
487500 -- (-475.013) (-475.424) [-475.907] (-476.023) * (-477.302) (-474.936) (-476.571) [-476.555] -- 0:00:00
488000 -- [-475.289] (-475.770) (-477.725) (-475.282) * (-476.583) (-474.745) (-477.324) [-475.258] -- 0:00:00
488500 -- [-475.202] (-474.548) (-475.806) (-479.360) * (-476.670) (-475.227) (-476.106) [-475.547] -- 0:00:00
489000 -- (-476.056) (-475.892) [-477.480] (-481.863) * (-474.069) (-476.346) (-476.022) [-476.008] -- 0:00:00
489500 -- [-478.587] (-484.301) (-475.920) (-477.544) * (-475.530) (-476.845) (-476.379) [-476.748] -- 0:00:00
490000 -- [-482.210] (-476.440) (-476.742) (-476.628) * (-475.807) (-477.602) [-476.104] (-477.101) -- 0:00:00
Average standard deviation of split frequencies: 0.014581
490500 -- [-476.602] (-474.170) (-474.681) (-475.478) * (-477.468) (-482.083) [-476.226] (-475.735) -- 0:00:00
491000 -- (-482.230) (-476.166) (-474.785) [-475.471] * (-476.091) (-478.329) (-481.297) [-475.954] -- 0:00:00
491500 -- (-474.926) (-475.338) (-476.825) [-475.134] * (-476.919) (-475.978) (-478.955) [-475.709] -- 0:00:00
492000 -- [-477.247] (-481.440) (-480.442) (-475.351) * (-477.158) (-475.079) (-477.562) [-475.969] -- 0:00:00
492500 -- (-479.591) [-479.230] (-480.686) (-479.470) * [-477.449] (-478.475) (-476.685) (-474.950) -- 0:00:00
493000 -- (-477.782) (-478.832) (-474.861) [-477.702] * (-478.583) (-476.708) [-478.150] (-475.585) -- 0:00:00
493500 -- (-481.172) (-476.864) [-476.076] (-477.715) * (-478.993) (-475.021) (-478.618) [-476.544] -- 0:00:00
494000 -- (-475.647) (-477.264) (-474.857) [-476.203] * [-477.332] (-474.733) (-477.161) (-475.657) -- 0:00:00
494500 -- (-475.752) [-479.871] (-475.156) (-481.043) * (-476.478) [-474.550] (-477.163) (-475.502) -- 0:00:00
495000 -- [-476.646] (-476.572) (-475.858) (-477.410) * (-475.114) [-474.851] (-477.773) (-476.456) -- 0:00:00
Average standard deviation of split frequencies: 0.013138
495500 -- (-474.980) [-478.205] (-476.268) (-476.295) * (-475.906) (-476.163) [-478.919] (-476.892) -- 0:00:00
496000 -- [-475.308] (-477.208) (-475.242) (-477.092) * (-475.772) (-478.349) (-477.452) [-478.411] -- 0:00:00
496500 -- (-477.260) [-474.579] (-477.490) (-479.908) * (-480.674) (-476.122) (-477.130) [-476.131] -- 0:00:00
497000 -- (-478.850) [-474.765] (-476.872) (-477.906) * [-478.565] (-475.893) (-476.935) (-476.804) -- 0:00:00
497500 -- [-476.063] (-476.659) (-476.656) (-476.190) * (-475.519) [-474.718] (-477.488) (-475.431) -- 0:00:00
498000 -- (-475.314) (-480.329) [-476.185] (-477.964) * (-479.395) (-476.096) (-476.798) [-475.756] -- 0:00:00
498500 -- [-479.115] (-476.835) (-481.610) (-475.319) * (-477.743) (-477.584) (-475.448) [-477.811] -- 0:00:00
499000 -- (-478.027) (-476.936) [-477.323] (-475.200) * (-478.036) (-480.306) (-475.732) [-477.975] -- 0:00:00
499500 -- (-476.451) (-476.684) [-477.146] (-477.244) * (-474.923) (-476.205) (-474.729) [-475.822] -- 0:00:00
500000 -- [-475.262] (-475.864) (-478.019) (-477.273) * [-474.856] (-474.449) (-477.966) (-479.082) -- 0:00:00
Average standard deviation of split frequencies: 0.012240
Analysis completed in 30 seconds
Analysis used 29.45 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -474.02
Likelihood of best state for "cold" chain of run 2 was -474.02
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
78.8 % ( 77 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
41.4 % ( 39 %) Dirichlet(Pi{all})
44.4 % ( 31 %) Slider(Pi{all})
88.4 % ( 79 %) Multiplier(Alpha{1,2})
88.2 % ( 77 %) Multiplier(Alpha{3})
24.7 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 93 %) ParsSPR(Tau{all},V{all})
30.7 % ( 26 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
35.4 % ( 17 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
78.7 % ( 77 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
42.9 % ( 39 %) Dirichlet(Pi{all})
45.2 % ( 27 %) Slider(Pi{all})
88.5 % ( 85 %) Multiplier(Alpha{1,2})
87.4 % ( 80 %) Multiplier(Alpha{3})
26.2 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 92 %) ParsSPR(Tau{all},V{all})
30.8 % ( 20 %) Multiplier(V{all})
97.5 % ( 94 %) Nodeslider(V{all})
35.0 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.80 0.63 0.50
2 | 82943 0.82 0.66
3 | 83526 83371 0.84
4 | 83301 83598 83261
