--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Nov 10 12:35:06 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/181/CG7091-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/181/CG7091-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/181/CG7091-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/181/CG7091-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3527.94 -3536.28 2 -3528.07 -3538.19 -------------------------------------- TOTAL -3528.01 -3537.63 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/181/CG7091-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/181/CG7091-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/181/CG7091-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.259128 0.000633 0.212509 0.309912 0.257013 1208.62 1340.76 1.000 r(A<->C){all} 0.116786 0.000572 0.071488 0.164455 0.115272 1107.54 1121.87 1.000 r(A<->G){all} 0.304271 0.001361 0.236503 0.377812 0.303054 766.65 815.84 1.001 r(A<->T){all} 0.130265 0.000793 0.078219 0.185802 0.129193 949.24 972.84 1.000 r(C<->G){all} 0.052225 0.000184 0.026480 0.077319 0.051216 1112.32 1180.51 1.000 r(C<->T){all} 0.324440 0.001431 0.248794 0.398592 0.323466 981.78 1024.44 1.002 r(G<->T){all} 0.072013 0.000278 0.041630 0.107370 0.070692 1056.20 1074.80 1.000 pi(A){all} 0.187495 0.000091 0.169449 0.206620 0.187253 986.80 1129.21 1.000 pi(C){all} 0.276392 0.000121 0.256032 0.299078 0.276368 1122.03 1173.32 1.000 pi(G){all} 0.279804 0.000122 0.259750 0.302062 0.279471 1054.33 1110.82 1.000 pi(T){all} 0.256310 0.000116 0.236609 0.278947 0.256640 1031.97 1158.14 1.000 alpha{1,2} 0.076980 0.003288 0.000147 0.185176 0.066516 1248.60 1260.21 1.000 alpha{3} 2.042036 0.627403 0.708880 3.522161 1.915719 1327.55 1412.21 1.000 pinvar{all} 0.214177 0.010082 0.011528 0.388728 0.216834 994.18 1159.78 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3395.584554 Model 2: PositiveSelection -3395.584554 Model 0: one-ratio -3396.143622 Model 3: discrete -3395.230022 Model 7: beta -3395.293737 Model 8: beta&w>1 -3395.293802 Model 0 vs 1 1.1181360000000495 Model 2 vs 1 0.0 Model 8 vs 7 1.3000000035390258E-4
>C1 MSSMSWTLPRLSQSSASTAHGLVGSVRLTYAICAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPAGLSRLTEGNVTSTGRCGSPRVVFNPQIQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAV AYILLPAMAHSSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLSFGIACCFLVY DTVEQHPRISNEEVDYLRQGKSQLGQQRQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILANCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGMAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIVFNTMAMLVFAFCSSTNLQPWDPRSRMEKTA SPSAQESNSo >C2 MSSMSWNLPRLSQSSASTAHGLVGSVRLTYAICAFLATCIHAAMRNMLGM IILKMVMPRPEDALVASAELGRLSEGNVTATGRCGSPRVVFNPQFQETQS GNLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAV AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVGSYLSNYGWELSFYVVGGVGLLFGIACCFLVY DTVEQHPRISDEEVDYLMQGKSQLGLKQQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQMMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILADCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIAFNTMAMLVFAFCSSTNLQPWDPRSRKEKTG SPSAQESNSo >C3 MSSMSWTLPRLSQSSASTAHELVGSVRLTYALCAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPAELGRLTEDNVTSTGRCGSPRVVFNPQFQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAA AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLLFGIACCFLVY DTVEQHPRISDEEVDYLMQGKSQLGLKQQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILVDCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIAFNTMAMLVFAFCSSTNLQPWDPRSRKEKTG SPSAQESNSo >C4 MSSKSWTLPRLSQSSASSAHGLLGSVRLTYAICAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPPEFGRLTEGNITSTGRCGSPRIIFNPQIQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKVLFLVSLIFEAV AYILLPAMAHFSFEAAVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLSLGIACCFLVY DTVEQHPRISDEEVEYLRQGKSQLGLQQQPVLRIPWKSLLTAPPAYAFIL THMFHTYSFLVIVQLMPRFMREAMEFELREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGSDQNCVRRMLYGICSILTTSLIGVIILADCNNKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLVTLIACNTLAMLVFAFCSSTNLQPWDPRSRKEKET GSPRAQDSNS >C5 MSSKSWTLPRLSQSRASSAHRLLGSVRLTYAICAFLSTCLHAAMRNMLGM IILKMVMPRPEDALLAPAELGRLTEGNTTSMSRCGSPRVIFNPQIQGTQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKVLFIVSLIFEAV AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVAIYLSNFGWELSFYVVGGVGLSFGIACYFLVY DTVEQHPRISDEEVDYLMQGKNQLGLQQQPVLRIPWKSLLTAPPAYAFIL THMFHTYSFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCMRRMLYSICSILTTSLIGVIILADCGDKKLVLMM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIACNTLAMLVFAFCSNTNLQPWDPRSRKEKTG SSRAQESNSo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=511 C1 MSSMSWTLPRLSQSSASTAHGLVGSVRLTYAICAFLATCLHAAMRNMLGM C2 MSSMSWNLPRLSQSSASTAHGLVGSVRLTYAICAFLATCIHAAMRNMLGM C3 MSSMSWTLPRLSQSSASTAHELVGSVRLTYALCAFLATCLHAAMRNMLGM C4 MSSKSWTLPRLSQSSASSAHGLLGSVRLTYAICAFLATCLHAAMRNMLGM C5 MSSKSWTLPRLSQSRASSAHRLLGSVRLTYAICAFLSTCLHAAMRNMLGM *** **.******* **:** *:********:****:**:********** C1 IILKMVMPRPEDALVVPAGLSRLTEGNVTSTGRCGSPRVVFNPQIQETQS C2 IILKMVMPRPEDALVASAELGRLSEGNVTATGRCGSPRVVFNPQFQETQS C3 IILKMVMPRPEDALVVPAELGRLTEDNVTSTGRCGSPRVVFNPQFQETQS C4 IILKMVMPRPEDALVVPPEFGRLTEGNITSTGRCGSPRIIFNPQIQETQS C5 IILKMVMPRPEDALLAPAELGRLTEGNTTSMSRCGSPRVIFNPQIQGTQS **************:... :.**:*.* *: .******::****:* *** C1 GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAV C2 GNLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAV C3 GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAA C4 GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKVLFLVSLIFEAV C5 GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKVLFIVSLIFEAV *:************************************ **:*******. C1 AYILLPAMAHSSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL C2 AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL C3 AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL C4 AYILLPAMAHFSFEAAVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL C5 AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL ********** ****.********************************** C1 LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLSFGIACCFLVY C2 LSFAYSGLLMGSMLVYPVGSYLSNYGWELSFYVVGGVGLLFGIACCFLVY C3 LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLLFGIACCFLVY C4 LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLSLGIACCFLVY C5 LSFAYSGLLMGSMLVYPVAIYLSNFGWELSFYVVGGVGLSFGIACYFLVY ******************. ****:************** :**** **** C1 DTVEQHPRISNEEVDYLRQGKSQLGQQRQPVVTIPWKSLLAAPPVYAFIL C2 DTVEQHPRISDEEVDYLMQGKSQLGLKQQPVVTIPWKSLLAAPPVYAFIL C3 DTVEQHPRISDEEVDYLMQGKSQLGLKQQPVVTIPWKSLLAAPPVYAFIL C4 DTVEQHPRISDEEVEYLRQGKSQLGLQQQPVLRIPWKSLLTAPPAYAFIL C5 DTVEQHPRISDEEVDYLMQGKNQLGLQQQPVLRIPWKSLLTAPPAYAFIL **********:***:** ***.*** ::***: *******:***.***** C1 THMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI C2 THMFHTYTFLVIVQMMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI C3 THMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI C4 THMFHTYSFLVIVQLMPRFMREAMEFELREVGFLSAAPYLGGICSKVMCI C5 THMFHTYSFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI *******:******:***********:*********************** C1 LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILANCDDKILVLVM C2 LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILADCDDKILVLVM C3 LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILVDCDDKILVLVM C4 LGGSYVERRVGSDQNCVRRMLYGICSILTTSLIGVIILADCNNKILVLVM C5 LGGSYVERRVGPDQNCMRRMLYSICSILTTSLIGVIILADCGDKKLVLMM ***********.****:*****.***************.:*.:* ***:* C1 FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGMAHLSGFLAPHLVA C2 FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA C3 FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA C4 FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA C5 FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ************************************:************* C1 ALVHTGSKDEWNVVLMTLIVFNTMAMLVFAFCSSTNLQPWDPRSRMEK-T C2 ALVHTGSKDEWNVVLMTLIAFNTMAMLVFAFCSSTNLQPWDPRSRKEK-T C3 ALVHTGSKDEWNVVLMTLIAFNTMAMLVFAFCSSTNLQPWDPRSRKEK-T C4 ALVHTGSKDEWNVVLVTLIACNTLAMLVFAFCSSTNLQPWDPRSRKEKET C5 ALVHTGSKDEWNVVLMTLIACNTLAMLVFAFCSNTNLQPWDPRSRKEK-T ***************:***. **:*********.*********** ** * C1 ASPSAQESNSo C2 GSPSAQESNSo C3 GSPSAQESNSo C4 GSPRAQDSNS- C5 GSSRAQESNSo .*. **:*** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] lugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 510 type PROTEIN Struct Unchecked Input File /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 510 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10288] Library Relaxation: Multi_proc [72] Relaxation Summary: [10288]--->[10272] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/181/CG7091-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.341 Mb, Max= 30.791 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MSSMSWTLPRLSQSSASTAHGLVGSVRLTYAICAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPAGLSRLTEGNVTSTGRCGSPRVVFNPQIQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAV AYILLPAMAHSSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLSFGIACCFLVY DTVEQHPRISNEEVDYLRQGKSQLGQQRQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILANCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGMAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIVFNTMAMLVFAFCSSTNLQPWDPRSRMEK-T ASPSAQESNSo >C2 MSSMSWNLPRLSQSSASTAHGLVGSVRLTYAICAFLATCIHAAMRNMLGM IILKMVMPRPEDALVASAELGRLSEGNVTATGRCGSPRVVFNPQFQETQS GNLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAV AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVGSYLSNYGWELSFYVVGGVGLLFGIACCFLVY DTVEQHPRISDEEVDYLMQGKSQLGLKQQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQMMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILADCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIAFNTMAMLVFAFCSSTNLQPWDPRSRKEK-T GSPSAQESNSo >C3 MSSMSWTLPRLSQSSASTAHELVGSVRLTYALCAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPAELGRLTEDNVTSTGRCGSPRVVFNPQFQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAA AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLLFGIACCFLVY DTVEQHPRISDEEVDYLMQGKSQLGLKQQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILVDCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIAFNTMAMLVFAFCSSTNLQPWDPRSRKEK-T GSPSAQESNSo >C4 MSSKSWTLPRLSQSSASSAHGLLGSVRLTYAICAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPPEFGRLTEGNITSTGRCGSPRIIFNPQIQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKVLFLVSLIFEAV AYILLPAMAHFSFEAAVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLSLGIACCFLVY DTVEQHPRISDEEVEYLRQGKSQLGLQQQPVLRIPWKSLLTAPPAYAFIL THMFHTYSFLVIVQLMPRFMREAMEFELREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGSDQNCVRRMLYGICSILTTSLIGVIILADCNNKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLVTLIACNTLAMLVFAFCSSTNLQPWDPRSRKEKET GSPRAQDSNS- >C5 MSSKSWTLPRLSQSRASSAHRLLGSVRLTYAICAFLSTCLHAAMRNMLGM IILKMVMPRPEDALLAPAELGRLTEGNTTSMSRCGSPRVIFNPQIQGTQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKVLFIVSLIFEAV AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVAIYLSNFGWELSFYVVGGVGLSFGIACYFLVY DTVEQHPRISDEEVDYLMQGKNQLGLQQQPVLRIPWKSLLTAPPAYAFIL THMFHTYSFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCMRRMLYSICSILTTSLIGVIILADCGDKKLVLMM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIACNTLAMLVFAFCSNTNLQPWDPRSRKEK-T GSSRAQESNSo FORMAT of file /tmp/tmp7759602233351183839aln Not Supported[FATAL:T-COFFEE] >C1 MSSMSWTLPRLSQSSASTAHGLVGSVRLTYAICAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPAGLSRLTEGNVTSTGRCGSPRVVFNPQIQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAV AYILLPAMAHSSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLSFGIACCFLVY DTVEQHPRISNEEVDYLRQGKSQLGQQRQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILANCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGMAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIVFNTMAMLVFAFCSSTNLQPWDPRSRMEK-T ASPSAQESNSo >C2 MSSMSWNLPRLSQSSASTAHGLVGSVRLTYAICAFLATCIHAAMRNMLGM IILKMVMPRPEDALVASAELGRLSEGNVTATGRCGSPRVVFNPQFQETQS GNLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAV AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVGSYLSNYGWELSFYVVGGVGLLFGIACCFLVY DTVEQHPRISDEEVDYLMQGKSQLGLKQQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQMMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILADCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIAFNTMAMLVFAFCSSTNLQPWDPRSRKEK-T GSPSAQESNSo >C3 MSSMSWTLPRLSQSSASTAHELVGSVRLTYALCAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPAELGRLTEDNVTSTGRCGSPRVVFNPQFQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAA AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLLFGIACCFLVY DTVEQHPRISDEEVDYLMQGKSQLGLKQQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILVDCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIAFNTMAMLVFAFCSSTNLQPWDPRSRKEK-T GSPSAQESNSo >C4 MSSKSWTLPRLSQSSASSAHGLLGSVRLTYAICAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPPEFGRLTEGNITSTGRCGSPRIIFNPQIQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKVLFLVSLIFEAV AYILLPAMAHFSFEAAVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLSLGIACCFLVY DTVEQHPRISDEEVEYLRQGKSQLGLQQQPVLRIPWKSLLTAPPAYAFIL THMFHTYSFLVIVQLMPRFMREAMEFELREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGSDQNCVRRMLYGICSILTTSLIGVIILADCNNKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLVTLIACNTLAMLVFAFCSSTNLQPWDPRSRKEKET GSPRAQDSNS- >C5 MSSKSWTLPRLSQSRASSAHRLLGSVRLTYAICAFLSTCLHAAMRNMLGM IILKMVMPRPEDALLAPAELGRLTEGNTTSMSRCGSPRVIFNPQIQGTQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKVLFIVSLIFEAV AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVAIYLSNFGWELSFYVVGGVGLSFGIACYFLVY DTVEQHPRISDEEVDYLMQGKNQLGLQQQPVLRIPWKSLLTAPPAYAFIL THMFHTYSFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCMRRMLYSICSILTTSLIGVIILADCGDKKLVLMM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIACNTLAMLVFAFCSNTNLQPWDPRSRKEK-T GSSRAQESNSo input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:511 S:99 BS:511 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # PW_SEQ_DISTANCES BOT 0 1 95.10 C1 C2 95.10 TOP 1 0 95.10 C2 C1 95.10 BOT 0 2 96.08 C1 C3 96.08 TOP 2 0 96.08 C3 C1 96.08 BOT 0 3 92.53 C1 C4 92.53 TOP 3 0 92.53 C4 C1 92.53 BOT 0 4 91.37 C1 C5 91.37 TOP 4 0 91.37 C5 C1 91.37 BOT 1 2 97.06 C2 C3 97.06 TOP 2 1 97.06 C3 C2 97.06 BOT 1 3 91.94 C2 C4 91.94 TOP 3 1 91.94 C4 C2 91.94 BOT 1 4 91.57 C2 C5 91.57 TOP 4 1 91.57 C5 C2 91.57 BOT 2 3 92.93 C3 C4 92.93 TOP 3 2 92.93 C4 C3 92.93 BOT 2 4 92.35 C3 C5 92.35 TOP 4 2 92.35 C5 C3 92.35 BOT 3 4 93.71 C4 C5 93.71 TOP 4 3 93.71 C5 C4 93.71 AVG 0 C1 * 93.77 AVG 1 C2 * 93.92 AVG 2 C3 * 94.60 AVG 3 C4 * 92.78 AVG 4 C5 * 92.25 TOT TOT * 93.46 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAGCAGCATGTCATGGACCCTGCCACGCCTCTCGCAGTCCAGTGCATC C2 ATGAGCAGCATGTCATGGAACCTGCCACGCCTCTCGCAGTCCAGCGCCTC C3 ATGAGCAGCATGTCATGGACCCTGCCACGCCTCTCACAGTCCAGCGCCTC C4 ATGAGCAGCAAGTCGTGGACGCTGCCACGCCTCTCGCAGTCCAGCGCCTC C5 ATGAGCAGCAAGTCGTGGACGCTGCCACGCCTCTCGCAGTCCAGAGCCTC **********:***.****. **************.******** **.** C1 CACCGCCCACGGACTAGTGGGTTCCGTTCGCCTGACCTACGCCATATGTG C2 CACCGCCCACGGACTGGTGGGTTCCGTCCGCCTGACCTACGCCATATGTG C3 CACCGCCCACGAACTCGTGGGTTCCGTCCGCTTGACCTACGCCTTATGTG C4 CTCCGCCCACGGACTGCTGGGATCCGTCCGTCTGACCTACGCCATATGCG C5 CTCCGCCCACAGACTGCTGGGATCTGTCCGCCTGACCTACGCCATATGCG *:********..*** ****:** ** ** ***********:**** * C1 CCTTTTTGGCAACTTGCCTACACGCCGCCATGAGGAACATGCTCGGCATG C2 CCTTTCTGGCCACTTGCATACACGCCGCCATGAGGAACATGCTCGGCATG C3 CCTTCCTAGCCACTTGCCTACACGCCGCCATGAGGAACATGCTCGGCATG C4 CCTTCCTGGCCACTTGCCTGCACGCCGCCATGAGGAACATGCTCGGCATG C5 CCTTCCTGTCCACTTGCCTGCACGCCGCCATGAGGAACATGCTCGGCATG **** *. *.******.*.****************************** C1 ATCATCCTCAAGATGGTCATGCCCCGGCCGGAGGATGCACTGGTCGTTCC C2 ATCATCCTCAAGATGGTCATGCCCCGGCCGGAGGATGCACTGGTCGCTTC C3 ATCATTCTTAAGATGGTCATGCCCCGGCCGGAGGATGCACTGGTCGTTCC C4 ATCATCCTGAAGATGGTCATGCCTCGGCCGGAGGATGCACTGGTTGTGCC C5 ATCATCCTCAAGATGGTCATGCCTCGGCCGGAGGATGCACTGCTCGCTCC ***** ** ************** ****************** * * * C1 AGCGGGGTTGAGTCGCCTAACGGAGGGCAATGTCACCTCCACGGGTCGAT C2 AGCGGAGTTGGGTCGCTTATCGGAGGGCAATGTCACCGCCACGGGGCGAT C3 AGCGGAGTTGGGACGCCTAACGGAGGACAATGTCACCTCCACGGGGCGAT C4 ACCGGAGTTTGGTCGCCTAACGGAGGGAAATATCACCTCCACGGGGCGGT C5 AGCGGAGTTGGGTCGCCTAACGGAGGGCAATACCACCTCCATGAGCCGAT * ***.*** .*:*** **:******..***. **** *** *.* **.* C1 GTGGATCTCCTCGGGTCGTTTTCAATCCGCAGATTCAAGAGACTCAGTCG C2 GTGGATCTCCTCGGGTCGTTTTTAACCCACAGTTCCAGGAAACTCAGTCT C3 GTGGATCTCCTCGGGTCGTTTTTAACCCACAGTTCCAGGAAACTCAGTCG C4 GTGGCTCTCCTCGGATCATTTTCAATCCCCAAATCCAAGAGACTCAGTCT C5 GTGGATCCCCTCGGGTCATTTTCAATCCGCAGATCCAAGGGACTCAGTCG ****.** ******.**.**** ** ** **.:* **.*..******** C1 GGCGACTTACCATGGACCCGAAACCAGGAGCTGACCTTCCCAGGTGTCTA C2 GGCAACTTACCATGGACCCGAAACCAGGAGCTGACCTTCCCGGGTGTCTA C3 GGCGACTTACCATGGACTCGAAACCAGGAGTTGACCTTCCCAGGTGTCTA C4 GGCGACCTGCCATGGACCCGAAATCAGGAGCTGACGTTCCCTGGTGTTTA C5 GGCGACTTACCATGGACCCGAAACCAGGAGCTGACGTTCCCAGGTGTTTA ***.** *.******** ***** ****** **** ***** ***** ** C1 CTACTATGGCTACGTGGTTTCCATCTCGCTATCCGGCTATCTGGCAGATC C2 CTACTATGGCTACGTGGTTTCCATCTCGCTATCCGGCTACCTGGCAGATC C3 CTACTATGGCTACGTGGTTTCCATCTCGCTATCCGGCTACCTGGCAGATC C4 CTACTATGGCTACGTGGTTTCCATCTCGTTATCCGGCTACCTGGCAGATC C5 CTACTATGGCTACGTGGTTTCCATCTCGTTATCCGGCTATCTGGCAGATC **************************** ********** ********** C1 GGTGCAGCAGCAAGCGGCTGTTCATCGTGTCCCTGATCTTCGAGGCTGTG C2 GGTGCAGCAGCAAGCGACTGTTCATCGTGTCCCTGATCTTTGAGGCGGTG C3 GGTGCAGCAGCAAGCGACTGTTCATCGTGTCCCTGATCTTTGAGGCGGCG C4 GGTGCAGCAGCAAGGTGCTGTTCCTCGTGTCCCTAATCTTCGAGGCGGTG C5 GGTGCAGCAGCAAGGTGCTGTTCATCGTGTCCCTGATCTTCGAGGCGGTG ************** .******.**********.***** ***** * * C1 GCCTACATACTGCTCCCAGCAATGGCGCACTCTAGTTTCGAGGCCGGAGT C2 GCCTACATACTGCTCCCAGCGATGGCGCACTTTAGTTTCGAGGCCGGAGT C3 GCCTACATCCTTCTGCCAGCGATGGCGCACTTTAGTTTCGAGGCCGGAGT C4 GCCTACATCCTGCTCCCAGCGATGGCGCATTTTAGCTTCGAGGCCGCAGT C5 GCCTACATCCTGCTTCCAGCGATGGCGCATTTTAGTTTCGAGGCCGGAGT ********.** ** *****.******** * *** ********** *** C1 GGTTGATCTGGTCATCTGTGGTTTACTGGCGGGCTGTGGAAATCCGGCAA C2 GGTTGATCTGGTCATTTGTGGCTTACTGGCGGGCTGTGGAAATCCGGCCA C3 GGTTGATCTGGTCATTTGTGGCTTACTGGCGGGCTGTGGAAATCCGGCCA C4 TGTTGATCTGGTCATTTGCGGCTTGCTGGCCGGCTGTGGCAATCCTGCAA C5 TGTTGATCTGGTCATTTGTGGCTTGCTGGCGGGCTGTGGCAATCCTGCGA ************** ** ** **.***** ********.***** ** * C1 TGTATAAACTGTTCGTGACCTGGGCTCATCCCACAGAGAGAACAGCGCTC C2 TGTACAAGCTGTTCGTGACCTGGGCTCATCCCACAGAGAGAACGGCGCTC C3 TGTACAAGCTGTTCGTGACCTGGGCTCATCCCACAGAGAGAACGGCGCTT C4 TGTACAAACTGTTTGTGACCTGGGCTCATCCCACTGAGAGAACAGCGCTC C5 TGTACAAGTTGTTTGTGACTTGGGCTCATCCCACAGAGAGAACAGCGCTC **** **. **** ***** **************:********.***** C1 CTGTCCTTCGCCTACAGTGGTCTTCTGATGGGCTCCATGTTGGTTTACCC C2 CTGTCCTTCGCCTACAGCGGCCTTCTGATGGGCTCTATGTTGGTTTACCC C3 CTGTCCTTCGCCTACAGCGGCCTTCTGATGGGCTCCATGTTGGTTTACCC C4 CTATCCTTCGCCTACAGTGGACTTCTGATGGGCTCCATGTTGGTTTACCC C5 CTGTCCTTCGCCTACAGTGGTCTTCTGATGGGCTCCATGTTGGTTTACCC **.************** ** ************** ************** C1 GGTGGCCAGTTATCTGAGCAACTTCGGCTGGGAACTGTCCTTCTATGTAG C2 GGTGGGCAGTTACCTAAGCAACTACGGCTGGGAGCTGTCCTTCTATGTAG C3 GGTGGCCAGTTACCTGAGCAACTTCGGCTGGGAGCTGTCCTTCTATGTAG C4 GGTGGCCAGTTACCTGAGCAACTTCGGCTGGGAGCTGTCCTTCTATGTAG C5 GGTTGCCATTTACCTGAGCAACTTTGGCTGGGAGCTGTCCTTCTACGTAG *** * ** *** **.*******: ********.*********** **** C1 TCGGTGGAGTTGGCCTCTCATTCGGCATTGCCTGCTGCTTTCTCGTTTAC C2 TCGGTGGAGTTGGCCTCTTATTCGGCATTGCCTGCTGCTTTCTCGTTTAC C3 TCGGTGGAGTTGGCCTCTTATTCGGCATTGCCTGCTGTTTTCTCGTTTAC C4 TAGGTGGGGTTGGCCTTTCCTTAGGCATTGCCTGCTGCTTTCTCGTTTAT C5 TCGGTGGGGTTGGCCTTTCCTTCGGCATTGCCTGCTACTTTCTCGTTTAT *.*****.******** * .**.*************. *********** C1 GACACCGTGGAGCAACATCCAAGGATATCGAATGAGGAGGTGGATTACCT C2 GACACCGTAGAACAGCATCCAAGGATATCGGATGAGGAGGTGGATTACCT C3 GACACCGTAGAGCAGCATCCAAGGATATCGGATGAGGAGGTGGATTACCT C4 GACACTGTGGAGCAGCATCCAAGGATATCGGATGAGGAGGTTGAATACCT C5 GACACTGTAGAGCAGCATCCCAGAATATCGGATGAGGAGGTGGATTACCT ***** **.**.**.*****.**.******.********** **:***** C1 GAGGCAGGGCAAGAGTCAATTGGGACAGCAGCGGCAGCCAGTGGTAACCA C2 GATGCAGGGCAAGAGTCAATTGGGACTAAAGCAGCAGCCTGTGGTAACCA C3 GATGCAGGGCAAGAGTCAATTGGGACTAAAGCAGCAGCCTGTGGTAACCA C4 TAGGCAGGGAAAGAGCCAATTGGGCCTTCAGCAGCAGCCAGTGCTGCGGA C5 GATGCAGGGAAAAAACCAATTGGGCCTTCAGCAGCAGCCAGTGCTAAGGA * ******.**.*. ********.*: .***.******:*** *.. * C1 TTCCCTGGAAGAGCCTGCTCGCCGCGCCGCCCGTCTACGCCTTCATCCTG C2 TTCCCTGGAAGAGCCTGCTCGCCGCGCCGCCCGTCTACGCCTTCATCCTG C3 TTCCCTGGAAGAGCCTGCTCGCCGCGCCGCCCGTCTACGCCTTCATCCTG C4 TTCCCTGGAAGAGCCTGCTAACCGCTCCGCCCGCCTACGCCTTCATCCTG C5 TTCCCTGGAAGAGCCTGCTCACCGCTCCGCCCGCCTATGCCTTCATCCTG *******************..**** ******* *** ************ C1 ACCCACATGTTCCACACCTACACCTTCCTGGTGATTGTGCAACTGATGCC C2 ACCCACATGTTCCACACCTACACCTTCCTGGTGATTGTGCAAATGATGCC C3 ACCCACATGTTCCACACCTACACCTTCCTGGTGATTGTCCAACTGATGCC C4 ACCCACATGTTCCACACATACTCCTTTCTGGTGATTGTACAACTGATGCC C5 ACCCACATGTTCCACACCTACTCCTTTCTGGTGATTGTACAACTGATGCC *****************.***:**** *********** ***.******* C1 GCGATTTATGCGCGAGGCCATGGAGTTCGATCTCCGCGAGGTGGGCTTCC C2 GCGATTTATGCGCGAGGCCATGGAGTTCGATCTGCGCGAGGTGGGCTTTC C3 GCGATTTATGCGCGAGGCCATGGAGTTCGATCTGCGCGAGGTGGGCTTTC C4 GCGATTTATGCGCGAGGCCATGGAATTTGAGCTGCGCGAGGTGGGTTTCC C5 GCGATTTATGCGCGAGGCCATGGAGTTCGATCTGCGCGAGGTGGGCTTCC ************************.** ** ** *********** ** * C1 TCTCGGCGGCGCCGTATCTGGGCGGGATCTGCTCGAAGGTGATGTGCATC C2 TCTCGGCGGCGCCGTATCTGGGCGGGATCTGCTCGAAGGTCATGTGCATC C3 TCTCGGCGGCGCCGTATCTGGGTGGGATCTGCTCGAAGGTCATGTGCATC C4 TCTCGGCTGCTCCGTATCTGGGCGGGATCTGCTCGAAGGTGATGTGCATC C5 TCTCGGCGGCGCCGTATCTGGGCGGGATCTGCTCAAAGGTGATGTGCATC ******* ** *********** ***********.***** ********* C1 CTGGGTGGCAGCTATGTGGAACGACGCGTGGGTCCTGACCAGAATTGTGT C2 CTGGGTGGCAGCTATGTGGAACGACGCGTGGGTCCTGACCAGAACTGTGT C3 CTGGGTGGCAGCTACGTGGAACGACGCGTGGGTCCTGACCAGAACTGTGT C4 CTGGGTGGCAGCTACGTGGAACGTCGCGTGGGTTCTGACCAGAACTGTGT C5 CTGGGTGGCAGCTACGTGGAACGTCGTGTGGGTCCTGACCAGAACTGTAT ************** ********:** ****** ********** ***.* C1 GCGAAGAATGCTGTACGGGATCTGCAGCATCCTGACCACTTCTTTGATTG C2 GCGGAGAATGCTGTACGGGATCTGCAGCATCCTGACCACTTCTTTGATTG C3 GCGGAGAATGCTGTACGGGATCTGCAGCATCCTGACCACTTCTTTGATTG C4 GCGGAGAATGCTGTACGGGATCTGCAGCATCCTGACCACTTCTTTGATTG C5 GCGGAGAATGCTGTACTCGATCTGCAGCATCCTGACCACTTCTTTGATTG ***.************ ******************************** C1 GGGTCATCATCCTGGCTAATTGTGATGACAAAATACTAGTACTTGTGATG C2 GGGTCATCATCCTGGCGGATTGTGATGACAAAATACTAGTTCTTGTGATG C3 GGGTCATCATCCTGGTTGATTGTGATGACAAAATACTAGTACTTGTGATG C4 GGGTCATCATCCTGGCTGATTGCAATAACAAAATACTGGTACTTGTGATG C5 GGGTCATCATCCTGGCTGATTGTGGTGATAAAAAACTGGTACTTATGATG *************** .**** ..*.* ****:***.**:***.***** C1 TTTGCCTTCATGATGGCCACTACGGATATGGGTTTCAGTGGCTACTGGCC C2 TTTGCCTTCATGATGGCCACTACGGATATGGGTTTCAGTGGCTACTGGCC C3 TTTGCCTTCATGATGGCCACTACGGATATGGGTTTCAGTGGCTACTGGCC C4 TTCGCCTTCATGATGGCCACTACGGATATGGGTTTCAGTGGCTACTGGCC C5 TTCGCCTTCATGATGGCCACTACGGATATGGGTTTCAGTGGCTACTGGCC ** *********************************************** C1 CACGCTGCTCTACTTTGCGCCCTCCTTCGCGGGATTGCTATCGGGATTGG C2 CACGCTGCTCTACTTTGCGCCCTCCTTCGCGGGATTGCTTTCGGGATTGG C3 CACGCTGCTCTACTTTGCGCCCTCCTTCGCGGGATTGCTTTCGGGATTGG C4 CACGCTGCTCTACTTTGCGCCCTCCTTCGCGGGATTGCTTTCGGGTCTGG C5 CACGCTGCTCTACTTTGCGCCCTCCTTCGCAGGATTGCTCTCGGGATTGG ******************************.******** *****: *** C1 CCAATGGAATGGCCCATCTTTCCGGATTCTTAGCTCCCCATCTTGTGGCC C2 CCAATGGACTGGCCCATCTCTCCGGATTCCTAGCTCCCCATCTTGTCGCT C3 CCAATGGACTGGCCCATCTCTCCGGATTCCTAGCTCCCCATCTTGTCGCC C4 CCAACGGACTGGCTCACCTTTCCGGATTCCTAGCTCCCCACCTTGTCGCC C5 CCAATGGACTGGCCCACCTTTCTGGATTCCTAGCTCCGCACCTTGTTGCC **** ***.**** ** ** ** ****** ******* ** ***** ** C1 GCTCTGGTCCACACTGGCAGCAAGGATGAGTGGAATGTGGTGTTGATGAC C2 GCTCTGGTCCACACTGGCAGCAAGGATGAGTGGAATGTGGTGTTGATGAC C3 GCTCTGGTGCACACTGGCAGCAAGGATGAGTGGAATGTGGTGTTGATGAC C4 GCTCTGGTTCACACTGGCAGCAAGGATGAGTGGAATGTGGTGCTGGTGAC C5 GCTCTGGTTCACACTGGCAGCAAGGATGAATGGAACGTGGTGCTGATGAC ******** ********************.***** ****** **.**** C1 GCTGATTGTCTTTAATACGATGGCCATGTTGGTATTTGCATTTTGCAGCA C2 GCTGATTGCCTTTAATACGATGGCCATGTTAGTATTTGCATTTTGCAGCA C3 GCTGATTGCCTTTAATACGATGGCCATGTTGGTATTTGCCTTTTGCAGCA C4 GCTGATTGCCTGTAATACGCTGGCCATGTTGGTATTTGCGTTTTGCAGCA C5 GCTGATTGCCTGCAATACGCTGGCCATGTTGGTATTTGCATTTTGCAGCA ******** ** ******.**********.