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.80 0.64 0.50
2 | 83415 0.82 0.67
3 | 83453 84071 0.84
4 | 83124 82986 82951
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -475.53
| 2 1 22 2 |
| 1 2 2 2 2 2 |
| 1 2 *2 2 1 2 2 |
| 2 1 1 2 1 11 1 1 1 |
| 211 1 1 1 * 1 * 1 * 1 2 |
|1 2 2 2 2 2 1 |
| 1 22 12 2 * 1 2 1* 1 1 22 *|
| 1 2 * 1 1 1 1 * * 1 |
| 2 1 1 21 22 2 |
| 1 1 * * 2 1 |
|2 21 2 1 1 2 |
| 21 21 1 2 2 |
| 12 2 |
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -477.99
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -475.80 -479.78
2 -475.77 -478.79
--------------------------------------
TOTAL -475.78 -479.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896916 0.087322 0.370933 1.457565 0.875507 751.00 751.00 0.999
r(A<->C){all} 0.183677 0.022151 0.000114 0.482824 0.147896 40.95 79.30 1.002
r(A<->G){all} 0.159398 0.017169 0.000048 0.422441 0.121792 83.75 90.27 1.007
r(A<->T){all} 0.159292 0.019978 0.000180 0.446940 0.117717 132.31 136.26 1.025
r(C<->G){all} 0.166973 0.019992 0.000001 0.451292 0.127337 33.20 37.18 1.005
r(C<->T){all} 0.160702 0.017660 0.000022 0.430492 0.128308 61.49 68.66 1.000
r(G<->T){all} 0.169958 0.020326 0.000141 0.456089 0.135783 76.64 86.79 1.000
pi(A){all} 0.221681 0.000490 0.179711 0.265898 0.220640 581.15 606.85 0.999
pi(C){all} 0.277890 0.000584 0.235069 0.329259 0.277744 647.27 683.39 0.999
pi(G){all} 0.320766 0.000621 0.269885 0.368745 0.321101 440.38 532.53 0.999
pi(T){all} 0.179663 0.000430 0.138360 0.218627 0.178983 555.25 568.80 0.999
alpha{1,2} 0.395459 0.201685 0.000254 1.294811 0.232791 455.43 480.82 0.999
alpha{3} 0.467129 0.259371 0.000282 1.521322 0.298061 542.84 580.32 1.001
pinvar{all} 0.995169 0.000034 0.983668 0.999998 0.997124 517.94 586.76 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ...*.*
9 -- .****.
10 -- .*..*.
11 -- .*.***
12 -- ..****
13 -- ..**..
14 -- .*...*
15 -- ...**.
16 -- ..*.*.
17 -- .*.*..
18 -- .***.*
19 -- ....**
20 -- ..*..*
21 -- .**.**
22 -- ..**.*
23 -- ..***.
24 -- .*..**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 239 0.159121 0.023539 0.142477 0.175766 2
8 238 0.158455 0.015065 0.147803 0.169108 2
9 234 0.155792 0.005649 0.151798 0.159787 2
10 227 0.151132 0.016006 0.139814 0.162450 2
11 220 0.146471 0.001883 0.145140 0.147803 2
12 219 0.145806 0.002825 0.143808 0.147803 2
13 216 0.143808 0.003766 0.141145 0.146471 2
14 215 0.143142 0.014123 0.133156 0.153129 2
15 207 0.137816 0.021656 0.122503 0.153129 2
16 206 0.137150 0.011299 0.129161 0.145140 2
17 203 0.135153 0.019773 0.121172 0.149134 2
18 202 0.134487 0.016948 0.122503 0.146471 2
19 199 0.132490 0.004708 0.129161 0.135819 2
20 195 0.129827 0.019773 0.115846 0.143808 2
21 186 0.123835 0.007532 0.118509 0.129161 2
22 149 0.099201 0.002825 0.097204 0.101198 2
23 143 0.095206 0.017890 0.082557 0.107856 2
24 138 0.091877 0.015065 0.081225 0.102530 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100842 0.010331 0.000061 0.296758 0.070120 1.000 2
length{all}[2] 0.102077 0.009641 0.000132 0.290951 0.072025 0.999 2
length{all}[3] 0.097532 0.009019 0.000038 0.281636 0.068840 0.999 2
length{all}[4] 0.099594 0.010071 0.000101 0.305337 0.067984 1.000 2
length{all}[5] 0.102118 0.011121 0.000006 0.313303 0.067930 1.000 2
length{all}[6] 0.100895 0.009763 0.000031 0.292986 0.068697 1.003 2
length{all}[7] 0.105006 0.011821 0.001004 0.334924 0.072389 1.017 2
length{all}[8] 0.101688 0.009133 0.000667 0.302526 0.072933 1.008 2
length{all}[9] 0.101224 0.010445 0.000232 0.301317 0.072605 1.002 2
length{all}[10] 0.103030 0.011166 0.000557 0.342094 0.062153 0.998 2
length{all}[11] 0.102959 0.008399 0.001010 0.317354 0.070448 0.996 2
length{all}[12] 0.086700 0.006920 0.000115 0.253495 0.058544 0.995 2
length{all}[13] 0.084519 0.008387 0.000229 0.304278 0.054297 0.996 2
length{all}[14] 0.102202 0.010691 0.000124 0.253510 0.072821 0.997 2
length{all}[15] 0.093638 0.010294 0.000046 0.296602 0.058127 0.995 2
length{all}[16] 0.098769 0.007653 0.000228 0.264379 0.076156 0.999 2
length{all}[17] 0.103120 0.011393 0.000163 0.322145 0.073920 0.999 2
length{all}[18] 0.103485 0.009923 0.000023 0.329845 0.073201 0.995 2
length{all}[19] 0.088362 0.007183 0.000640 0.250344 0.059727 0.995 2
length{all}[20] 0.098060 0.010312 0.000151 0.296758 0.062457 0.997 2
length{all}[21] 0.100377 0.010386 0.000018 0.298407 0.066529 1.009 2
length{all}[22] 0.100996 0.009238 0.000499 0.311900 0.066915 0.994 2
length{all}[23] 0.104092 0.010167 0.001780 0.325028 0.077805 1.009 2
length{all}[24] 0.100704 0.012468 0.000415 0.335134 0.064841 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.012240
Maximum standard deviation of split frequencies = 0.023539
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.017
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 42 trees
90 % credible set contains 88 trees
95 % credible set contains 95 trees
99 % credible set contains 102 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 348
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 41 patterns at 116 / 116 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 41 patterns at 116 / 116 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40016 bytes for conP
3608 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101618 0.045832 0.095187 0.061731 0.095229 0.085966 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -508.461136
Iterating by ming2
Initial: fx= 508.461136
x= 0.10162 0.04583 0.09519 0.06173 0.09523 0.08597 0.30000 1.30000
1 h-m-p 0.0000 0.0004 278.4115 +++ 477.277584 m 0.0004 14 | 1/8
2 h-m-p 0.0044 0.0714 23.3762 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 255.9327 ++ 468.134037 m 0.0001 46 | 2/8
4 h-m-p 0.0013 0.0798 24.4557 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 229.2974 +++ 456.888356 m 0.0002 78 | 3/8
6 h-m-p 0.0019 0.0958 22.4716 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 199.3452 ++ 453.653228 m 0.0001 110 | 4/8
8 h-m-p 0.0007 0.1229 19.2893 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 163.0042 ++ 453.643304 m 0.0000 141 | 5/8
10 h-m-p 0.0004 0.1832 13.5515 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 115.1957 ++ 452.894122 m 0.0001 171 | 6/8
12 h-m-p 0.5498 8.0000 0.0000 C 452.894122 0 0.1374 182 | 6/8
13 h-m-p 0.6933 8.0000 0.0000 ++ 452.894122 m 8.0000 195 | 6/8
14 h-m-p 0.0160 8.0000 0.0009 +++++ 452.894122 m 8.0000 211 | 6/8
15 h-m-p 0.1685 8.0000 0.0449 ----------Y 452.894122 0 0.0000 234 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
17 h-m-p 0.0160 8.0000 0.0000 +++++ 452.894122 m 8.0000 274 | 6/8
18 h-m-p 0.0086 4.3019 0.5581 ++++C 452.894102 0 2.2363 291 | 6/8
19 h-m-p 0.8917 4.4583 0.2585 C 452.894102 0 0.8917 304 | 6/8
20 h-m-p 1.6000 8.0000 0.0067 Y 452.894102 0 0.8880 317 | 6/8
21 h-m-p 1.6000 8.0000 0.0002 ++ 452.894102 m 8.0000 330 | 6/8
22 h-m-p 0.6662 8.0000 0.0018 +Y 452.894102 0 4.4929 344 | 6/8
23 h-m-p 1.6000 8.0000 0.0004 ++ 452.894102 m 8.0000 357 | 6/8
24 h-m-p 0.0303 8.0000 0.1071 --------------.. | 6/8
25 h-m-p 0.0160 8.0000 0.0000 ---Y 452.894102 0 0.0001 398
Out..
lnL = -452.894102
399 lfun, 399 eigenQcodon, 2394 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.073686 0.017451 0.109299 0.026937 0.031463 0.063001 1.528973 0.893446 0.252790
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.307169
np = 9
lnL0 = -488.827594
Iterating by ming2
Initial: fx= 488.827594
x= 0.07369 0.01745 0.10930 0.02694 0.03146 0.06300 1.52897 0.89345 0.25279
1 h-m-p 0.0000 0.0002 268.4272 ++ 477.374155 m 0.0002 14 | 1/9
2 h-m-p 0.0000 0.0001 284.4274 ++ 472.070582 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 239.0177 ++ 470.180662 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0003 408.8362 ++ 459.251990 m 0.0003 50 | 4/9
5 h-m-p 0.0000 0.0000 45270.5001 ++ 456.825063 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0001 1794.1990 ++ 453.772485 m 0.0001 74 | 6/9
7 h-m-p 0.0143 0.1234 2.6897 -------------.. | 6/9
8 h-m-p 0.0000 0.0001 113.6343 ++ 452.894100 m 0.0001 109 | 7/9
9 h-m-p 0.1594 8.0000 0.0000 +++ 452.894100 m 8.0000 122 | 7/9
10 h-m-p 0.0481 8.0000 0.0005 ---C 452.894100 0 0.0002 139 | 7/9
11 h-m-p 0.0160 8.0000 0.0002 +++++ 452.894100 m 8.0000 156 | 7/9
12 h-m-p 0.0231 8.0000 0.0610 +++C 452.894100 0 1.2749 173 | 7/9
13 h-m-p 1.6000 8.0000 0.0049 Y 452.894100 0 1.1310 187 | 7/9
14 h-m-p 1.6000 8.0000 0.0001 C 452.894100 0 1.6000 201 | 7/9
15 h-m-p 1.6000 8.0000 0.0000 --------N 452.894100 0 0.0000 223
Out..