******** ********** C1 GTACGAACCTACAACCTTGGGATCCTCGTAGCAGAATGGAGAAA---ACT C2 GTACGAACCTACAACCTTGGGATCCTCGTAGCAGAAAGGAGAAA---ACT C3 GTACGAACCTACAACCTTGGGATCCTCGTAGCAGAAAGGAGAAA---ACT C4 GTACGAACCTACAACCTTGGGATCCTCGTAGCAGAAAAGAGAAAGAGACC C5 ATACGAACCTACAACCTTGGGATCCTCGTAGCAGAAAAGAGAAA---ACT .***********************************:.****** ** C1 GCATCACCAAGTGCTCAGGAATCAAATAGT--- C2 GGATCACCAAGTGCTCAGGAATCGAATAGT--- C3 GGATCACCAAGTGCTCAGGAATCGAATAGT--- C4 GGGTCACCACGTGCTCAGGATTCGAATAGT--- C5 GGGTCTTCACGTGCTCAGGAATCGAATAGT--- * .**: **.**********:**.****** >C1 ATGAGCAGCATGTCATGGACCCTGCCACGCCTCTCGCAGTCCAGTGCATC CACCGCCCACGGACTAGTGGGTTCCGTTCGCCTGACCTACGCCATATGTG CCTTTTTGGCAACTTGCCTACACGCCGCCATGAGGAACATGCTCGGCATG ATCATCCTCAAGATGGTCATGCCCCGGCCGGAGGATGCACTGGTCGTTCC AGCGGGGTTGAGTCGCCTAACGGAGGGCAATGTCACCTCCACGGGTCGAT GTGGATCTCCTCGGGTCGTTTTCAATCCGCAGATTCAAGAGACTCAGTCG GGCGACTTACCATGGACCCGAAACCAGGAGCTGACCTTCCCAGGTGTCTA CTACTATGGCTACGTGGTTTCCATCTCGCTATCCGGCTATCTGGCAGATC GGTGCAGCAGCAAGCGGCTGTTCATCGTGTCCCTGATCTTCGAGGCTGTG GCCTACATACTGCTCCCAGCAATGGCGCACTCTAGTTTCGAGGCCGGAGT GGTTGATCTGGTCATCTGTGGTTTACTGGCGGGCTGTGGAAATCCGGCAA TGTATAAACTGTTCGTGACCTGGGCTCATCCCACAGAGAGAACAGCGCTC CTGTCCTTCGCCTACAGTGGTCTTCTGATGGGCTCCATGTTGGTTTACCC GGTGGCCAGTTATCTGAGCAACTTCGGCTGGGAACTGTCCTTCTATGTAG TCGGTGGAGTTGGCCTCTCATTCGGCATTGCCTGCTGCTTTCTCGTTTAC GACACCGTGGAGCAACATCCAAGGATATCGAATGAGGAGGTGGATTACCT GAGGCAGGGCAAGAGTCAATTGGGACAGCAGCGGCAGCCAGTGGTAACCA TTCCCTGGAAGAGCCTGCTCGCCGCGCCGCCCGTCTACGCCTTCATCCTG ACCCACATGTTCCACACCTACACCTTCCTGGTGATTGTGCAACTGATGCC GCGATTTATGCGCGAGGCCATGGAGTTCGATCTCCGCGAGGTGGGCTTCC TCTCGGCGGCGCCGTATCTGGGCGGGATCTGCTCGAAGGTGATGTGCATC CTGGGTGGCAGCTATGTGGAACGACGCGTGGGTCCTGACCAGAATTGTGT GCGAAGAATGCTGTACGGGATCTGCAGCATCCTGACCACTTCTTTGATTG GGGTCATCATCCTGGCTAATTGTGATGACAAAATACTAGTACTTGTGATG TTTGCCTTCATGATGGCCACTACGGATATGGGTTTCAGTGGCTACTGGCC CACGCTGCTCTACTTTGCGCCCTCCTTCGCGGGATTGCTATCGGGATTGG CCAATGGAATGGCCCATCTTTCCGGATTCTTAGCTCCCCATCTTGTGGCC GCTCTGGTCCACACTGGCAGCAAGGATGAGTGGAATGTGGTGTTGATGAC GCTGATTGTCTTTAATACGATGGCCATGTTGGTATTTGCATTTTGCAGCA GTACGAACCTACAACCTTGGGATCCTCGTAGCAGAATGGAGAAA---ACT GCATCACCAAGTGCTCAGGAATCAAATAGT--- >C2 ATGAGCAGCATGTCATGGAACCTGCCACGCCTCTCGCAGTCCAGCGCCTC CACCGCCCACGGACTGGTGGGTTCCGTCCGCCTGACCTACGCCATATGTG CCTTTCTGGCCACTTGCATACACGCCGCCATGAGGAACATGCTCGGCATG ATCATCCTCAAGATGGTCATGCCCCGGCCGGAGGATGCACTGGTCGCTTC AGCGGAGTTGGGTCGCTTATCGGAGGGCAATGTCACCGCCACGGGGCGAT GTGGATCTCCTCGGGTCGTTTTTAACCCACAGTTCCAGGAAACTCAGTCT GGCAACTTACCATGGACCCGAAACCAGGAGCTGACCTTCCCGGGTGTCTA CTACTATGGCTACGTGGTTTCCATCTCGCTATCCGGCTACCTGGCAGATC GGTGCAGCAGCAAGCGACTGTTCATCGTGTCCCTGATCTTTGAGGCGGTG GCCTACATACTGCTCCCAGCGATGGCGCACTTTAGTTTCGAGGCCGGAGT GGTTGATCTGGTCATTTGTGGCTTACTGGCGGGCTGTGGAAATCCGGCCA TGTACAAGCTGTTCGTGACCTGGGCTCATCCCACAGAGAGAACGGCGCTC CTGTCCTTCGCCTACAGCGGCCTTCTGATGGGCTCTATGTTGGTTTACCC GGTGGGCAGTTACCTAAGCAACTACGGCTGGGAGCTGTCCTTCTATGTAG TCGGTGGAGTTGGCCTCTTATTCGGCATTGCCTGCTGCTTTCTCGTTTAC GACACCGTAGAACAGCATCCAAGGATATCGGATGAGGAGGTGGATTACCT GATGCAGGGCAAGAGTCAATTGGGACTAAAGCAGCAGCCTGTGGTAACCA TTCCCTGGAAGAGCCTGCTCGCCGCGCCGCCCGTCTACGCCTTCATCCTG ACCCACATGTTCCACACCTACACCTTCCTGGTGATTGTGCAAATGATGCC GCGATTTATGCGCGAGGCCATGGAGTTCGATCTGCGCGAGGTGGGCTTTC TCTCGGCGGCGCCGTATCTGGGCGGGATCTGCTCGAAGGTCATGTGCATC CTGGGTGGCAGCTATGTGGAACGACGCGTGGGTCCTGACCAGAACTGTGT GCGGAGAATGCTGTACGGGATCTGCAGCATCCTGACCACTTCTTTGATTG GGGTCATCATCCTGGCGGATTGTGATGACAAAATACTAGTTCTTGTGATG TTTGCCTTCATGATGGCCACTACGGATATGGGTTTCAGTGGCTACTGGCC CACGCTGCTCTACTTTGCGCCCTCCTTCGCGGGATTGCTTTCGGGATTGG CCAATGGACTGGCCCATCTCTCCGGATTCCTAGCTCCCCATCTTGTCGCT GCTCTGGTCCACACTGGCAGCAAGGATGAGTGGAATGTGGTGTTGATGAC GCTGATTGCCTTTAATACGATGGCCATGTTAGTATTTGCATTTTGCAGCA GTACGAACCTACAACCTTGGGATCCTCGTAGCAGAAAGGAGAAA---ACT GGATCACCAAGTGCTCAGGAATCGAATAGT--- >C3 ATGAGCAGCATGTCATGGACCCTGCCACGCCTCTCACAGTCCAGCGCCTC CACCGCCCACGAACTCGTGGGTTCCGTCCGCTTGACCTACGCCTTATGTG CCTTCCTAGCCACTTGCCTACACGCCGCCATGAGGAACATGCTCGGCATG ATCATTCTTAAGATGGTCATGCCCCGGCCGGAGGATGCACTGGTCGTTCC AGCGGAGTTGGGACGCCTAACGGAGGACAATGTCACCTCCACGGGGCGAT GTGGATCTCCTCGGGTCGTTTTTAACCCACAGTTCCAGGAAACTCAGTCG GGCGACTTACCATGGACTCGAAACCAGGAGTTGACCTTCCCAGGTGTCTA CTACTATGGCTACGTGGTTTCCATCTCGCTATCCGGCTACCTGGCAGATC GGTGCAGCAGCAAGCGACTGTTCATCGTGTCCCTGATCTTTGAGGCGGCG GCCTACATCCTTCTGCCAGCGATGGCGCACTTTAGTTTCGAGGCCGGAGT GGTTGATCTGGTCATTTGTGGCTTACTGGCGGGCTGTGGAAATCCGGCCA TGTACAAGCTGTTCGTGACCTGGGCTCATCCCACAGAGAGAACGGCGCTT CTGTCCTTCGCCTACAGCGGCCTTCTGATGGGCTCCATGTTGGTTTACCC GGTGGCCAGTTACCTGAGCAACTTCGGCTGGGAGCTGTCCTTCTATGTAG TCGGTGGAGTTGGCCTCTTATTCGGCATTGCCTGCTGTTTTCTCGTTTAC GACACCGTAGAGCAGCATCCAAGGATATCGGATGAGGAGGTGGATTACCT GATGCAGGGCAAGAGTCAATTGGGACTAAAGCAGCAGCCTGTGGTAACCA TTCCCTGGAAGAGCCTGCTCGCCGCGCCGCCCGTCTACGCCTTCATCCTG ACCCACATGTTCCACACCTACACCTTCCTGGTGATTGTCCAACTGATGCC GCGATTTATGCGCGAGGCCATGGAGTTCGATCTGCGCGAGGTGGGCTTTC TCTCGGCGGCGCCGTATCTGGGTGGGATCTGCTCGAAGGTCATGTGCATC CTGGGTGGCAGCTACGTGGAACGACGCGTGGGTCCTGACCAGAACTGTGT GCGGAGAATGCTGTACGGGATCTGCAGCATCCTGACCACTTCTTTGATTG GGGTCATCATCCTGGTTGATTGTGATGACAAAATACTAGTACTTGTGATG TTTGCCTTCATGATGGCCACTACGGATATGGGTTTCAGTGGCTACTGGCC CACGCTGCTCTACTTTGCGCCCTCCTTCGCGGGATTGCTTTCGGGATTGG CCAATGGACTGGCCCATCTCTCCGGATTCCTAGCTCCCCATCTTGTCGCC GCTCTGGTGCACACTGGCAGCAAGGATGAGTGGAATGTGGTGTTGATGAC GCTGATTGCCTTTAATACGATGGCCATGTTGGTATTTGCCTTTTGCAGCA GTACGAACCTACAACCTTGGGATCCTCGTAGCAGAAAGGAGAAA---ACT GGATCACCAAGTGCTCAGGAATCGAATAGT--- >C4 ATGAGCAGCAAGTCGTGGACGCTGCCACGCCTCTCGCAGTCCAGCGCCTC CTCCGCCCACGGACTGCTGGGATCCGTCCGTCTGACCTACGCCATATGCG CCTTCCTGGCCACTTGCCTGCACGCCGCCATGAGGAACATGCTCGGCATG ATCATCCTGAAGATGGTCATGCCTCGGCCGGAGGATGCACTGGTTGTGCC ACCGGAGTTTGGTCGCCTAACGGAGGGAAATATCACCTCCACGGGGCGGT GTGGCTCTCCTCGGATCATTTTCAATCCCCAAATCCAAGAGACTCAGTCT GGCGACCTGCCATGGACCCGAAATCAGGAGCTGACGTTCCCTGGTGTTTA CTACTATGGCTACGTGGTTTCCATCTCGTTATCCGGCTACCTGGCAGATC GGTGCAGCAGCAAGGTGCTGTTCCTCGTGTCCCTAATCTTCGAGGCGGTG GCCTACATCCTGCTCCCAGCGATGGCGCATTTTAGCTTCGAGGCCGCAGT TGTTGATCTGGTCATTTGCGGCTTGCTGGCCGGCTGTGGCAATCCTGCAA TGTACAAACTGTTTGTGACCTGGGCTCATCCCACTGAGAGAACAGCGCTC CTATCCTTCGCCTACAGTGGACTTCTGATGGGCTCCATGTTGGTTTACCC GGTGGCCAGTTACCTGAGCAACTTCGGCTGGGAGCTGTCCTTCTATGTAG TAGGTGGGGTTGGCCTTTCCTTAGGCATTGCCTGCTGCTTTCTCGTTTAT GACACTGTGGAGCAGCATCCAAGGATATCGGATGAGGAGGTTGAATACCT TAGGCAGGGAAAGAGCCAATTGGGCCTTCAGCAGCAGCCAGTGCTGCGGA TTCCCTGGAAGAGCCTGCTAACCGCTCCGCCCGCCTACGCCTTCATCCTG ACCCACATGTTCCACACATACTCCTTTCTGGTGATTGTACAACTGATGCC GCGATTTATGCGCGAGGCCATGGAATTTGAGCTGCGCGAGGTGGGTTTCC TCTCGGCTGCTCCGTATCTGGGCGGGATCTGCTCGAAGGTGATGTGCATC CTGGGTGGCAGCTACGTGGAACGTCGCGTGGGTTCTGACCAGAACTGTGT GCGGAGAATGCTGTACGGGATCTGCAGCATCCTGACCACTTCTTTGATTG GGGTCATCATCCTGGCTGATTGCAATAACAAAATACTGGTACTTGTGATG TTCGCCTTCATGATGGCCACTACGGATATGGGTTTCAGTGGCTACTGGCC CACGCTGCTCTACTTTGCGCCCTCCTTCGCGGGATTGCTTTCGGGTCTGG CCAACGGACTGGCTCACCTTTCCGGATTCCTAGCTCCCCACCTTGTCGCC GCTCTGGTTCACACTGGCAGCAAGGATGAGTGGAATGTGGTGCTGGTGAC GCTGATTGCCTGTAATACGCTGGCCATGTTGGTATTTGCGTTTTGCAGCA GTACGAACCTACAACCTTGGGATCCTCGTAGCAGAAAAGAGAAAGAGACC GGGTCACCACGTGCTCAGGATTCGAATAGT--- >C5 ATGAGCAGCAAGTCGTGGACGCTGCCACGCCTCTCGCAGTCCAGAGCCTC CTCCGCCCACAGACTGCTGGGATCTGTCCGCCTGACCTACGCCATATGCG CCTTCCTGTCCACTTGCCTGCACGCCGCCATGAGGAACATGCTCGGCATG ATCATCCTCAAGATGGTCATGCCTCGGCCGGAGGATGCACTGCTCGCTCC AGCGGAGTTGGGTCGCCTAACGGAGGGCAATACCACCTCCATGAGCCGAT GTGGATCCCCTCGGGTCATTTTCAATCCGCAGATCCAAGGGACTCAGTCG GGCGACTTACCATGGACCCGAAACCAGGAGCTGACGTTCCCAGGTGTTTA CTACTATGGCTACGTGGTTTCCATCTCGTTATCCGGCTATCTGGCAGATC GGTGCAGCAGCAAGGTGCTGTTCATCGTGTCCCTGATCTTCGAGGCGGTG GCCTACATCCTGCTTCCAGCGATGGCGCATTTTAGTTTCGAGGCCGGAGT TGTTGATCTGGTCATTTGTGGCTTGCTGGCGGGCTGTGGCAATCCTGCGA TGTACAAGTTGTTTGTGACTTGGGCTCATCCCACAGAGAGAACAGCGCTC CTGTCCTTCGCCTACAGTGGTCTTCTGATGGGCTCCATGTTGGTTTACCC GGTTGCCATTTACCTGAGCAACTTTGGCTGGGAGCTGTCCTTCTACGTAG TCGGTGGGGTTGGCCTTTCCTTCGGCATTGCCTGCTACTTTCTCGTTTAT GACACTGTAGAGCAGCATCCCAGAATATCGGATGAGGAGGTGGATTACCT GATGCAGGGAAAAAACCAATTGGGCCTTCAGCAGCAGCCAGTGCTAAGGA TTCCCTGGAAGAGCCTGCTCACCGCTCCGCCCGCCTATGCCTTCATCCTG ACCCACATGTTCCACACCTACTCCTTTCTGGTGATTGTACAACTGATGCC GCGATTTATGCGCGAGGCCATGGAGTTCGATCTGCGCGAGGTGGGCTTCC TCTCGGCGGCGCCGTATCTGGGCGGGATCTGCTCAAAGGTGATGTGCATC CTGGGTGGCAGCTACGTGGAACGTCGTGTGGGTCCTGACCAGAACTGTAT GCGGAGAATGCTGTACTCGATCTGCAGCATCCTGACCACTTCTTTGATTG GGGTCATCATCCTGGCTGATTGTGGTGATAAAAAACTGGTACTTATGATG TTCGCCTTCATGATGGCCACTACGGATATGGGTTTCAGTGGCTACTGGCC CACGCTGCTCTACTTTGCGCCCTCCTTCGCAGGATTGCTCTCGGGATTGG CCAATGGACTGGCCCACCTTTCTGGATTCCTAGCTCCGCACCTTGTTGCC GCTCTGGTTCACACTGGCAGCAAGGATGAATGGAACGTGGTGCTGATGAC GCTGATTGCCTGCAATACGCTGGCCATGTTGGTATTTGCATTTTGCAGCA ATACGAACCTACAACCTTGGGATCCTCGTAGCAGAAAAGAGAAA---ACT GGGTCTTCACGTGCTCAGGAATCGAATAGT--- >C1 MSSMSWTLPRLSQSSASTAHGLVGSVRLTYAICAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPAGLSRLTEGNVTSTGRCGSPRVVFNPQIQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAV AYILLPAMAHSSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLSFGIACCFLVY DTVEQHPRISNEEVDYLRQGKSQLGQQRQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILANCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGMAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIVFNTMAMLVFAFCSSTNLQPWDPRSRMEKoT ASPSAQESNS >C2 MSSMSWNLPRLSQSSASTAHGLVGSVRLTYAICAFLATCIHAAMRNMLGM IILKMVMPRPEDALVASAELGRLSEGNVTATGRCGSPRVVFNPQFQETQS GNLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAV AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVGSYLSNYGWELSFYVVGGVGLLFGIACCFLVY DTVEQHPRISDEEVDYLMQGKSQLGLKQQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQMMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILADCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIAFNTMAMLVFAFCSSTNLQPWDPRSRKEKoT GSPSAQESNS >C3 MSSMSWTLPRLSQSSASTAHELVGSVRLTYALCAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPAELGRLTEDNVTSTGRCGSPRVVFNPQFQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAA AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLLFGIACCFLVY DTVEQHPRISDEEVDYLMQGKSQLGLKQQPVVTIPWKSLLAAPPVYAFIL THMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCVRRMLYGICSILTTSLIGVIILVDCDDKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIAFNTMAMLVFAFCSSTNLQPWDPRSRKEKoT GSPSAQESNS >C4 MSSKSWTLPRLSQSSASSAHGLLGSVRLTYAICAFLATCLHAAMRNMLGM IILKMVMPRPEDALVVPPEFGRLTEGNITSTGRCGSPRIIFNPQIQETQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKVLFLVSLIFEAV AYILLPAMAHFSFEAAVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVASYLSNFGWELSFYVVGGVGLSLGIACCFLVY DTVEQHPRISDEEVEYLRQGKSQLGLQQQPVLRIPWKSLLTAPPAYAFIL THMFHTYSFLVIVQLMPRFMREAMEFELREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGSDQNCVRRMLYGICSILTTSLIGVIILADCNNKILVLVM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLVTLIACNTLAMLVFAFCSSTNLQPWDPRSRKEKET GSPRAQDSNS >C5 MSSKSWTLPRLSQSRASSAHRLLGSVRLTYAICAFLSTCLHAAMRNMLGM IILKMVMPRPEDALLAPAELGRLTEGNTTSMSRCGSPRVIFNPQIQGTQS GDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKVLFIVSLIFEAV AYILLPAMAHFSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTAL LSFAYSGLLMGSMLVYPVAIYLSNFGWELSFYVVGGVGLSFGIACYFLVY DTVEQHPRISDEEVDYLMQGKNQLGLQQQPVLRIPWKSLLTAPPAYAFIL THMFHTYSFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCI LGGSYVERRVGPDQNCMRRMLYSICSILTTSLIGVIILADCGDKKLVLMM FAFMMATTDMGFSGYWPTLLYFAPSFAGLLSGLANGLAHLSGFLAPHLVA ALVHTGSKDEWNVVLMTLIACNTLAMLVFAFCSNTNLQPWDPRSRKEKoT GSSRAQESNS MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/181/CG7091-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 5 taxa and 1533 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1478780964 Setting output file names to "/opt/ADOPS/181/CG7091-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1140653278 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 4172969487 Seed = 600218656 Swapseed = 1478780964 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 35 unique site patterns Division 2 has 34 unique site patterns Division 3 has 75 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4227.713121 -- -25.624409 Chain 2 -- -4189.039913 -- -25.624409 Chain 3 -- -4227.713121 -- -25.624409 Chain 4 -- -4189.536944 -- -25.624409 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4211.115184 -- -25.624409 Chain 2 -- -4212.841344 -- -25.624409 Chain 3 -- -4136.325513 -- -25.624409 Chain 4 -- -4211.771730 -- -25.624409 