lnL = -452.894100
224 lfun, 672 eigenQcodon, 2688 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.014350 0.085778 0.040728 0.072095 0.061208 0.026455 1.480951 1.173011 0.333600 0.132630 2.130144
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.200904
np = 11
lnL0 = -484.549138
Iterating by ming2
Initial: fx= 484.549138
x= 0.01435 0.08578 0.04073 0.07210 0.06121 0.02646 1.48095 1.17301 0.33360 0.13263 2.13014
1 h-m-p 0.0000 0.0001 238.4993 ++ 476.054302 m 0.0001 16 | 1/11
2 h-m-p 0.0003 0.0015 71.2754 ++ 469.250435 m 0.0015 30 | 2/11
3 h-m-p 0.0000 0.0001 408.5576 ++ 466.006810 m 0.0001 44 | 3/11
4 h-m-p 0.0015 0.0223 12.0138 -----------.. | 3/11
5 h-m-p 0.0000 0.0001 208.0214 ++ 463.551069 m 0.0001 81 | 4/11
6 h-m-p 0.0038 1.9245 8.2943 ------------.. | 4/11
7 h-m-p 0.0000 0.0002 183.0566 +++ 456.911864 m 0.0002 120 | 5/11
8 h-m-p 0.0076 3.7945 5.1747 -------------.. | 5/11
9 h-m-p 0.0000 0.0001 156.8959 ++ 454.463354 m 0.0001 159 | 6/11
10 h-m-p 0.0160 8.0000 2.0289 -------------.. | 6/11
11 h-m-p 0.0000 0.0001 112.8704 ++ 452.894102 m 0.0001 198 | 7/11
12 h-m-p 0.6049 8.0000 0.0000 ++ 452.894102 m 8.0000 212 | 7/11
13 h-m-p 0.0890 8.0000 0.0001 ----Y 452.894102 0 0.0001 234
Out..
lnL = -452.894102
235 lfun, 940 eigenQcodon, 4230 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -452.899254 S = -452.892523 -0.002573
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:02
did 20 / 41 patterns 0:02
did 30 / 41 patterns 0:02
did 40 / 41 patterns 0:02
did 41 / 41 patterns 0:02
Time used: 0:02
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101485 0.060909 0.017382 0.060603 0.018763 0.042389 1.477564 0.971850 0.713831 0.254340 0.590543 0.975757
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 7.626128
np = 12
lnL0 = -486.691971
Iterating by ming2
Initial: fx= 486.691971
x= 0.10148 0.06091 0.01738 0.06060 0.01876 0.04239 1.47756 0.97185 0.71383 0.25434 0.59054 0.97576
1 h-m-p 0.0000 0.0002 269.7671 ++ 475.203976 m 0.0002 17 | 1/12
2 h-m-p 0.0000 0.0001 120.0872 ++ 474.427107 m 0.0001 32 | 2/12
3 h-m-p 0.0001 0.0004 146.0922 ++ 465.010147 m 0.0004 47 | 3/12
4 h-m-p 0.0002 0.0009 127.3139 ++ 457.837540 m 0.0009 62 | 4/12
5 h-m-p 0.0000 0.0000 7461.8523 ++ 457.758951 m 0.0000 77 | 5/12
6 h-m-p 0.0000 0.0000 141460.8973 ++ 455.799076 m 0.0000 92 | 6/12
7 h-m-p 0.0057 0.3401 5.2060 ------------.. | 6/12
8 h-m-p 0.0000 0.0002 112.8817 +++ 452.894101 m 0.0002 133 | 7/12
9 h-m-p 0.6449 8.0000 0.0000 ++ 452.894101 m 8.0000 148 | 7/12
10 h-m-p 0.0160 8.0000 0.0043 +++++ 452.894101 m 8.0000 171 | 7/12
11 h-m-p 0.0667 8.0000 0.5135 --------------.. | 7/12
12 h-m-p 0.0160 8.0000 0.0000 +++++ 452.894101 m 8.0000 226 | 7/12
13 h-m-p 0.0091 4.5295 0.3399 +++++ 452.894040 m 4.5295 249 | 8/12
14 h-m-p 0.9230 8.0000 1.5373 ---------------Y 452.894040 0 0.0000 284 | 8/12
15 h-m-p 0.0160 8.0000 0.0001 +++++ 452.894040 m 8.0000 302 | 8/12
16 h-m-p 0.0160 8.0000 0.8324 ------------Y 452.894040 0 0.0000 333 | 8/12
17 h-m-p 0.0160 8.0000 0.0012 +++++ 452.894039 m 8.0000 355 | 8/12
18 h-m-p 0.0160 8.0000 0.8998 ----------C 452.894039 0 0.0000 384 | 8/12
19 h-m-p 0.0160 8.0000 0.0003 +++++ 452.894039 m 8.0000 406 | 8/12
20 h-m-p 0.0160 8.0000 0.8440 -------------.. | 8/12
21 h-m-p 0.0160 8.0000 0.0001 +++++ 452.894039 m 8.0000 458 | 8/12
22 h-m-p 0.0160 8.0000 0.7001 -------------.. | 8/12
23 h-m-p 0.0160 8.0000 0.0001 +++++ 452.894039 m 8.0000 510 | 8/12
24 h-m-p 0.0160 8.0000 0.7580 -----------Y 452.894039 0 0.0000 540 | 8/12
25 h-m-p 0.0160 8.0000 0.0001 +++++ 452.894039 m 8.0000 562 | 8/12
26 h-m-p 0.0160 8.0000 0.9684 ----------C 452.894039 0 0.0000 591 | 8/12
27 h-m-p 0.0160 8.0000 0.0001 ---------Y 452.894039 0 0.0000 619 | 8/12
28 h-m-p 0.0160 8.0000 0.0000 +++++ 452.894039 m 8.0000 641 | 8/12
29 h-m-p 0.0021 1.0554 1.6262 +++++ 452.894023 m 1.0554 663 | 9/12
30 h-m-p 0.4060 2.0301 1.0799 ++ 452.893985 m 2.0301 678 | 10/12
31 h-m-p 1.6000 8.0000 0.0000 Y 452.893985 0 1.6000 693
Out..
lnL = -452.893985
694 lfun, 2776 eigenQcodon, 12492 P(t)
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032730 0.070365 0.094639 0.040094 0.106947 0.021276 0.000100 1.188301 1.927811
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.913658
np = 9
lnL0 = -492.988007
Iterating by ming2
Initial: fx= 492.988007
x= 0.03273 0.07037 0.09464 0.04009 0.10695 0.02128 0.00011 1.18830 1.92781
1 h-m-p 0.0000 0.0000 259.7049 ++ 492.709898 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0459 25.9494 +++++ 487.531529 m 0.0459 29 | 2/9
3 h-m-p 0.0001 0.0006 259.2201
QuantileBeta(0.15, 0.00500, 2.19307) = 1.198864e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.22393) = 1.177982e-160 2000 rounds
+ 483.158381 m 0.0006 41
QuantileBeta(0.15, 0.00500, 2.22393) = 1.177982e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22393) = 1.177982e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22393) = 1.177982e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22393) = 1.177982e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22393) = 1.177982e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22393) = 1.177982e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22393) = 1.177982e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22393) = 1.219105e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22393) = 1.177981e-160 2000 rounds
| 3/9
4 h-m-p 0.0011 0.0117 140.5893 ++ 465.072170 m 0.0117 53 | 4/9
5 h-m-p 0.0001 0.0004 50.5118 ++ 464.290257 m 0.0004 65 | 5/9
6 h-m-p 0.0000 0.0002 73.2758 ++ 463.708687 m 0.0002 77 | 6/9
7 h-m-p 0.0007 0.0419 13.7632 -----------.. | 6/9
8 h-m-p 0.0000 0.0005 147.4810 +++ 453.100260 m 0.0005 111 | 7/9
9 h-m-p 0.0476 8.0000 1.0406 --------------.. | 7/9
10 h-m-p 0.0000 0.0000 109.4027 ++ 452.893985 m 0.0000 147 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 452.893985 0 1.6000 159 | 8/9
12 h-m-p 0.0160 8.0000 0.0000 +Y 452.893985 0 0.0640 173
Out..