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4227.713] (-4189.040) (-4227.713) (-4189.537) * [-4211.115] (-4212.841) (-4136.326) (-4211.772) 500 -- (-3569.207) (-3576.755) (-3576.814) [-3561.815] * (-3576.668) (-3574.353) (-3567.705) [-3565.078] -- 0:00:00 1000 -- (-3555.966) [-3559.249] (-3565.581) (-3550.399) * (-3571.072) (-3563.646) [-3542.528] (-3549.839) -- 0:00:00 1500 -- [-3545.963] (-3556.241) (-3547.874) (-3548.862) * (-3554.570) (-3548.310) [-3533.536] (-3546.518) -- 0:00:00 2000 -- (-3538.945) (-3554.488) (-3541.216) [-3549.156] * (-3542.509) (-3546.747) [-3537.463] (-3549.755) -- 0:00:00 2500 -- (-3542.191) [-3541.960] (-3535.499) (-3541.076) * (-3540.661) (-3544.200) [-3536.014] (-3547.849) -- 0:00:00 3000 -- (-3550.051) (-3536.918) [-3529.787] (-3541.499) * (-3534.305) [-3532.267] (-3532.079) (-3545.283) -- 0:00:00 3500 -- [-3541.197] (-3535.891) (-3536.461) (-3531.208) * (-3530.452) (-3529.434) [-3529.539] (-3527.658) -- 0:00:00 4000 -- [-3537.965] (-3538.759) (-3532.772) (-3529.744) * [-3536.250] (-3529.749) (-3527.811) (-3534.732) -- 0:04:09 4500 -- (-3539.971) (-3533.477) [-3524.899] (-3540.410) * (-3532.283) (-3532.913) (-3530.913) [-3540.236] -- 0:03:41 5000 -- (-3538.606) (-3529.714) (-3533.122) [-3529.463] * (-3529.168) (-3531.149) [-3532.146] (-3535.698) -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- (-3535.631) (-3528.980) [-3529.607] (-3529.773) * (-3541.946) (-3529.348) [-3532.526] (-3535.345) -- 0:03:00 6000 -- [-3535.455] (-3528.172) (-3530.498) (-3536.934) * (-3532.013) [-3528.726] (-3526.355) (-3531.066) -- 0:02:45 6500 -- [-3530.026] (-3527.091) (-3528.736) (-3527.265) * (-3537.916) (-3525.988) [-3531.198] (-3535.263) -- 0:02:32 7000 -- [-3532.205] (-3530.792) (-3531.530) (-3530.654) * (-3539.506) [-3528.630] (-3530.366) (-3529.086) -- 0:02:21 7500 -- (-3535.580) [-3531.962] (-3532.882) (-3534.175) * (-3531.285) [-3529.668] (-3529.045) (-3535.298) -- 0:04:24 8000 -- (-3529.796) (-3532.600) (-3536.391) [-3528.654] * (-3530.264) (-3528.058) [-3527.927] (-3536.216) -- 0:04:08 8500 -- [-3528.337] (-3532.070) (-3532.870) (-3537.980) * (-3531.459) (-3529.332) [-3532.276] (-3529.382) -- 0:03:53 9000 -- [-3529.800] (-3530.804) (-3532.225) (-3534.431) * [-3530.674] (-3527.121) (-3529.433) (-3531.756) -- 0:03:40 9500 -- (-3530.025) (-3532.637) (-3531.589) [-3530.594] * (-3531.055) (-3531.872) [-3529.951] (-3529.150) -- 0:03:28 10000 -- (-3533.678) (-3531.600) [-3531.108] (-3534.836) * (-3530.958) (-3535.747) [-3530.954] (-3529.857) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 10500 -- (-3532.384) (-3529.593) [-3530.733] (-3528.699) * (-3535.275) (-3531.161) (-3530.102) [-3525.249] -- 0:03:08 11000 -- [-3528.901] (-3531.734) (-3528.960) (-3529.094) * [-3533.146] (-3529.830) (-3529.646) (-3537.541) -- 0:04:29 11500 -- (-3528.456) (-3531.310) (-3529.747) [-3536.293] * (-3536.012) (-3527.854) (-3530.296) [-3531.278] -- 0:04:17 12000 -- (-3529.819) [-3532.912] (-3536.537) (-3536.726) * [-3532.641] (-3534.467) (-3533.216) (-3537.698) -- 0:04:07 12500 -- (-3530.854) [-3530.129] (-3533.643) (-3532.885) * (-3532.777) [-3527.673] (-3530.964) (-3529.089) -- 0:03:57 13000 -- (-3529.656) [-3529.349] (-3528.362) (-3533.525) * [-3527.050] (-3536.787) (-3534.544) (-3534.875) -- 0:03:47 13500 -- (-3531.650) (-3529.622) [-3530.126] (-3537.368) * [-3531.423] (-3534.462) (-3534.652) (-3528.905) -- 0:03:39 14000 -- (-3539.116) [-3533.992] (-3531.782) (-3535.943) * (-3536.837) (-3528.634) (-3530.876) [-3526.809] -- 0:04:41 14500 -- [-3527.677] (-3531.816) (-3535.717) (-3535.194) * (-3536.997) [-3532.686] (-3529.388) (-3534.947) -- 0:04:31 15000 -- (-3532.095) (-3533.804) [-3527.938] (-3532.445) * (-3532.768) (-3531.606) (-3534.735) [-3530.536] -- 0:04:22 Average standard deviation of split frequencies: 0.000000 15500 -- [-3528.197] (-3531.812) (-3527.694) (-3531.418) * (-3532.167) [-3534.056] (-3530.221) (-3530.776) -- 0:04:14 16000 -- (-3528.244) [-3530.275] (-3530.473) (-3533.019) * (-3536.168) (-3537.151) [-3531.220] (-3537.745) -- 0:04:06 16500 -- (-3525.544) (-3527.408) (-3535.481) [-3536.931] * (-3530.266) (-3535.185) [-3529.623] (-3544.211) -- 0:03:58 17000 -- [-3529.495] (-3530.470) (-3529.240) (-3532.417) * (-3534.237) [-3526.978] (-3538.638) (-3541.468) -- 0:03:51 17500 -- (-3530.836) [-3526.787] (-3530.124) (-3529.245) * (-3534.670) (-3529.502) [-3531.125] (-3529.379) -- 0:03:44 18000 -- (-3532.810) [-3526.902] (-3534.012) (-3532.323) * (-3529.986) (-3531.529) (-3540.397) [-3530.672] -- 0:04:32 18500 -- [-3531.289] (-3529.875) (-3528.269) (-3529.137) * (-3529.424) (-3539.276) (-3539.022) [-3530.706] -- 0:04:25 19000 -- (-3530.814) [-3536.305] (-3531.332) (-3527.175) * (-3530.345) [-3528.686] (-3539.482) (-3530.352) -- 0:04:18 19500 -- (-3533.136) [-3527.060] (-3530.600) (-3528.059) * [-3535.665] (-3536.128) (-3533.614) (-3528.307) -- 0:04:11 20000 -- (-3535.648) (-3527.663) [-3531.100] (-3535.490) * (-3543.154) (-3533.722) (-3535.486) [-3528.868] -- 0:04:05 Average standard deviation of split frequencies: 0.000000 20500 -- (-3530.827) [-3531.681] (-3529.983) (-3533.299) * (-3540.013) (-3531.247) (-3530.262) [-3529.513] -- 0:03:58 21000 -- (-3529.485) (-3531.954) (-3539.061) [-3527.843] * (-3533.701) (-3535.881) [-3529.994] (-3534.181) -- 0:03:53 21500 -- (-3530.625) [-3531.988] (-3533.402) (-3531.169) * (-3535.606) (-3537.210) [-3529.096] (-3534.543) -- 0:03:47 22000 -- (-3532.856) (-3534.364) (-3535.221) [-3532.004] * [-3533.788] (-3528.193) (-3532.787) (-3535.089) -- 0:04:26 22500 -- (-3532.960) [-3534.074] (-3532.032) (-3531.120) * (-3524.615) (-3532.506) (-3529.159) [-3534.411] -- 0:04:20 23000 -- [-3531.813] (-3537.065) (-3538.617) (-3539.224) * (-3533.948) (-3534.325) (-3533.328) [-3535.558] -- 0:04:14 23500 -- [-3528.117] (-3535.605) (-3528.220) (-3531.942) * (-3530.929) (-3534.496) (-3529.540) [-3531.804] -- 0:04:09 24000 -- (-3537.184) [-3529.512] (-3525.693) (-3535.564) * [-3531.148] (-3543.335) (-3529.668) (-3532.784) -- 0:04:04 24500 -- (-3534.974) (-3530.764) [-3530.461] (-3533.691) * (-3531.742) (-3541.083) [-3530.113] (-3533.241) -- 0:03:58 25000 -- (-3535.779) [-3536.281] (-3531.757) (-3530.827) * [-3533.074] (-3532.574) (-3535.435) (-3540.317) -- 0:03:54 Average standard deviation of split frequencies: 0.000000 25500 -- [-3533.390] (-3532.719) (-3531.143) (-3528.353) * (-3529.273) (-3531.124) [-3530.309] (-3535.354) -- 0:04:27 26000 -- (-3527.613) (-3529.161) (-3528.457) [-3530.084] * (-3546.179) (-3534.661) (-3530.246) [-3530.926] -- 0:04:22 26500 -- [-3531.409] (-3531.128) (-3530.790) (-3532.161) * (-3533.866) (-3534.801) (-3535.555) [-3531.707] -- 0:04:17 27000 -- (-3530.252) [-3529.898] (-3532.884) (-3530.716) * (-3537.751) (-3532.948) [-3532.424] (-3525.713) -- 0:04:12 27500 -- (-3530.954) (-3526.739) [-3527.053] (-3529.960) * (-3533.340) [-3533.083] (-3530.367) (-3530.944) -- 0:04:07 28000 -- [-3534.090] (-3543.327) (-3531.105) (-3537.585) * (-3532.088) (-3532.930) [-3528.327] (-3527.043) -- 0:04:03 28500 -- [-3527.597] (-3533.103) (-3533.986) (-3527.880) * (-3536.338) (-3535.420) (-3531.619) [-3528.352] -- 0:03:58 29000 -- (-3525.742) (-3527.824) (-3530.607) [-3529.991] * (-3536.596) (-3536.662) [-3529.061] (-3525.008) -- 0:03:54 29500 -- [-3531.580] (-3531.993) (-3528.288) (-3530.092) * (-3530.811) [-3533.964] (-3533.404) (-3529.208) -- 0:04:23 30000 -- [-3527.909] (-3532.824) (-3530.363) (-3529.611) * (-3537.824) (-3528.438) [-3535.942] (-3528.468) -- 0:04:18 Average standard deviation of split frequencies: 0.000000 30500 -- (-3530.050) (-3532.558) (-3531.126) [-3527.316] * (-3532.777) (-3532.757) (-3537.019) [-3533.914] -- 0:04:14 31000 -- (-3534.776) (-3530.126) [-3531.751] (-3527.196) * (-3533.091) (-3531.571) (-3532.615) [-3533.266] -- 0:04:10 31500 -- [-3537.129] (-3530.146) (-3532.984) (-3533.437) * (-3529.425) (-3532.528) (-3527.526) [-3538.205] -- 0:04:05 32000 -- [-3527.023] (-3531.264) (-3535.280) (-3539.031) * (-3535.052) (-3533.808) (-3529.270) [-3538.357] -- 0:04:02 32500 -- (-3532.518) [-3531.289] (-3532.640) (-3535.833) * (-3530.484) [-3531.212] (-3525.475) (-3525.953) -- 0:03:58 33000 -- (-3533.301) (-3532.769) [-3532.427] (-3534.871) * (-3532.953) (-3536.973) (-3525.925) [-3527.847] -- 0:03:54 33500 -- [-3536.375] (-3531.466) (-3531.241) (-3528.980) * (-3535.350) (-3529.816) [-3528.350] (-3534.757) -- 0:04:19 34000 -- (-3528.597) (-3531.619) [-3533.090] (-3537.215) * (-3533.865) [-3528.932] (-3529.710) (-3533.408) -- 0:04:15 34500 -- (-3532.584) [-3533.623] (-3528.153) (-3535.192) * [-3538.306] (-3536.995) (-3528.810) (-3535.074) -- 0:04:11 35000 -- (-3541.664) (-3531.624) [-3529.317] (-3534.161) * (-3533.887) (-3530.318) (-3528.581) [-3529.301] -- 0:04:08 Average standard deviation of split frequencies: 0.000000 35500 -- (-3533.318) (-3530.500) [-3526.933] (-3528.253) * (-3532.196) [-3529.799] (-3531.079) (-3529.675) -- 0:04:04 36000 -- (-3534.684) (-3540.726) [-3529.115] (-3531.040) * (-3533.694) (-3528.466) (-3532.927) [-3527.773] -- 0:04:01 36500 -- (-3532.779) [-3530.202] (-3536.337) (-3528.130) * (-3528.389) [-3527.206] (-3535.889) (-3526.419) -- 0:03:57 37000 -- (-3535.686) (-3530.365) (-3534.173) [-3530.492] * (-3532.552) (-3534.679) [-3535.509] (-3530.746) -- 0:04:20 37500 -- (-3533.047) (-3533.138) [-3527.740] (-3532.716) * (-3527.801) (-3532.266) [-3531.658] (-3527.857) -- 0:04:16 38000 -- (-3536.342) (-3525.740) [-3534.624] (-3533.552) * (-3529.211) [-3531.027] (-3526.050) (-3530.076) -- 0:04:13 38500 -- (-3527.340) (-3530.963) [-3534.445] (-3532.145) * (-3528.576) (-3532.076) [-3533.599] (-3528.763) -- 0:04:09 39000 -- (-3528.891) (-3532.757) [-3538.524] (-3528.709) * [-3529.246] (-3527.363) (-3538.941) (-3533.119) -- 0:04:06 39500 -- (-3533.554) [-3525.507] (-3530.961) (-3529.926) * (-3537.002) [-3529.042] (-3534.611) (-3530.593) -- 0:04:03 40000 -- (-3531.034) (-3529.262) (-3534.694) [-3532.775] * [-3532.290] (-3524.839) (-3529.299) (-3527.351) -- 0:04:00 Average standard deviation of split frequencies: 0.000000 40500 -- (-3532.417) (-3533.487) (-3541.493) [-3531.104] * [-3532.694] (-3529.154) (-3529.026) (-3527.296) -- 0:03:56 41000 -- [-3536.887] (-3535.122) (-3528.157) (-3531.725) * (-3537.811) [-3527.020] (-3534.822) (-3528.758) -- 0:04:17 41500 -- (-3540.992) [-3530.744] (-3531.300) (-3529.172) * [-3532.782] (-3526.256) (-3532.500) (-3535.721) -- 0:04:14 42000 -- [-3533.045] (-3540.725) (-3535.413) (-3531.868) * [-3535.006] (-3527.523) (-3531.684) (-3530.024) -- 0:04:10 42500 -- (-3527.607) (-3535.445) (-3533.945) [-3533.471] * [-3530.538] (-3530.455) (-3528.925) (-3531.481) -- 0:04:07 43000 -- (-3527.656) (-3539.650) [-3529.824] (-3533.770) * [-3529.885] (-3528.615) (-3532.152) (-3535.867) -- 0:04:04 43500 -- [-3527.417] (-3532.355) (-3533.051) (-3530.436) * (-3534.605) (-3529.992) [-3525.611] (-3541.360) -- 0:04:01 44000 -- (-3533.377) (-3527.902) [-3533.523] (-3533.900) * [-3528.249] (-3529.754) (-3530.739) (-3532.966) -- 0:03:59 44500 -- (-3533.482) (-3531.644) (-3535.764) [-3529.102] * (-3532.179) [-3530.548] (-3531.643) (-3536.809) -- 0:03:56 45000 -- (-3530.694) [-3531.294] (-3531.810) (-3525.919) * (-3530.888) (-3532.350) (-3543.545) [-3530.814] -- 0:04:14 Average standard deviation of split frequencies: 0.000000 45500 -- (-3528.120) (-3539.772) (-3535.050) [-3527.792] * (-3533.812) [-3532.272] (-3541.809) (-3535.019) -- 0:04:11 46000 -- [-3529.414] (-3535.262) (-3531.078) (-3530.752) * [-3528.032] (-3529.910) (-3534.978) (-3536.275) -- 0:04:08 46500 -- (-3533.757) (-3535.961) [-3532.028] (-3529.528) * (-3532.268) (-3532.677) (-3544.610) [-3537.927] -- 0:04:06 47000 -- [-3533.898] (-3530.896) (-3531.512) (-3532.471) * (-3530.463) (-3528.295) (-3532.258) [-3526.954] -- 0:04:03 47500 -- (-3525.993) (-3535.728) [-3528.651] (-3531.139) * (-3529.683) (-3534.798) (-3537.948) [-3532.677] -- 0:04:00 48000 -- [-3530.137] (-3528.194) (-3529.175) (-3526.447) * (-3526.698) (-3534.238) (-3535.162) [-3530.839] -- 0:03:58 48500 -- (-3528.997) [-3531.191] (-3534.240) (-3527.500) * (-3532.118) (-3531.553) (-3533.203) [-3530.985] -- 