lnL = -452.893985
174 lfun, 1914 eigenQcodon, 10440 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.011201 0.030007 0.045897 0.089895 0.093228 0.104054 0.000100 0.900000 1.076164 1.787849 2.924856
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.656666
np = 11
lnL0 = -490.120113
Iterating by ming2
Initial: fx= 490.120113
x= 0.01120 0.03001 0.04590 0.08990 0.09323 0.10405 0.00011 0.90000 1.07616 1.78785 2.92486
1 h-m-p 0.0000 0.0000 219.1759 ++ 489.974511 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 391.0430 ++ 483.745368 m 0.0001 30 | 2/11
3 h-m-p 0.0001 0.0006 74.8993 ++ 475.006141 m 0.0006 44 | 3/11
4 h-m-p 0.0017 0.0276 24.7508 +++ 455.908985 m 0.0276 59 | 4/11
5 h-m-p 0.0000 0.0000 2128.0182 ++ 455.195090 m 0.0000 73 | 5/11
6 h-m-p 0.0003 0.0016 137.4384 ++ 454.533091 m 0.0016 87 | 6/11
7 h-m-p 0.0000 0.0000 22552.9970 ++ 452.894118 m 0.0000 101 | 7/11
8 h-m-p 1.6000 8.0000 0.0005 ++ 452.894118 m 8.0000 115 | 7/11
9 h-m-p 0.0077 1.3650 0.5289 ---------N 452.894118 0 0.0000 142 | 7/11
10 h-m-p 0.0160 8.0000 0.0001 +++++ 452.894118 m 8.0000 163 | 7/11
11 h-m-p 0.0001 0.0748 7.8047 --------Y 452.894118 0 0.0000 189 | 7/11
12 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 452.894117 m 8.0000 235 | 6/11
14 h-m-p 0.0011 0.0056 0.1837 ---------Y 452.894117 0 0.0000 263 | 6/11
15 h-m-p 0.0160 8.0000 0.0007 +++++ 452.894117 m 8.0000 285 | 6/11
16 h-m-p 0.0036 0.0180 0.3080 ------------.. | 6/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 452.894117 m 8.0000 336 | 6/11
18 h-m-p 0.0054 0.1215 0.1942 ---------Y 452.894117 0 0.0000 364 | 6/11
19 h-m-p 0.0160 8.0000 0.0005 +++++ 452.894116 m 8.0000 386 | 6/11
20 h-m-p 0.0237 4.5771 0.1838 ----------Y 452.894116 0 0.0000 415 | 6/11
21 h-m-p 0.0000 0.0213 0.9508 +++++ 452.894114 m 0.0213 437 | 6/11
22 h-m-p 0.1080 4.5971 0.1874 ---------------.. | 6/11
23 h-m-p 0.0160 8.0000 0.0002 +++++ 452.894113 m 8.0000 491 | 6/11
24 h-m-p 0.0014 0.0069 0.1758 ----------N 452.894113 0 0.0000 520 | 6/11
25 h-m-p 0.0014 0.6836 0.0020 +++++ 452.894113 m 0.6836 542 | 6/11
26 h-m-p 0.0099 4.9361 0.1700 ---------C 452.894113 0 0.0000 570 | 6/11
27 h-m-p 0.0000 0.0000 0.0007 ---Y 452.894113 0 0.0000 592 | 6/11
28 h-m-p 0.0000 0.0000 0.0003 -Y 452.894113 0 0.0000 612
Out..
lnL = -452.894113
613 lfun, 7356 eigenQcodon, 40458 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -452.900605 S = -452.892229 -0.003673
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:19
did 20 / 41 patterns 0:19
did 30 / 41 patterns 0:19
did 40 / 41 patterns 0:19
did 41 / 41 patterns 0:19
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=116
NC_011896_1_WP_010908836_1_2489_MLBR_RS11855 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
NC_002677_1_NP_302516_1_1388_ML2330 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG
**************************************************
NC_011896_1_WP_010908836_1_2489_MLBR_RS11855 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
NC_002677_1_NP_302516_1_1388_ML2330 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125 EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM
**************************************************
NC_011896_1_WP_010908836_1_2489_MLBR_RS11855 RPTAPPPTPPTYMAGT
NC_002677_1_NP_302516_1_1388_ML2330 RPTAPPPTPPTYMAGT
NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350 RPTAPPPTPPTYMAGT
NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110 RPTAPPPTPPTYMAGT
NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790 RPTAPPPTPPTYMAGT
NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125 RPTAPPPTPPTYMAGT
****************
>NC_011896_1_WP_010908836_1_2489_MLBR_RS11855 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC >NC_002677_1_NP_302516_1_1388_ML2330 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC >NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC >NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC >NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC >NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125 ATGCAACCCGGAGGTGATATGTCGGCGCTGCTCGCCCAGGCGCAGCAGAT GCAGCAGAAGCTACTGGAAACCCAACAACAGCTCGCGAACGCGCAGGTGC ATGGTCAGGGTGGTGGGGGCTTGGTCGAGGTCGTCGTCAAAGGCAGTGGA GAAGTGGTTAGTGTCGCTATCGATCCTAAAGTCGTCGACCCTGGCGATAT TGAGACCTTGCAGGACCTGATCGTCGGCGCGATGGCTGATGCTTCTAAGC AAGTCACCAAACTGGCTCAGGAGCGTTTGGGAGCGTTGACCAGCGCCATG CGTCCGACGGCACCGCCACCGACCCCACCGACTTACATGGCAGGAACC
>NC_011896_1_WP_010908836_1_2489_MLBR_RS11855 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM RPTAPPPTPPTYMAGT >NC_002677_1_NP_302516_1_1388_ML2330 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM RPTAPPPTPPTYMAGT >NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM RPTAPPPTPPTYMAGT >NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM RPTAPPPTPPTYMAGT >NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM RPTAPPPTPPTYMAGT >NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125 MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSG EVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAM RPTAPPPTPPTYMAGT
#NEXUS
[ID: 5244580233]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908836_1_2489_MLBR_RS11855
NC_002677_1_NP_302516_1_1388_ML2330
NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350
NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110
NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790
NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908836_1_2489_MLBR_RS11855,
2 NC_002677_1_NP_302516_1_1388_ML2330,
3 NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350,
4 NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110,
5 NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790,
6 NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07012014,2:0.07202455,3:0.06884027,4:0.06798416,5:0.06792979,6:0.06869719);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07012014,2:0.07202455,3:0.06884027,4:0.06798416,5:0.06792979,6:0.06869719);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -475.80 -479.78
2 -475.77 -478.79
--------------------------------------
TOTAL -475.78 -479.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2330/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896916 0.087322 0.370933 1.457565 0.875507 751.00 751.00 0.999
r(A<->C){all} 0.183677 0.022151 0.000114 0.482824 0.147896 40.95 79.30 1.002
r(A<->G){all} 0.159398 0.017169 0.000048 0.422441 0.121792 83.75 90.27 1.007
r(A<->T){all} 0.159292 0.019978 0.000180 0.446940 0.117717 132.31 136.26 1.025
r(C<->G){all} 0.166973 0.019992 0.000001 0.451292 0.127337 33.20 37.18 1.005
r(C<->T){all} 0.160702 0.017660 0.000022 0.430492 0.128308 61.49 68.66 1.000
r(G<->T){all} 0.169958 0.020326 0.000141 0.456089 0.135783 76.64 86.79 1.000
pi(A){all} 0.221681 0.000490 0.179711 0.265898 0.220640 581.15 606.85 0.999
pi(C){all} 0.277890 0.000584 0.235069 0.329259 0.277744 647.27 683.39 0.999
pi(G){all} 0.320766 0.000621 0.269885 0.368745 0.321101 440.38 532.53 0.999
pi(T){all} 0.179663 0.000430 0.138360 0.218627 0.178983 555.25 568.80 0.999
alpha{1,2} 0.395459 0.201685 0.000254 1.294811 0.232791 455.43 480.82 0.999
alpha{3} 0.467129 0.259371 0.000282 1.521322 0.298061 542.84 580.32 1.001
pinvar{all} 0.995169 0.000034 0.983668 0.999998 0.997124 517.94 586.76 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2330/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 116
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 0 0 0 0 0 0
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 4 4 4 4 4 4 | CGA 0 0 0 0 0 0
CTG 4 4 4 4 4 4 | CCG 4 4 4 4 4 4 | CAG 10 10 10 10 10 10 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 2 2 2 2 2 2 | ACC 6 6 6 6 6 6 | AAC 1 1 1 1 1 1 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 1 1 1 1 1 1 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 4 4 4 4 4 4 | Asp GAT 4 4 4 4 4 4 | Gly GGT 4 4 4 4 4 4
GTC 9 9 9 9 9 9 | GCC 2 2 2 2 2 2 | GAC 2 2 2 2 2 2 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 2 2 2 2 2 2 | GGA 4 4 4 4 4 4
GTG 2 2 2 2 2 2 | GCG 6 6 6 6 6 6 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908836_1_2489_MLBR_RS11855
position 1: T:0.06034 C:0.28448 A:0.22414 G:0.43103
position 2: T:0.27586 C:0.28448 A:0.28448 G:0.15517
position 3: T:0.19828 C:0.26724 A:0.15517 G:0.37931
Average T:0.17816 C:0.27874 A:0.22126 G:0.32184
#2: NC_002677_1_NP_302516_1_1388_ML2330
position 1: T:0.06034 C:0.28448 A:0.22414 G:0.43103
position 2: T:0.27586 C:0.28448 A:0.28448 G:0.15517
position 3: T:0.19828 C:0.26724 A:0.15517 G:0.37931
Average T:0.17816 C:0.27874 A:0.22126 G:0.32184
#3: NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350
position 1: T:0.06034 C:0.28448 A:0.22414 G:0.43103
position 2: T:0.27586 C:0.28448 A:0.28448 G:0.15517
position 3: T:0.19828 C:0.26724 A:0.15517 G:0.37931
Average T:0.17816 C:0.27874 A:0.22126 G:0.32184
#4: NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110
position 1: T:0.06034 C:0.28448 A:0.22414 G:0.43103
position 2: T:0.27586 C:0.28448 A:0.28448 G:0.15517
position 3: T:0.19828 C:0.26724 A:0.15517 G:0.37931
Average T:0.17816 C:0.27874 A:0.22126 G:0.32184
#5: NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790
position 1: T:0.06034 C:0.28448 A:0.22414 G:0.43103
position 2: T:0.27586 C:0.28448 A:0.28448 G:0.15517
position 3: T:0.19828 C:0.26724 A:0.15517 G:0.37931
Average T:0.17816 C:0.27874 A:0.22126 G:0.32184
#6: NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125
position 1: T:0.06034 C:0.28448 A:0.22414 G:0.43103
position 2: T:0.27586 C:0.28448 A:0.28448 G:0.15517
position 3: T:0.19828 C:0.26724 A:0.15517 G:0.37931
Average T:0.17816 C:0.27874 A:0.22126 G:0.32184
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 0 | TCC 0 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 12
CTC 12 | CCC 6 | CAC 0 | CGC 0
CTA 6 | CCA 12 | Gln Q CAA 24 | CGA 0
CTG 24 | CCG 24 | CAG 60 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 12
ATC 12 | ACC 36 | AAC 6 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 36 | ACG 6 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 24 | Asp D GAT 24 | Gly G GGT 24
GTC 54 | GCC 12 | GAC 12 | GGC 24
GTA 0 | GCA 12 | Glu E GAA 12 | GGA 24
GTG 12 | GCG 36 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.06034 C:0.28448 A:0.22414 G:0.43103
position 2: T:0.27586 C:0.28448 A:0.28448 G:0.15517
position 3: T:0.19828 C:0.26724 A:0.15517 G:0.37931
Average T:0.17816 C:0.27874 A:0.22126 G:0.32184
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -452.894102 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.528973 0.508679
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908836_1_2489_MLBR_RS11855: 0.000004, NC_002677_1_NP_302516_1_1388_ML2330: 0.000004, NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350: 0.000004, NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110: 0.000004, NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790: 0.000004, NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.52897