0:04:15 49000 -- (-3527.355) (-3533.812) [-3530.619] (-3531.034) * [-3529.690] (-3530.473) (-3539.161) (-3528.990) -- 0:04:12 49500 -- (-3537.261) (-3530.347) (-3535.256) [-3526.033] * (-3531.462) [-3527.473] (-3530.171) (-3530.094) -- 0:04:09 50000 -- (-3529.821) (-3534.073) (-3528.722) [-3528.484] * [-3537.666] (-3529.356) (-3529.699) (-3537.440) -- 0:04:06 Average standard deviation of split frequencies: 0.000000 50500 -- (-3534.318) [-3526.699] (-3526.762) (-3528.392) * (-3530.234) (-3533.921) (-3534.754) [-3533.360] -- 0:04:04 51000 -- (-3530.273) (-3535.774) [-3529.409] (-3532.017) * [-3534.793] (-3530.557) (-3530.392) (-3529.200) -- 0:04:01 51500 -- (-3530.516) [-3530.219] (-3530.996) (-3532.514) * (-3535.461) [-3531.246] (-3529.464) (-3536.455) -- 0:03:59 52000 -- [-3529.676] (-3535.974) (-3531.354) (-3531.146) * (-3542.113) (-3534.708) [-3526.570] (-3538.585) -- 0:03:57 52500 -- (-3542.991) (-3534.271) (-3531.186) [-3531.813] * (-3537.503) (-3536.312) [-3526.122] (-3531.482) -- 0:04:12 53000 -- (-3534.479) (-3530.675) [-3527.994] (-3530.795) * (-3532.725) [-3527.303] (-3529.941) (-3532.065) -- 0:04:10 53500 -- (-3538.728) (-3530.494) (-3530.066) [-3536.310] * (-3532.562) [-3532.727] (-3533.786) (-3534.423) -- 0:04:07 54000 -- (-3530.062) (-3535.120) [-3527.635] (-3533.869) * (-3527.975) (-3537.214) (-3531.644) [-3531.231] -- 0:04:05 54500 -- (-3534.966) (-3536.627) (-3531.563) [-3532.822] * (-3533.422) (-3532.787) [-3528.371] (-3536.227) -- 0:04:02 55000 -- (-3530.126) (-3527.905) (-3532.840) [-3537.339] * [-3530.119] (-3538.234) (-3533.313) (-3533.744) -- 0:04:00 Average standard deviation of split frequencies: 0.000000 55500 -- (-3531.103) [-3536.925] (-3530.936) (-3533.755) * (-3530.710) (-3528.427) (-3529.855) [-3530.512] -- 0:03:58 56000 -- [-3526.901] (-3533.684) (-3535.133) (-3531.226) * [-3532.500] (-3528.536) (-3532.300) (-3530.666) -- 0:03:56 56500 -- (-3533.912) (-3535.821) (-3530.715) [-3534.934] * (-3532.256) (-3533.353) [-3533.684] (-3529.325) -- 0:04:10 57000 -- (-3532.082) [-3529.688] (-3523.793) (-3535.129) * (-3528.254) (-3527.449) (-3541.785) [-3541.972] -- 0:04:08 57500 -- [-3534.428] (-3533.034) (-3528.080) (-3529.569) * (-3531.391) (-3533.818) [-3529.886] (-3534.580) -- 0:04:05 58000 -- (-3532.083) (-3529.405) (-3531.445) [-3529.324] * (-3529.411) [-3538.000] (-3533.191) (-3529.524) -- 0:04:03 58500 -- (-3534.101) (-3530.698) [-3528.816] (-3536.882) * [-3536.552] (-3540.652) (-3537.042) (-3534.989) -- 0:04:01 59000 -- (-3535.254) [-3528.025] (-3528.220) (-3536.506) * [-3527.201] (-3536.299) (-3536.022) (-3530.666) -- 0:03:59 59500 -- (-3530.593) [-3529.686] (-3534.109) (-3532.515) * [-3530.896] (-3535.419) (-3532.804) (-3530.941) -- 0:03:57 60000 -- (-3527.362) (-3535.374) [-3533.749] (-3544.160) * [-3526.196] (-3530.650) (-3540.652) (-3525.478) -- 0:04:10 Average standard deviation of split frequencies: 0.000000 60500 -- [-3533.513] (-3530.877) (-3528.854) (-3540.195) * (-3530.723) (-3526.415) [-3534.569] (-3528.180) -- 0:04:08 61000 -- (-3527.591) [-3528.271] (-3533.597) (-3533.762) * (-3526.031) (-3540.080) (-3533.959) [-3525.727] -- 0:04:06 61500 -- (-3530.836) [-3530.095] (-3529.992) (-3535.220) * [-3531.976] (-3537.967) (-3530.562) (-3526.983) -- 0:04:04 62000 -- (-3526.704) (-3526.975) (-3534.645) [-3529.692] * (-3527.911) (-3531.997) (-3540.575) [-3530.664] -- 0:04:02 62500 -- (-3530.210) (-3534.513) [-3528.602] (-3527.295) * (-3528.726) (-3535.105) [-3533.732] (-3529.771) -- 0:04:00 63000 -- (-3531.849) [-3525.321] (-3530.515) (-3538.084) * [-3529.661] (-3530.908) (-3535.943) (-3525.336) -- 0:03:57 63500 -- (-3526.176) [-3530.902] (-3538.099) (-3531.933) * (-3531.635) [-3539.105] (-3534.976) (-3533.832) -- 0:03:55 64000 -- (-3534.041) (-3528.320) [-3530.180] (-3526.699) * (-3532.324) [-3528.240] (-3527.734) (-3532.902) -- 0:04:08 64500 -- (-3527.854) (-3538.700) (-3532.976) [-3533.122] * [-3530.596] (-3533.240) (-3533.149) (-3527.155) -- 0:04:06 65000 -- [-3530.105] (-3540.550) (-3531.549) (-3534.104) * (-3528.853) (-3531.045) [-3530.054] (-3529.165) -- 0:04:04 Average standard deviation of split frequencies: 0.000000 65500 -- (-3527.108) [-3531.990] (-3528.629) (-3534.869) * (-3528.871) [-3526.925] (-3538.195) (-3535.831) -- 0:04:02 66000 -- [-3533.349] (-3532.724) (-3531.378) (-3532.095) * (-3528.368) (-3530.492) (-3537.504) [-3533.876] -- 0:04:00 66500 -- (-3531.011) [-3536.908] (-3531.180) (-3534.816) * [-3525.483] (-3534.173) (-3526.133) (-3537.431) -- 0:03:58 67000 -- (-3531.655) (-3530.673) (-3528.045) [-3538.147] * (-3534.477) (-3531.445) [-3527.038] (-3535.984) -- 0:03:56 67500 -- [-3533.393] (-3531.187) (-3532.427) (-3534.093) * [-3526.584] (-3530.714) (-3531.704) (-3531.498) -- 0:03:54 68000 -- (-3532.096) (-3527.736) (-3528.416) [-3532.212] * [-3528.272] (-3527.373) (-3532.680) (-3533.519) -- 0:04:06 68500 -- [-3527.004] (-3529.539) (-3529.295) (-3530.501) * (-3529.759) (-3530.900) [-3538.958] (-3544.147) -- 0:04:04 69000 -- [-3529.018] (-3529.132) (-3534.810) (-3533.678) * [-3535.078] (-3534.997) (-3529.108) (-3539.056) -- 0:04:02 69500 -- (-3532.340) (-3533.847) (-3529.974) [-3538.338] * (-3529.211) [-3533.220] (-3534.519) (-3538.007) -- 0:04:00 70000 -- (-3530.568) [-3531.401] (-3528.822) (-3540.615) * (-3530.400) (-3538.231) [-3534.730] (-3536.331) -- 0:03:59 Average standard deviation of split frequencies: 0.000000 70500 -- (-3530.106) [-3530.984] (-3531.915) (-3533.560) * [-3530.396] (-3536.731) (-3531.672) (-3535.298) -- 0:03:57 71000 -- [-3534.438] (-3530.822) (-3531.092) (-3528.185) * (-3531.427) (-3528.570) (-3531.130) [-3535.243] -- 0:03:55 71500 -- (-3531.896) (-3528.764) [-3532.136] (-3527.885) * (-3528.833) (-3526.625) [-3528.219] (-3532.890) -- 0:04:06 72000 -- (-3533.840) (-3534.668) (-3529.460) [-3531.163] * [-3528.795] (-3529.128) (-3535.364) (-3541.822) -- 0:04:04 72500 -- [-3530.900] (-3533.671) (-3532.653) (-3530.965) * [-3533.300] (-3535.611) (-3536.139) (-3530.785) -- 0:04:03 73000 -- (-3531.574) [-3530.348] (-3530.933) (-3533.016) * [-3525.889] (-3529.970) (-3539.447) (-3538.876) -- 0:04:01 73500 -- [-3530.859] (-3532.134) (-3530.862) (-3534.844) * [-3530.576] (-3534.096) (-3530.536) (-3530.822) -- 0:03:59 74000 -- (-3533.622) [-3533.258] (-3534.447) (-3542.719) * [-3527.135] (-3528.829) (-3530.871) (-3532.719) -- 0:03:57 74500 -- (-3529.305) (-3534.599) [-3533.968] (-3537.679) * (-3526.476) (-3533.066) (-3535.355) [-3526.634] -- 0:03:56 75000 -- (-3530.326) [-3527.585] (-3536.662) (-3533.281) * (-3529.776) [-3531.555] (-3537.709) (-3530.955) -- 0:03:54 Average standard deviation of split frequencies: 0.000000 75500 -- (-3539.822) [-3526.244] (-3533.111) (-3533.336) * (-3526.816) (-3528.516) (-3532.581) [-3539.173] -- 0:04:04 76000 -- (-3527.690) (-3531.755) [-3532.555] (-3534.313) * (-3531.298) (-3527.886) (-3532.748) [-3530.265] -- 0:04:03 76500 -- (-3538.383) (-3538.148) (-3533.558) [-3531.215] * [-3532.346] (-3532.259) (-3535.658) (-3528.307) -- 0:04:01 77000 -- (-3535.963) (-3531.839) (-3530.217) [-3534.367] * [-3531.200] (-3532.264) (-3538.127) (-3530.339) -- 0:03:59 77500 -- (-3538.866) [-3529.057] (-3525.384) (-3529.776) * (-3536.782) (-3538.024) [-3530.257] (-3531.582) -- 0:03:58 78000 -- [-3527.303] (-3533.444) (-3532.551) (-3532.388) * (-3534.548) (-3532.757) [-3527.895] (-3534.794) -- 0:03:56 78500 -- [-3532.734] (-3537.017) (-3531.612) (-3534.236) * (-3529.676) (-3534.343) [-3531.824] (-3529.071) -- 0:03:54 79000 -- [-3529.201] (-3535.677) (-3542.338) (-3538.858) * (-3538.744) (-3534.708) [-3529.443] (-3540.036) -- 0:04:04 79500 -- (-3527.232) (-3539.703) (-3529.036) [-3531.091] * (-3538.568) (-3536.732) [-3528.394] (-3535.807) -- 0:04:03 80000 -- (-3533.849) [-3543.188] (-3534.645) (-3530.452) * (-3528.274) (-3539.730) [-3527.983] (-3535.136) -- 0:04:01 Average standard deviation of split frequencies: 0.000000 80500 -- (-3531.820) (-3530.514) (-3529.761) [-3532.583] * (-3529.840) (-3541.755) [-3528.264] (-3534.227) -- 0:03:59 81000 -- (-3532.585) (-3530.897) [-3529.211] (-3538.257) * (-3538.171) (-3548.809) [-3532.793] (-3536.755) -- 0:03:58 81500 -- (-3536.672) [-3535.245] (-3527.422) (-3532.632) * (-3530.248) (-3538.844) (-3528.911) [-3531.624] -- 0:03:56 82000 -- (-3537.515) (-3529.313) (-3526.783) [-3533.930] * (-3535.295) (-3546.095) [-3529.007] (-3533.883) -- 0:03:55 82500 -- (-3538.406) (-3531.266) [-3527.711] (-3531.702) * (-3537.110) (-3527.213) (-3536.252) [-3530.497] -- 0:03:53 83000 -- (-3533.139) [-3531.082] (-3531.175) (-3530.723) * (-3531.386) (-3531.378) (-3541.669) [-3532.540] -- 0:04:03 83500 -- [-3528.503] (-3531.024) (-3533.198) (-3531.034) * [-3530.248] (-3533.705) (-3534.637) (-3536.372) -- 0:04:01 84000 -- (-3532.350) [-3531.171] (-3536.403) (-3528.422) * (-3529.146) (-3532.121) (-3533.550) [-3532.208] -- 0:03:59 84500 -- (-3538.624) (-3529.198) [-3533.886] (-3536.781) * [-3531.164] (-3529.110) (-3533.231) (-3532.919) -- 0:03:58 85000 -- (-3536.430) (-3534.377) (-3529.417) [-3532.421] * (-3527.903) (-3534.205) (-3533.062) [-3526.313] -- 0:03:56 Average standard deviation of split frequencies: 0.000000 85500 -- [-3538.142] (-3534.191) (-3528.112) (-3532.016) * (-3528.813) (-3534.333) (-3529.884) [-3528.064] -- 0:03:55 86000 -- (-3535.330) [-3533.416] (-3527.164) (-3531.699) * (-3526.254) (-3525.475) [-3533.653] (-3532.592) -- 0:03:53 86500 -- (-3529.847) (-3529.082) (-3528.029) [-3535.270] * (-3532.267) (-3526.665) (-3531.127) [-3527.228] -- 0:03:52 87000 -- [-3533.474] (-3539.953) (-3531.930) (-3539.729) * (-3531.606) [-3526.999] (-3526.422) (-3534.586) -- 0:04:01 87500 -- (-3536.329) [-3534.184] (-3528.729) (-3530.603) * [-3532.433] (-3533.354) (-3532.908) (-3528.416) -- 0:03:59 88000 -- (-3530.234) [-3529.281] (-3528.930) (-3529.565) * [-3528.380] (-3534.196) (-3528.638) (-3529.849) -- 0:03:58 88500 -- [-3531.903] (-3529.399) (-3529.267) (-3532.039) * (-3530.349) (-3527.629) (-3535.202) [-3529.056] -- 0:03:56 89000 -- [-3531.860] (-3533.341) (-3531.618) (-3533.925) * (-3528.427) [-3527.702] (-3532.606) (-3530.470) -- 0:03:55 89500 -- (-3541.008) (-3542.918) (-3535.164) [-3535.176] * [-3529.290] (-3528.430) (-3537.371) (-3530.168) -- 0:03:53 90000 -- (-3533.771) (-3532.137) (-3528.458) [-3528.593] * (-3534.307) (-3530.643) (-3526.939) [-3525.894] -- 0:03:52 Average standard deviation of split frequencies: 0.000000 90500 -- [-3532.627] (-3532.246) (-3530.646) (-3533.973) * (-3531.404) (-3531.947) (-3536.626) [-3529.105] -- 0:04:01 91000 -- (-3531.785) (-3537.253) [-3529.060] (-3530.515) * (-3531.818) (-3528.443) [-3538.074] (-3529.131) -- 0:03:59 91500 -- (-3534.193) [-3528.921] (-3530.248) (-3537.775) * [-3528.825] (-3528.675) (-3532.822) (-3527.663) -- 0:03:58 92000 -- (-3533.572) (-3533.842) (-3526.488) [-3531.860] * [-3533.133] (-3525.857) (-3531.005) (-3532.124) -- 0:03:56 92500 -- (-3535.266) [-3527.703] (-3529.506) (-3533.990) * (-3529.307) [-3524.687] (-3531.303) (-3528.741) -- 0:03:55 93000 -- (-3527.243) (-3531.018) [-3531.398] (-3530.120) * (-3531.853) (-3527.216) [-3530.391] (-3532.115) -- 0:03:54 93500 -- (-3536.511) [-3537.776] (-3530.943) (-3528.876) * [-3531.222] (-3535.429) (-3529.803) (-3532.183) -- 0:03:52 94000 -- [-3536.768] (-3534.223) (-3538.620) (-3529.569) * (-3536.889) (-3526.512) (-3540.482) [-3530.877] -- 0:03:51 94500 -- [-3524.836] (-3532.374) (-3535.850) (-3527.942) * (-3538.868) (-3526.711) (-3537.133) [-3528.192] -- 0:03:59 95000 -- [-3535.148] (-3535.750) (-3533.331) (-3537.129) * (-3535.677) [-3527.741] (-3533.090) (-3530.304) -- 0:03:58 Average standard deviation of split frequencies: 0.000000 95500 -- [-3532.325] (-3531.213) (-3526.165) (-3527.384) * [-3531.384] (-3530.589) (-3531.289) (-3527.938) -- 0:03:56 96000 -- [-3524.227] (-3539.083) (-3534.477) (-3529.823) * (-3529.488) (-3538.295) (-3534.482) [-3536.309] -- 0:03:55 96500 -- (-3532.324) (-3535.533) (-3536.016) [-3532.066] * [-3526.456] (-3528.366) (-3532.650) (-3529.949) -- 0:03:54 97000 -- (-3532.702) [-3529.390] (-3534.705) (-3529.890) * (-3533.990) (-3532.839) [-3529.334] (-3532.247) -- 0:03:52 97500 -- (-3532.233) (-3536.147) [-3529.970] (-3531.932) * (-3536.682) (-3535.235) [-3529.122] (-3528.708) -- 0:03:51 98000 -- (-3531.234) (-3528.101) [-3532.217] (-3532.910) * (-3531.179) (-3531.717) [-3527.629] (-3526.748) -- 0:03:50 98500 -- [-3534.363] (-3533.793) (-3531.767) (-3530.550) * (-3530.793) (-3540.023) (-3525.905) [-3528.906] -- 0:03:57 99000 -- [-3534.130] (-3535.518) (-3534.114) (-3538.994) * [-3529.497] (-3538.760) (-3533.743) (-3532.099) -- 0:03:56 99500 -- [-3536.667] (-3541.252) (-3534.647) (-3532.196) * [-3533.478] (-3534.124) (-3529.888) (-3529.765) -- 0:03:55 100000 -- (-3536.954) [-3531.852] (-3532.150) (-3532.694) * (-3528.721) [-3534.099] (-3530.596) (-3530.858) -- 0:03:53 Average standard deviation of split frequencies: 0.000000 100500 -- [-3530.820] (-3531.035) (-3535.072) (-3533.231) * (-3532.633) [-3529.620] (-3525.105) (-3533.692) -- 0:03:52 101000 -- (-3538.087) [-3529.201] (-3539.173) (-3537.258) * (-3536.539) (-3530.897) [-3532.132] (-3530.644) -- 0:03:51 101500 -- (-3530.483) [-3526.967] (-3534.722) (-3526.860) * (-3534.349) (-3528.130) [-3528.617] (-3532.703) -- 0:03:50 102000 -- (-3532.537) (-3530.585) (-3544.404) [-3527.849] * (-3538.380) (-3530.356) [-3526.617] (-3528.104) -- 0:03:48 102500 -- [-3528.556] (-3527.410) (-3538.437) (-3543.569) * (-3535.088) (-3533.589) [-3527.197] (-3531.353) -- 0:03:56 103000 -- (-3524.738) [-3533.145] (-3541.085) (-3534.892) * (-3529.542) (-3538.703) [-3536.750] (-3536.922) -- 0:03:55 103500 -- [-3534.803] (-3528.936) (-3539.958) (-3535.467) * (-3529.575) (-3545.571) (-3531.786) [-3531.951] -- 0:03:53 104000 -- (-3532.057) (-3530.584) [-3537.168] (-3534.207) * [-3528.506] (-3536.007) (-3530.193) (-3526.962) -- 0:03:52 104500 -- (-3526.892) [-3532.996] (-3529.197) (-3529.856) * (-3532.077) (-3535.524) [-3531.032] (-3529.956) -- 0:03:51 105000 -- (-3532.476) (-3536.526) (-3527.459) [-3533.947] * (-3533.812) (-3533.229) [-3525.381] (-3528.806) -- 0:03:50 Average standard deviation of split frequencies: 0.000000 105500 -- (-3533.172) [-3533.159] (-3527.085) (-3533.202) * (-3533.598) [-3531.254] (-3534.176) (-3527.362) -- 0:03:48 106000 -- (-3530.933) (-3532.136) [-3531.658] (-3531.918) * (-3531.963) (-3529.608) [-3536.942] (-3537.016) -- 0:03:56 106500 -- (-3537.685) [-3533.047] (-3530.652) (-3533.760) * [-3533.058] (-3533.221) (-3533.453) (-3540.304) -- 0:03:54 107000 -- [-3533.534] (-3535.031) (-3533.187) (-3537.127) * (-3539.328) [-3525.735] (-3536.716) (-3533.727) -- 0:03:53 107500 -- (-3531.654) (-3530.432) [-3527.259] (-3537.543) * [-3532.165] (-3539.222) (-3532.500) (-3527.784) -- 0:03:52 108000 -- (-3534.771) (-3533.313) (-3528.499) [-3536.088] * (-3539.999) (-3534.738) (-3528.840) [-3531.042] -- 0:03:51 108500 -- [-3531.743] (-3536.186) (-3531.874) (-3536.151) * [-3530.250] (-3531.555) (-3534.690) (-3531.773) -- 0:03:50 109000 -- [-3532.547] (-3531.884) (-3538.050) (-3538.029) * (-3535.074) (-3534.581) (-3532.694) [-3525.765] -- 0:03:48 109500 -- (-3534.874) (-3528.429) (-3532.481) [-3532.616] * (-3534.140) [-3532.966] (-3529.843) (-3531.782) -- 0:03:47 110000 -- (-3528.385) (-3536.455) (-3533.450) [-3534.122] * (-3528.944) (-3530.083) [-3533.293] (-3536.203) -- 0:03:54 Average standard deviation of split frequencies: 0.000000 110500 -- [-3526.825] (-3531.708) (-3529.585) (-3538.096) * [-3535.193] (-3527.970) (-3535.176) (-3527.824) -- 0:03:53 111000 -- [-3535.439] (-3527.821) (-3531.218) (-3535.733) * [-3530.686] (-3537.529) (-3544.307) (-3535.146) -- 0:03:52 111500 -- (-3531.799) (-3537.901) (-3525.665) [-3533.217] * (-3538.618) (-3536.552) (-3532.134) [-3528.874] -- 0:03:51 112000 -- (-3530.710) (-3535.653) [-3533.066] (-3538.723) * (-3540.306) (-3531.141) [-3526.582] (-3529.352) -- 0:03:49 112500 -- (-3531.941) (-3533.803) (-3535.836) [-3531.198] * (-3530.511) (-3528.640) [-3533.799] (-3534.319) -- 0:03:48 113000 -- (-3526.607) (-3531.223) (-3526.332) [-3533.751] * [-3530.030] (-3534.668) (-3537.795) (-3531.497) -- 0:03:47 113500 -- (-3533.100) (-3531.935) (-3534.279) [-3527.759] * (-3533.392) [-3530.382] (-3539.820) (-3525.440) -- 0:03:46 114000 -- (-3536.401) [-3529.629] (-3531.111) (-3535.471) * (-3528.452) [-3529.034] (-3537.251) (-3532.987) -- 0:03:53 114500 -- (-3531.877) (-3530.733) (-3532.685) [-3529.173] * [-3528.909] (-3535.507) (-3537.315) (-3529.016) -- 0:03:52 115000 -- (-3532.174) (-3532.331) (-3525.527) [-3528.938] * [-3538.960] (-3524.231) (-3535.150) (-3535.504) -- 0:03:50 Average standard deviation of split frequencies: 0.000000 115500 -- [-3527.601] (-3531.054) (-3530.127) (-3530.838) * [-3529.383] (-3531.726) (-3530.121) (-3532.460) -- 0:03:49 116000 -- [-3529.461] (-3526.906) (-3528.713) (-3526.283) * (-3528.966) [-3529.603] (-3538.953) (-3538.333) -- 0:03:48 116500 -- [-3529.816] (-3531.920) (-3539.647) (-3526.459) * (-3532.908) [-3529.088] (-3532.423) (-3530.548) -- 0:03:47 117000 -- (-3534.169) (-3530.677) [-3533.071] (-3531.620) * (-3538.649) (-3534.228) [-3528.434] (-3526.478) -- 0:03:46 117500 -- (-3534.961) [-3535.862] (-3529.440) (-3531.741) * (-3537.783) (-3535.952) [-3534.197] (-3525.570) -- 0:03:45 118000 -- (-3532.883) [-3533.617] (-3530.284) (-3528.707) * (-3538.515) (-3533.062) [-3530.445] (-3529.858) -- 0:03:51 118500 -- (-3530.906) (-3534.667) (-3530.157) [-3527.308] * (-3528.568) (-3529.857) [-3530.578] (-3532.850) -- 0:03:50 119000 -- (-3531.903) (-3534.891) (-3532.923) [-3529.145] * (-3534.825) (-3539.839) [-3529.074] (-3537.497) -- 0:03:49 119500 -- [-3528.465] (-3538.456) (-3531.598) (-3534.640) * [-3530.046] (-3533.311) (-3531.098) (-3533.523) -- 0:03:48 120000 -- (-3535.296) (-3538.500) [-3532.677] (-3532.008) * (-3532.183) (-3533.832) (-3534.105) [-3533.773] -- 0:03:47 Average standard deviation of split frequencies: 0.000000 120500 -- (-3533.643) (-3529.530) [-3533.076] (-3533.759) * [-3524.803] (-3532.739) (-3532.878) (-3532.858) -- 0:03:46 121000 -- [-3529.900] (-3532.591) (-3527.634) (-3531.031) * (-3529.114) [-3528.530] (-3530.379) (-3533.869) -- 0:03:45 121500 -- [-3529.956] (-3528.059) (-3528.784) (-3530.558) * (-3528.782) (-3533.299) (-3531.246) [-3529.179] -- 0:03:51 122000 -- (-3531.786) [-3532.091] (-3531.599) (-3531.957) * (-3529.429) (-3529.244) (-3528.858) [-3531.075] -- 0:03:50 122500 -- (-3526.213) (-3535.746) (-3531.521) [-3531.796] * (-3537.358) [-3530.179] (-3527.084) (-3530.864) -- 0:03:49 123000 -- [-3526.069] (-3529.014) (-3530.818) (-3527.131) * (-3532.043) [-3530.509] (-3528.306) (-3538.523) -- 0:03:48 123500 -- (-3531.908) [-3528.367] (-3535.135) (-3531.195) * (-3534.403) [-3528.879] (-3528.051) (-3535.079) -- 0:03:47 124000 -- (-3534.117) (-3534.467) (-3531.779) [-3529.608] * (-3530.549) (-3532.747) [-3527.160] (-3530.577) -- 0:03:46 124500 -- (-3530.687) (-3534.420) (-3529.503) [-3530.283] * (-3532.648) (-3529.554) (-3528.544) [-3527.487] -- 0:03:45 125000 -- (-3531.256) (-3536.364) [-3527.387] (-3539.798) * (-3530.158) (-3528.782) [-3527.962] (-3532.497) -- 0:03:44 Average standard deviation of split frequencies: 0.000000 125500 -- (-3533.537) (-3540.884) [-3528.555] (-3540.104) * (-3528.960) (-3530.922) (-3527.803) [-3530.063] -- 0:03:49 126000 -- (-3534.872) [-3528.320] (-3527.659) (-3530.990) * (-3536.073) (-3528.199) [-3531.944] (-3536.423) -- 0:03:48 126500 -- (-3532.854) (-3530.989) [-3527.625] (-3535.396) * (-3530.837) [-3531.993] (-3530.248) (-3537.840) -- 0:03:47 127000 -- (-3529.879) (-3524.617) [-3529.930] (-3528.091) * (-3530.292) [-3528.130] (-3530.563) (-3537.029) -- 0:03:46 127500 -- (-3536.302) [-3528.708] (-3532.879) (-3528.773) * [-3525.590] (-3532.561) (-3532.328) (-3532.675) -- 0:03:45 128000 -- (-3531.633) (-3534.807) [-3531.968] (-3532.065) * (-3530.561) (-3540.527) [-3528.434] (-3530.521) -- 0:03:44 128500 -- (-3527.915) (-3531.217) [-3533.052] (-3526.913) * (-3533.250) (-3534.025) [-3536.411] (-3530.652) -- 0:03:43 129000 -- (-3529.959) (-3538.899) (-3535.543) [-3527.442] * (-3534.257) (-3534.001) [-3526.483] (-3527.176) -- 0:03:42 129500 -- (-3531.228) (-3528.137) (-3531.732) [-3530.674] * (-3536.673) (-3536.877) (-3528.754) [-3529.736] -- 0:03:48 130000 -- [-3532.580] (-3537.187) (-3529.295) (-3532.181) * (-3529.484) [-3535.783] (-3531.303) (-3527.718) -- 0:03:47 Average standard deviation of split frequencies: 0.000000 130500 -- (-3535.818) (-3527.343) [-3535.227] (-3532.287) * (-3527.826) (-3535.882) [-3532.924] (-3533.498) -- 0:03:46 131000 -- (-3538.994) [-3527.657] (-3529.652) (-3530.102) * (-3536.150) (-3547.774) (-3535.143) [-3530.696] -- 0:03:45 131500 -- (-3529.671) [-3532.752] (-3532.390) (-3530.603) * [-3526.133] (-3538.374) (-3535.305) (-3536.504) -- 0:03:44 132000 -- (-3535.750) (-3532.486) [-3528.641] (-3528.530) * (-3527.027) (-3539.395) (-3529.143) [-3525.637] -- 0:03:43 132500 -- (-3529.476) [-3529.239] (-3535.283) (-3533.740) * (-3528.205) (-3538.551) (-3532.428) [-3529.096] -- 0:03:42 133000 -- (-3529.809) [-3532.605] (-3534.403) (-3533.120) * [-3530.980] (-3536.750) (-3532.804) (-3534.579) -- 0:03:48 133500 -- (-3532.311) [-3531.501] (-3528.202) (-3534.135) * [-3528.164] (-3532.463) (-3529.827) (-3527.787) -- 0:03:47 134000 -- (-3534.107) (-3530.712) (-3531.225) [-3532.401] * [-3534.281] (-3526.268) (-3534.417) (-3534.465) -- 0:03:46 134500 -- [-3527.992] (-3529.679) (-3533.843) (-3531.859) * [-3534.557] (-3535.824) (-3533.456) (-3535.871) -- 0:03:45 135000 -- (-3535.970) [-3534.358] (-3537.575) (-3530.610) * (-3543.339) (-3531.700) [-3530.971] (-3529.050) -- 0:03:44 Average standard deviation of split frequencies: 0.000000 135500 -- (-3537.955) [-3530.410] (-3545.332) (-3533.687) * (-3531.974) (-3533.353) (-3530.902) [-3530.229] -- 0:03:43 136000 -- [-3530.341] (-3526.802) (-3532.832) (-3536.148) * (-3532.809) (-3528.693) (-3531.629) [-3528.158] -- 0:03:42 136500 -- [-3528.096] (-3530.155) (-3532.320) (-3529.507) * (-3535.104) [-3528.987] (-3528.830) (-3533.588) -- 0:03:41 137000 -- [-3528.679] (-3530.863) (-3534.683) (-3530.658) * (-3533.634) [-3532.276] (-3533.094) (-3528.085) -- 0:03:46 137500 -- (-3528.835) (-3535.585) (-3530.905) [-3533.546] * (-3533.897) (-3534.092) [-3533.266] (-3531.317) -- 0:03:45 138000 -- (-3535.658) (-3530.548) [-3532.875] (-3539.778) * (-3528.901) [-3524.690] (-3534.955) (-3530.409) -- 0:03:44 138500 -- (-3530.041) (-3534.384) [-3532.421] (-3542.342) * (-3530.395) (-3528.301) (-3531.233) [-3527.824] -- 0:03:43 139000 -- (-3533.992) (-3531.955) (-3534.162) [-3539.401] * (-3539.650) (-3533.935) (-3525.571) [-3533.003] -- 0:03:42 139500 -- (-3533.698) [-3530.073] (-3527.505) (-3532.538) * (-3530.281) [-3534.064] (-3529.403) (-3528.525) -- 0:03:42 140000 -- (-3531.368) (-3531.031) (-3532.252) [-3534.686] * (-3531.939) [-3531.181] (-3529.927) (-3529.378) -- 0:03:41 Average standard deviation of split frequencies: 0.000000 140500 -- (-3528.686) [-3529.935] (-3530.116) (-3537.622) * [-3530.778] (-3531.578) (-3529.448) (-3537.270) -- 0:03:40 141000 -- (-3528.918) [-3528.174] (-3528.438) (-3534.266) * (-3533.547) [-3530.154] (-3530.453) (-3529.137) -- 0:03:45 141500 -- (-3529.119) [-3537.197] (-3529.023) (-3539.768) * (-3531.918) (-3532.281) [-3536.222] (-3541.088) -- 0:03:44 142000 -- [-3528.519] (-3536.509) (-3533.681) (-3535.626) * (-3534.959) [-3533.935] (-3532.939) (-3526.772) -- 0:03:43 142500 -- [-3530.853] (-3533.651) (-3533.348) (-3531.471) * (-3534.344) [-3533.370] (-3532.049) (-3531.768) -- 0:03:42 143000 -- (-3528.611) (-3532.381) [-3535.549] (-3538.060) * (-3528.542) (-3527.555) (-3532.740) [-3530.871] -- 0:03:41 143500 -- (-3529.375) (-3528.349) (-3531.825) [-3530.900] * (-3533.828) (-3531.700) [-3529.851] (-3528.811) -- 0:03:40 144000 -- (-3529.666) (-3528.719) (-3535.602) [-3536.455] * [-3529.204] (-3533.786) (-3533.869) (-3529.289) -- 0:03:39 144500 -- [-3528.798] (-3531.630) (-3529.816) (-3529.273) * [-3531.482] (-3531.490) (-3528.021) (-3536.161) -- 0:03:44 145000 -- [-3530.608] (-3532.267) (-3533.399) (-3529.910) * (-3532.285) [-3528.268] (-3533.597) (-3533.230) -- 0:03:44 Average standard deviation of split frequencies: 0.000000 145500 -- (-3529.955) [-3532.217] (-3534.270) (-3530.951) * (-3535.919) (-3534.050) [-3530.687] (-3545.089) -- 0:03:43 146000 -- (-3531.146) (-3533.339) (-3530.552) [-3532.660] * [-3544.004] (-3530.853) (-3531.766) (-3533.456) -- 0:03:42 146500 -- (-3536.750) (-3535.074) [-3529.395] (-3529.990) * (-3540.091) [-3530.614] (-3531.648) (-3530.320) -- 0:03:41 147000 -- (-3542.641) (-3531.138) (-3535.659) [-3533.336] * (-3535.324) (-3529.171) (-3536.401) [-3529.531] -- 0:03:40 147500 -- (-3535.520) (-3538.406) [-3532.700] (-3541.124) * [-3531.401] (-3527.853) (-3536.886) (-3529.006) -- 0:03:39 148000 -- [-3527.915] (-3534.792) (-3534.180) (-3536.800) * (-3530.673) [-3534.047] (-3535.438) (-3529.257) -- 0:03:38 148500 -- (-3536.760) (-3532.977) (-3531.496) [-3532.348] * [-3529.295] (-3529.886) (-3534.684) (-3529.689) -- 0:03:43 149000 -- (-3532.452) (-3535.111) (-3536.406) [-3530.065] * (-3527.191) (-3531.226) [-3531.886] (-3532.213) -- 0:03:42 149500 -- (-3526.943) [-3534.016] (-3541.850) (-3532.421) * (-3529.039) (-3533.375) [-3532.866] (-3530.598) -- 0:03:41 150000 -- (-3531.570) (-3535.295) (-3535.302) [-3534.204] * (-3530.798) [-3526.064] (-3537.641) (-3527.726) -- 0:03:40 Average standard deviation of split frequencies: 0.000000 150500 -- (-3528.576) (-3526.861) (-3542.299) [-3528.914] * [-3530.961] (-3530.822) (-3533.040) (-3529.309) -- 0:03:40 151000 -- (-3527.565) [-3527.851] (-3530.286) (-3531.604) * (-3530.062) [-3527.511] (-3543.591) (-3530.008) -- 0:03:39 151500 -- (-3531.615) (-3529.287) [-3528.270] (-3536.239) * [-3530.957] (-3531.224) (-3540.661) (-3527.119) -- 0:03:38 152000 -- (-3532.369) [-3537.306] (-3533.621) (-3525.649) * (-3536.326) [-3526.989] (-3534.702) (-3533.927) -- 0:03:37 152500 -- [-3532.067] (-3531.947) (-3535.887) (-3532.457) * (-3529.347) [-3531.421] (-3531.303) (-3536.723) -- 0:03:42 153000 -- [-3529.043] (-3530.943) (-3538.865) (-3532.300) * (-3534.799) [-3526.274] (-3528.914) (-3528.388) -- 0:03:41 153500 -- (-3530.883) (-3538.796) (-3530.868) [-3529.442] * (-3538.721) (-3526.373) (-3533.150) [-3532.498] -- 0:03:40 154000 -- (-3525.572) (-3534.499) [-3528.989] (-3535.575) * (-3536.171) (-3527.589) (-3533.369) [-3527.168] -- 0:03:39 154500 -- (-3532.476) (-3532.322) [-3529.497] (-3533.945) * (-3528.429) (-3540.488) (-3529.120) [-3529.472] -- 0:03:38 155000 -- [-3539.183] (-3537.962) (-3525.744) (-3538.532) * (-3532.832) (-3533.541) (-3538.265) [-3533.174] -- 0:03:38 Average standard deviation of split frequencies: 0.000000 155500 -- (-3540.329) [-3529.897] (-3536.107) (-3529.587) * [-3532.828] (-3535.695) (-3526.337) (-3536.366) -- 0:03:37 156000 -- [-3529.878] (-3529.378) (-3529.156) (-3530.260) * [-3536.018] (-3530.018) (-3530.846) (-3530.669) -- 0:03:41 156500 -- (-3530.009) [-3535.725] (-3541.462) (-3530.654) * (-3531.841) (-3530.155) [-3527.793] (-3532.943) -- 0:03:40 157000 -- [-3532.140] (-3532.996) (-3534.628) (-3531.911) * (-3529.914) (-3526.511) (-3526.188) [-3527.731] -- 0:03:40 157500 -- (-3530.051) (-3535.060) [-3532.288] (-3530.884) * (-3532.015) [-3528.178] (-3529.056) (-3531.367) -- 0:03:39 158000 -- (-3533.460) [-3531.054] (-3529.747) (-3537.861) * (-3533.179) (-3532.378) [-3532.068] (-3532.764) -- 0:03:38 158500 -- (-3533.994) (-3531.769) (-3538.259) [-3534.483] * [-3535.258] (-3530.340) (-3533.728) (-3527.992) -- 0:03:37 159000 -- (-3534.218) [-3526.738] (-3534.686) (-3532.105) * (-3532.259) (-3533.518) (-3534.611) [-3529.908] -- 0:03:36 159500 -- [-3533.633] (-3532.120) (-3533.517) (-3530.503) * (-3534.336) (-3531.953) [-3534.367] (-3533.746) -- 0:03:36 160000 -- [-3528.323] (-3532.847) (-3529.765) (-3527.726) * [-3530.264] (-3536.540) (-3536.032) (-3530.894) -- 0:03:40 Average standard deviation of split frequencies: 0.000000 160500 -- (-3534.353) [-3532.848] (-3535.928) (-3530.598) * (-3529.544) (-3532.784) (-3535.229) [-3526.909] -- 0:03:39 161000 -- (-3534.193) (-3531.364) [-3534.223] (-3532.259) * [-3530.457] (-3532.457) (-3531.711) (-3533.279) -- 0:03:38 161500 -- (-3531.511) [-3529.591] (-3533.279) (-3527.372) * (-3526.111) (-3533.249) [-3528.235] (-3536.281) -- 0:03:38 162000 -- (-3534.509) (-3530.407) [-3533.480] (-3533.192) * (-3529.069) (-3532.362) [-3531.436] (-3544.401) -- 0:03:37 162500 -- (-3526.726) (-3528.813) (-3536.499) [-3529.721] * [-3531.519] (-3541.511) (-3527.652) (-3542.391) -- 0:03:36 163000 -- (-3537.566) (-3540.230) (-3528.829) [-3534.635] * (-3531.045) (-3533.574) (-3534.435) [-3530.644] -- 0:03:35 163500 -- [-3529.325] (-3529.396) (-3538.269) (-3532.671) * (-3536.432) [-3529.763] (-3526.907) (-3531.683) -- 0:03:34 164000 -- (-3527.507) (-3532.059) (-3532.554) [-3529.661] * [-3530.097] (-3534.496) (-3529.229) (-3533.889) -- 0:03:39 164500 -- (-3533.060) (-3531.454) (-3528.414) [-3534.507] * (-3531.865) (-3529.849) (-3532.483) [-3535.202] -- 0:03:38 165000 -- (-3532.355) (-3530.677) [-3528.988] (-3536.822) * (-3527.767) [-3526.734] (-3533.301) (-3536.059) -- 0:03:37 Average standard deviation of split frequencies: 0.000000 165500 -- (-3533.083) (-3532.865) [-3530.155] (-3533.607) * (-3536.117) (-3525.496) (-3537.102) [-3531.787] -- 0:03:36 166000 -- (-3541.333) (-3530.640) [-3529.698] (-3528.282) * [-3527.138] (-3533.016) (-3539.096) (-3531.445) -- 0:03:36 166500 -- (-3530.330) (-3540.152) (-3527.968) [-3532.966] * (-3532.863) (-3528.614) (-3538.927) [-3525.560] -- 0:03:35 167000 -- [-3538.006] (-3538.259) (-3532.812) (-3538.176) * [-3527.442] (-3536.465) (-3532.336) (-3539.776) -- 0:03:34 167500 -- (-3536.384) (-3529.334) [-3529.364] (-3534.074) * (-3530.387) (-3530.880) (-3531.001) [-3532.859] -- 0:03:38 168000 -- (-3534.009) (-3532.920) [-3526.328] (-3524.669) * [-3535.808] (-3530.335) (-3532.864) (-3534.914) -- 0:03:37 168500 -- (-3536.555) (-3529.239) (-3533.876) [-3531.629] * [-3531.567] (-3527.470) (-3528.181) (-3528.627) -- 0:03:37 169000 -- (-3538.968) (-3534.699) (-3531.040) [-3531.749] * (-3534.319) (-3526.859) [-3534.246] (-3535.882) -- 0:03:36 169500 -- (-3535.168) (-3531.287) [-3528.139] (-3526.524) * (-3531.735) (-3532.150) [-3528.680] (-3534.831) -- 0:03:35 170000 -- (-3537.675) (-3531.882) (-3532.536) [-3528.756] * [-3528.178] (-3532.376) (-3529.147) (-3531.843) -- 0:03:34 Average standard deviation of split frequencies: 0.000000 170500 -- (-3532.099) (-3530.309) (-3530.392) [-3527.474] * (-3531.331) (-3547.019) (-3534.860) [-3531.227] -- 0:03:34 171000 -- [-3527.128] (-3529.473) (-3532.504) (-3528.733) * [-3532.192] (-3549.749) (-3529.425) (-3530.326) -- 0:03:33 171500 -- [-3530.238] (-3532.604) (-3534.201) (-3530.625) * (-3538.226) (-3535.899) [-3530.609] (-3532.053) -- 0:03:37 172000 -- [-3529.352] (-3530.606) (-3533.683) (-3533.414) * (-3534.842) [-3539.169] (-3530.073) (-3532.282) -- 0:03:36 172500 -- [-3527.368] (-3541.493) (-3532.054) (-3531.620) * [-3529.727] (-3535.983) (-3528.603) (-3527.890) -- 0:03:35 173000 -- (-3529.524) (-3531.440) [-3532.727] (-3539.203) * (-3534.931) (-3536.553) (-3528.925) [-3529.992] -- 0:03:35 173500 -- (-3536.071) [-3531.565] (-3534.428) (-3529.444) * (-3533.850) (-3534.634) (-3525.178) [-3530.998] -- 0:03:34 174000 -- (-3533.879) [-3531.384] (-3532.490) (-3537.507) * (-3534.554) (-3529.440) (-3526.540) [-3536.029] -- 0:03:33 174500 -- (-3530.575) [-3531.494] (-3527.242) (-3533.528) * [-3533.226] (-3530.852) (-3526.741) (-3530.758) -- 0:03:32 175000 -- (-3530.521) (-3531.085) [-3526.838] (-3538.737) * (-3533.684) (-3533.851) [-3528.660] (-3536.030) -- 0:03:32 Average standard deviation of split frequencies: 0.000000 175500 -- [-3534.592] (-3532.028) (-3534.549) (-3530.393) * (-3535.544) (-3533.531) [-3529.070] (-3535.894) -- 0:03:36 176000 -- [-3530.808] (-3529.188) (-3538.393) (-3537.598) * [-3531.900] (-3538.074) (-3528.108) (-3528.047) -- 0:03:35 176500 -- (-3532.432) [-3530.111] (-3534.454) (-3535.793) * (-3535.038) [-3534.921] (-3534.860) (-3528.221) -- 0:03:34 177000 -- [-3526.186] (-3529.000) (-3533.400) (-3530.145) * (-3535.411) [-3528.602] (-3533.852) (-3533.853) -- 0:03:33 177500 -- (-3531.185) [-3528.426] (-3529.852) (-3533.754) * (-3537.134) [-3530.835] (-3543.935) (-3529.736) -- 0:03:33 178000 -- (-3533.616) [-3532.313] (-3528.917) (-3535.178) * (-3538.156) (-3527.529) [-3537.723] (-3533.917) -- 0:03:32 178500 -- (-3532.617) (-3529.107) [-3533.686] (-3532.728) * [-3527.766] (-3530.391) (-3530.932) (-3532.000) -- 0:03:31 179000 -- (-3534.593) [-3528.684] (-3529.378) (-3536.791) * [-3530.211] (-3530.303) (-3531.449) (-3532.376) -- 0:03:30 179500 -- (-3533.549) (-3540.945) (-3530.140) [-3530.016] * [-3526.498] (-3525.816) (-3540.173) (-3534.967) -- 0:03:34 180000 -- (-3534.829) [-3534.622] (-3541.457) (-3532.496) * (-3530.770) [-3526.648] (-3536.493) (-3530.940) -- 0:03:34 Average standard deviation of split frequencies: 0.000000 180500 -- (-3536.773) [-3531.977] (-3528.736) (-3532.011) * [-3529.855] (-3528.608) (-3538.955) (-3530.365) -- 0:03:33 181000 -- (-3530.702) [-3536.099] (-3538.834) (-3529.442) * (-3531.015) [-3528.253] (-3535.660) (-3532.951) -- 0:03:32 181500 -- [-3528.752] (-3534.656) (-3535.400) (-3533.731) * [-3527.302] (-3532.381) (-3529.081) (-3529.855) -- 0:03:31 182000 -- (-3533.782) [-3529.357] (-3531.974) (-3531.276) * (-3530.166) (-3528.155) [-3535.400] (-3532.519) -- 0:03:31 182500 -- (-3538.110) (-3528.466) [-3529.779] (-3533.332) * (-3529.091) (-3534.234) [-3531.929] (-3529.033) -- 0:03:30 183000 -- (-3541.609) (-3528.389) (-3532.426) [-3536.264] * (-3532.570) (-3538.187) [-3530.943] (-3535.870) -- 0:03:34 183500 -- [-3528.846] (-3533.121) (-3528.159) (-3535.300) * (-3537.567) (-3536.603) [-3528.406] (-3539.140) -- 0:03:33 184000 -- [-3527.944] (-3533.951) (-3533.213) (-3535.603) * (-3528.010) [-3536.801] (-3538.817) (-3539.160) -- 0:03:32 184500 -- (-3534.229) (-3533.645) [-3529.246] (-3534.227) * [-3533.316] (-3528.118) (-3539.188) (-3534.334) -- 0:03:32 185000 -- [-3530.407] (-3530.829) (-3528.489) (-3527.462) * (-3529.661) (-3534.417) [-3532.599] (-3531.812) -- 0:03:31 Average standard deviation of split frequencies: 0.000000 185500 -- (-3527.199) (-3533.092) (-3532.781) [-3530.728] * [-3527.394] (-3533.009) (-3535.658) (-3532.913) -- 0:03:30 186000 -- (-3537.062) [-3528.560] (-3533.755) (-3532.839) * [-3528.556] (-3536.770) (-3533.098) (-3529.745) -- 0:03:30 186500 -- (-3534.751) [-3531.723] (-3533.462) (-3538.256) * (-3532.218) (-3531.577) (-3531.088) [-3531.448] -- 0:03:29 187000 -- (-3534.952) [-3528.207] (-3536.125) (-3534.350) * (-3533.262) [-3527.317] (-3533.360) (-3534.478) -- 0:03:33 187500 -- (-3530.514) (-3530.462) [-3532.706] (-3532.640) * [-3533.603] (-3529.576) (-3532.526) (-3534.286) -- 0:03:32 188000 -- (-3531.168) (-3526.403) (-3529.093) [-3528.330] * (-3534.091) (-3536.082) [-3530.696] (-3531.314) -- 0:03:31 188500 -- (-3533.695) (-3528.326) [-3534.696] (-3531.889) * (-3536.117) (-3527.729) (-3536.425) [-3528.748] -- 0:03:30 189000 -- (-3537.403) (-3529.265) (-3537.969) [-3531.940] * (-3526.607) [-3529.536] (-3533.355) (-3528.435) -- 0:03:30 189500 -- (-3534.587) [-3529.436] (-3532.272) (-3528.825) * (-3534.141) (-3526.738) (-3532.443) [-3528.368] -- 0:03:29 190000 -- [-3533.486] (-3529.396) (-3532.559) (-3528.506) * (-3530.244) (-3525.678) [-3530.949] (-3526.911) -- 0:03:28 Average standard deviation of split frequencies: 0.000000 190500 -- [-3534.326] (-3530.861) (-3528.151) (-3527.934) * (-3529.638) (-3526.167) (-3536.740) [-3528.960] -- 0:03:28 191000 -- (-3536.546) [-3531.332] (-3535.107) (-3530.088) * [-3526.857] (-3535.810) (-3540.077) (-3534.143) -- 0:03:31 191500 -- (-3533.933) (-3530.609) [-3527.036] (-3529.650) * (-3528.432) (-3526.147) (-3531.482) [-3535.292] -- 0:03:31 192000 -- (-3537.454) (-3533.281) [-3531.315] (-3532.350) * (-3531.162) [-3532.618] (-3533.060) (-3532.989) -- 0:03:30 192500 -- (-3536.626) (-3533.205) (-3537.315) [-3531.186] * (-3536.047) (-3543.036) [-3532.927] (-3531.474) -- 