omega (dN/dS) = 0.50868
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 252.6 95.4 0.5087 0.0000 0.0000 0.0 0.0
7..2 0.000 252.6 95.4 0.5087 0.0000 0.0000 0.0 0.0
7..3 0.000 252.6 95.4 0.5087 0.0000 0.0000 0.0 0.0
7..4 0.000 252.6 95.4 0.5087 0.0000 0.0000 0.0 0.0
7..5 0.000 252.6 95.4 0.5087 0.0000 0.0000 0.0 0.0
7..6 0.000 252.6 95.4 0.5087 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -452.894100 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.480951 0.750869 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908836_1_2489_MLBR_RS11855: 0.000004, NC_002677_1_NP_302516_1_1388_ML2330: 0.000004, NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350: 0.000004, NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110: 0.000004, NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790: 0.000004, NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.48095
MLEs of dN/dS (w) for site classes (K=2)
p: 0.75087 0.24913
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 252.9 95.1 0.2491 0.0000 0.0000 0.0 0.0
7..2 0.000 252.9 95.1 0.2491 0.0000 0.0000 0.0 0.0
7..3 0.000 252.9 95.1 0.2491 0.0000 0.0000 0.0 0.0
7..4 0.000 252.9 95.1 0.2491 0.0000 0.0000 0.0 0.0
7..5 0.000 252.9 95.1 0.2491 0.0000 0.0000 0.0 0.0
7..6 0.000 252.9 95.1 0.2491 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -452.894102 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.477564 0.580881 0.242298 0.000001 2.158032
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908836_1_2489_MLBR_RS11855: 0.000004, NC_002677_1_NP_302516_1_1388_ML2330: 0.000004, NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350: 0.000004, NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110: 0.000004, NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790: 0.000004, NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.47756
MLEs of dN/dS (w) for site classes (K=3)
p: 0.58088 0.24230 0.17682
w: 0.00000 1.00000 2.15803
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 252.9 95.1 0.6239 0.0000 0.0000 0.0 0.0
7..2 0.000 252.9 95.1 0.6239 0.0000 0.0000 0.0 0.0
7..3 0.000 252.9 95.1 0.6239 0.0000 0.0000 0.0 0.0
7..4 0.000 252.9 95.1 0.6239 0.0000 0.0000 0.0 0.0
7..5 0.000 252.9 95.1 0.6239 0.0000 0.0000 0.0 0.0
7..6 0.000 252.9 95.1 0.6239 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908836_1_2489_MLBR_RS11855)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908836_1_2489_MLBR_RS11855)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -452.893985 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.554581 0.230156 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908836_1_2489_MLBR_RS11855: 0.000004, NC_002677_1_NP_302516_1_1388_ML2330: 0.000004, NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350: 0.000004, NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110: 0.000004, NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790: 0.000004, NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.55458 0.23016 0.21526
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -452.893985 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.579293
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908836_1_2489_MLBR_RS11855: 0.000004, NC_002677_1_NP_302516_1_1388_ML2330: 0.000004, NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350: 0.000004, NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110: 0.000004, NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790: 0.000004, NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.57929
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 267.1 80.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -452.894113 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.818328 0.489255 2.103276 3.392397
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908836_1_2489_MLBR_RS11855: 0.000004, NC_002677_1_NP_302516_1_1388_ML2330: 0.000004, NZ_LVXE01000002_1_WP_010908836_1_773_A3216_RS01350: 0.000004, NZ_LYPH01000022_1_WP_010908836_1_863_A8144_RS04110: 0.000004, NZ_CP029543_1_WP_010908836_1_2511_DIJ64_RS12790: 0.000004, NZ_AP014567_1_WP_010908836_1_2578_JK2ML_RS13125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.81833 p = 0.48925 q = 2.10328
(p1 = 0.18167) w = 3.39240
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08183 0.08183 0.08183 0.08183 0.08183 0.08183 0.08183 0.08183 0.08183 0.08183 0.18167
w: 0.00092 0.00872 0.02509 0.05088 0.08742 0.13684 0.20268 0.29154 0.41811 0.63392 3.39240
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 267.1 80.9 0.7682 0.0000 0.0000 0.0 0.0
7..2 0.000 267.1 80.9 0.7682 0.0000 0.0000 0.0 0.0
7..3 0.000 267.1 80.9 0.7682 0.0000 0.0000 0.0 0.0
7..4 0.000 267.1 80.9 0.7682 0.0000 0.0000 0.0 0.0
7..5 0.000 267.1 80.9 0.7682 0.0000 0.0000 0.0 0.0
7..6 0.000 267.1 80.9 0.7682 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908836_1_2489_MLBR_RS11855)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908836_1_2489_MLBR_RS11855)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Time used: 0:19
Model 1: NearlyNeutral -452.8941 Model 2: PositiveSelection -452.894102 Model 0: one-ratio -452.894102 Model 3: discrete -452.893985 Model 7: beta -452.893985 Model 8: beta&w>1 -452.894113 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 2.5600000003578316E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