0:03:29 193000 -- (-3533.814) [-3530.232] (-3533.455) (-3531.550) * (-3534.143) [-3528.173] (-3535.253) (-3529.999) -- 0:03:29 193500 -- (-3533.603) (-3534.637) [-3530.984] (-3536.671) * (-3534.119) (-3530.609) (-3538.185) [-3528.796] -- 0:03:28 194000 -- [-3535.434] (-3528.273) (-3531.611) (-3534.056) * (-3535.690) (-3533.379) (-3530.257) [-3527.451] -- 0:03:27 194500 -- (-3531.256) (-3531.452) [-3529.414] (-3534.333) * (-3533.515) (-3526.836) (-3536.187) [-3532.281] -- 0:03:31 195000 -- (-3529.668) [-3527.009] (-3530.663) (-3531.668) * [-3533.793] (-3531.269) (-3534.167) (-3529.475) -- 0:03:30 Average standard deviation of split frequencies: 0.000000 195500 -- (-3533.563) (-3529.879) (-3533.821) [-3529.102] * (-3529.285) (-3531.564) [-3536.690] (-3527.396) -- 0:03:29 196000 -- (-3528.944) [-3527.352] (-3527.378) (-3533.899) * (-3531.147) [-3526.202] (-3531.878) (-3533.644) -- 0:03:29 196500 -- (-3532.936) (-3532.334) (-3535.027) [-3528.067] * (-3529.654) (-3533.873) (-3531.231) [-3528.269] -- 0:03:28 197000 -- [-3533.236] (-3529.436) (-3526.666) (-3532.507) * (-3529.174) (-3535.502) [-3530.267] (-3527.282) -- 0:03:27 197500 -- [-3527.767] (-3529.488) (-3536.904) (-3530.852) * [-3535.751] (-3534.249) (-3529.140) (-3527.628) -- 0:03:27 198000 -- [-3527.102] (-3528.865) (-3535.999) (-3527.686) * [-3533.630] (-3538.021) (-3530.009) (-3527.369) -- 0:03:26 198500 -- [-3528.416] (-3527.591) (-3534.202) (-3534.541) * [-3532.488] (-3531.783) (-3533.390) (-3529.299) -- 0:03:29 199000 -- (-3532.706) (-3530.896) [-3534.738] (-3529.912) * (-3529.926) [-3528.965] (-3531.174) (-3529.278) -- 0:03:29 199500 -- (-3531.367) [-3529.770] (-3528.203) (-3536.976) * (-3529.357) (-3534.130) (-3532.543) [-3531.696] -- 0:03:28 200000 -- (-3537.245) (-3534.222) [-3529.229] (-3533.764) * (-3531.657) (-3535.277) [-3528.934] (-3533.248) -- 0:03:27 Average standard deviation of split frequencies: 0.000000 200500 -- (-3528.788) (-3527.901) (-3535.791) [-3530.238] * (-3530.343) (-3532.855) (-3531.503) [-3529.623] -- 0:03:27 201000 -- (-3534.418) [-3529.742] (-3532.260) (-3533.873) * (-3533.516) (-3528.873) (-3536.568) [-3532.312] -- 0:03:26 201500 -- [-3531.852] (-3528.897) (-3529.182) (-3535.842) * [-3532.103] (-3524.395) (-3532.295) (-3533.417) -- 0:03:26 202000 -- (-3531.216) (-3531.442) [-3533.955] (-3539.757) * (-3536.230) (-3534.114) [-3531.833] (-3530.420) -- 0:03:25 202500 -- (-3529.385) (-3526.277) [-3528.452] (-3530.214) * [-3533.114] (-3535.744) (-3544.076) (-3527.815) -- 0:03:28 203000 -- (-3528.455) [-3532.316] (-3528.510) (-3534.279) * (-3529.457) (-3534.713) (-3537.509) [-3526.201] -- 0:03:28 203500 -- [-3530.403] (-3533.565) (-3535.091) (-3537.534) * (-3530.600) (-3534.924) (-3530.221) [-3534.805] -- 0:03:27 204000 -- [-3527.474] (-3529.347) (-3530.587) (-3538.096) * [-3534.944] (-3530.792) (-3533.327) (-3536.919) -- 0:03:26 204500 -- [-3526.814] (-3526.669) (-3528.776) (-3526.488) * [-3526.663] (-3536.205) (-3526.834) (-3534.170) -- 0:03:26 205000 -- (-3538.199) (-3533.422) [-3528.168] (-3531.083) * (-3528.925) (-3531.630) [-3532.992] (-3538.170) -- 0:03:25 Average standard deviation of split frequencies: 0.000000 205500 -- [-3525.402] (-3534.454) (-3531.901) (-3530.680) * (-3537.761) (-3529.176) (-3534.126) [-3530.095] -- 0:03:24 206000 -- (-3537.804) (-3535.008) (-3528.437) [-3528.345] * (-3532.715) (-3528.755) (-3535.116) [-3530.642] -- 0:03:28 206500 -- (-3528.958) (-3535.817) (-3531.375) [-3524.642] * (-3531.461) (-3536.561) [-3530.025] (-3528.241) -- 0:03:27 207000 -- (-3531.814) (-3533.746) (-3534.179) [-3530.779] * (-3529.934) (-3529.676) [-3529.563] (-3535.833) -- 0:03:26 207500 -- (-3533.230) (-3529.811) (-3534.461) [-3532.349] * (-3527.728) [-3529.764] (-3534.207) (-3529.358) -- 0:03:26 208000 -- [-3528.414] (-3534.370) (-3527.957) (-3528.075) * (-3530.915) (-3532.094) (-3536.474) [-3534.841] -- 0:03:25 208500 -- [-3528.000] (-3533.726) (-3536.335) (-3529.108) * (-3528.170) (-3536.139) (-3540.869) [-3529.897] -- 0:03:24 209000 -- (-3522.669) [-3532.752] (-3531.992) (-3528.661) * [-3529.856] (-3531.974) (-3540.121) (-3531.652) -- 0:03:24 209500 -- (-3526.646) (-3534.745) [-3529.836] (-3530.528) * [-3529.274] (-3533.002) (-3530.535) (-3535.771) -- 0:03:23 210000 -- [-3528.229] (-3534.466) (-3532.276) (-3528.673) * (-3532.982) [-3535.225] (-3532.687) (-3534.506) -- 0:03:26 Average standard deviation of split frequencies: 0.000000 210500 -- [-3531.925] (-3530.780) (-3530.074) (-3530.051) * (-3534.588) (-3531.129) [-3529.953] (-3536.734) -- 0:03:26 211000 -- (-3526.966) (-3537.998) (-3534.362) [-3524.657] * (-3529.042) [-3532.083] (-3529.991) (-3529.587) -- 0:03:25 211500 -- (-3526.907) [-3533.460] (-3533.210) (-3535.060) * [-3535.590] (-3530.328) (-3535.193) (-3531.177) -- 0:03:25 212000 -- [-3529.407] (-3530.586) (-3531.698) (-3532.934) * (-3537.671) [-3529.373] (-3532.634) (-3528.906) -- 0:03:24 212500 -- (-3537.117) [-3529.925] (-3530.312) (-3536.867) * [-3533.639] (-3532.746) (-3531.860) (-3531.063) -- 0:03:23 213000 -- [-3530.974] (-3532.370) (-3532.245) (-3529.912) * [-3531.354] (-3532.581) (-3534.611) (-3532.399) -- 0:03:23 213500 -- (-3527.757) [-3528.329] (-3536.724) (-3532.065) * (-3537.996) (-3534.816) [-3530.106] (-3533.008) -- 0:03:22 214000 -- (-3531.408) [-3527.297] (-3533.939) (-3531.025) * (-3529.522) (-3533.659) [-3526.342] (-3539.360) -- 0:03:25 214500 -- [-3529.386] (-3530.482) (-3532.842) (-3533.844) * [-3529.441] (-3535.266) (-3527.868) (-3531.751) -- 0:03:25 215000 -- (-3528.568) (-3536.092) (-3532.113) [-3525.678] * (-3536.237) (-3542.410) (-3529.394) [-3538.854] -- 0:03:24 Average standard deviation of split frequencies: 0.000000 215500 -- (-3534.434) (-3537.272) [-3535.098] (-3528.829) * (-3530.212) (-3544.370) [-3530.165] (-3537.156) -- 0:03:23 216000 -- [-3532.319] (-3533.432) (-3538.345) (-3528.776) * (-3530.717) (-3531.937) [-3531.107] (-3535.674) -- 0:03:23 216500 -- (-3530.426) (-3534.935) (-3538.473) [-3535.363] * (-3528.514) (-3532.675) [-3535.140] (-3534.556) -- 0:03:22 217000 -- [-3532.281] (-3531.002) (-3539.759) (-3530.686) * (-3534.202) (-3532.293) [-3532.271] (-3532.879) -- 0:03:22 217500 -- (-3533.927) (-3530.324) (-3538.478) [-3529.916] * (-3529.930) (-3531.905) [-3532.297] (-3533.063) -- 0:03:21 218000 -- [-3535.735] (-3533.819) (-3532.296) (-3529.892) * (-3539.017) (-3528.503) [-3534.372] (-3528.478) -- 0:03:24 218500 -- (-3533.163) (-3539.682) [-3530.140] (-3536.938) * (-3528.977) (-3530.360) (-3529.997) [-3528.539] -- 0:03:23 219000 -- (-3532.680) [-3530.270] (-3531.972) (-3533.122) * (-3528.775) (-3533.187) [-3532.263] (-3529.664) -- 0:03:23 219500 -- [-3535.660] (-3533.751) (-3525.804) (-3532.094) * (-3530.983) (-3534.420) (-3530.962) [-3525.537] -- 0:03:22 220000 -- (-3538.582) (-3529.943) [-3530.954] (-3533.977) * (-3530.029) (-3535.001) [-3527.816] (-3534.110) -- 0:03:22 Average standard deviation of split frequencies: 0.000000 220500 -- (-3532.446) [-3531.996] (-3535.464) (-3537.836) * (-3539.616) (-3533.997) [-3531.947] (-3539.706) -- 0:03:21 221000 -- (-3534.041) (-3533.466) [-3539.054] (-3534.475) * (-3530.027) (-3527.346) (-3529.050) [-3534.989] -- 0:03:20 221500 -- (-3528.475) [-3533.546] (-3530.687) (-3527.954) * (-3529.913) (-3526.314) [-3532.618] (-3533.859) -- 0:03:23 222000 -- (-3530.949) (-3532.180) (-3532.303) [-3530.808] * (-3525.889) (-3534.877) (-3528.533) [-3528.500] -- 0:03:23 222500 -- (-3529.727) (-3530.055) (-3527.339) [-3532.497] * (-3524.418) [-3533.155] (-3532.400) (-3529.621) -- 0:03:22 223000 -- (-3535.977) [-3527.861] (-3525.942) (-3531.838) * [-3533.712] (-3540.047) (-3534.898) (-3527.618) -- 0:03:22 223500 -- [-3529.097] (-3533.716) (-3532.812) (-3533.992) * (-3532.137) (-3530.011) (-3537.093) [-3528.726] -- 0:03:21 224000 -- (-3535.819) (-3532.449) [-3533.578] (-3531.854) * (-3535.314) [-3529.728] (-3528.547) (-3534.390) -- 0:03:20 224500 -- (-3530.424) (-3530.279) [-3540.288] (-3528.767) * (-3532.201) [-3531.396] (-3531.465) (-3527.045) -- 0:03:20 225000 -- [-3526.573] (-3533.080) (-3532.829) (-3533.973) * (-3535.560) [-3524.855] (-3536.654) (-3530.305) -- 0:03:19 Average standard deviation of split frequencies: 0.000000 225500 -- [-3537.503] (-3529.393) (-3533.370) (-3532.469) * [-3528.136] (-3536.880) (-3535.052) (-3532.060) -- 0:03:22 226000 -- (-3529.584) (-3526.649) (-3533.780) [-3533.497] * [-3529.907] (-3534.831) (-3528.170) (-3528.061) -- 0:03:22 226500 -- (-3527.071) [-3525.654] (-3537.250) (-3536.229) * (-3527.764) (-3536.947) [-3536.490] (-3536.279) -- 0:03:21 227000 -- (-3530.296) (-3531.282) (-3535.912) [-3528.178] * (-3531.154) (-3530.928) (-3531.503) [-3533.245] -- 0:03:20 227500 -- (-3527.246) (-3528.423) [-3533.485] (-3532.562) * (-3533.555) [-3530.691] (-3527.595) (-3530.756) -- 0:03:20 228000 -- (-3533.729) (-3530.701) [-3528.815] (-3533.248) * (-3532.333) (-3533.790) [-3529.943] (-3526.189) -- 0:03:19 228500 -- (-3528.921) (-3528.055) [-3532.391] (-3530.689) * [-3531.374] (-3536.881) (-3529.784) (-3531.827) -- 0:03:19 229000 -- (-3532.326) [-3531.157] (-3525.101) (-3535.773) * (-3542.926) (-3535.101) (-3531.599) [-3529.982] -- 0:03:22 229500 -- (-3532.665) (-3531.713) [-3536.767] (-3534.577) * (-3534.882) [-3531.250] (-3536.209) (-3531.086) -- 0:03:21 230000 -- [-3528.513] (-3530.396) (-3537.402) (-3526.057) * (-3534.624) (-3532.843) [-3526.630] (-3536.787) -- 0:03:20 Average standard deviation of split frequencies: 0.000000 230500 -- (-3535.381) (-3532.033) (-3531.602) [-3530.247] * (-3529.951) (-3533.681) (-3526.711) [-3531.534] -- 0:03:20 231000 -- [-3529.461] (-3529.215) (-3532.044) (-3528.711) * [-3527.422] (-3535.075) (-3524.696) (-3534.597) -- 0:03:19 231500 -- [-3534.596] (-3534.290) (-3529.214) (-3534.855) * [-3531.905] (-3532.701) (-3534.101) (-3525.666) -- 0:03:19 232000 -- (-3529.363) (-3541.485) [-3531.445] (-3536.463) * [-3526.602] (-3531.999) (-3531.184) (-3528.492) -- 0:03:18 232500 -- (-3531.394) [-3532.647] (-3528.515) (-3530.076) * (-3529.491) (-3534.562) [-3529.844] (-3527.000) -- 0:03:18 233000 -- (-3534.526) [-3529.766] (-3535.098) (-3532.960) * (-3530.701) (-3539.648) [-3531.896] (-3537.304) -- 0:03:20 233500 -- (-3538.849) [-3529.123] (-3536.055) (-3533.594) * (-3535.498) (-3537.418) [-3530.330] (-3528.149) -- 0:03:20 234000 -- [-3534.022] (-3533.741) (-3537.021) (-3532.112) * (-3532.801) (-3534.521) (-3532.748) [-3530.157] -- 0:03:19 234500 -- [-3535.664] (-3533.300) (-3531.778) (-3529.867) * (-3538.872) (-3533.397) (-3527.883) [-3534.609] -- 0:03:19 235000 -- (-3532.569) (-3526.842) [-3528.702] (-3526.466) * (-3536.365) (-3530.642) (-3525.493) [-3531.165] -- 0:03:18 Average standard deviation of split frequencies: 0.000000 235500 -- [-3531.543] (-3532.760) (-3528.241) (-3527.102) * (-3535.542) (-3532.084) (-3531.776) [-3529.440] -- 0:03:18 236000 -- (-3536.485) (-3526.114) (-3528.157) [-3528.958] * [-3533.278] (-3531.050) (-3531.496) (-3535.976) -- 0:03:17 236500 -- [-3536.002] (-3532.442) (-3531.425) (-3527.040) * (-3531.477) [-3533.093] (-3530.194) (-3533.527) -- 0:03:16 237000 -- (-3538.486) (-3531.369) (-3539.659) [-3526.157] * (-3534.908) [-3529.272] (-3536.694) (-3536.962) -- 0:03:19 237500 -- [-3534.727] (-3536.687) (-3527.636) (-3532.788) * [-3528.905] (-3536.685) (-3529.881) (-3536.102) -- 0:03:19 238000 -- [-3529.991] (-3532.396) (-3533.030) (-3534.636) * (-3532.027) [-3529.453] (-3528.777) (-3527.275) -- 0:03:18 238500 -- (-3526.679) (-3536.663) (-3532.175) [-3532.028] * (-3533.794) (-3534.963) [-3529.434] (-3526.915) -- 0:03:17 239000 -- [-3536.807] (-3536.648) (-3530.645) (-3533.236) * (-3527.703) (-3534.168) (-3530.176) [-3526.328] -- 0:03:17 239500 -- (-3534.100) (-3535.176) (-3525.784) [-3529.124] * (-3530.804) (-3533.566) [-3524.631] (-3533.162) -- 0:03:16 240000 -- (-3529.577) (-3535.867) [-3530.965] (-3528.742) * (-3525.967) [-3527.143] (-3530.217) (-3532.497) -- 0:03:16 Average standard deviation of split frequencies: 0.000000 240500 -- [-3529.408] (-3537.776) (-3530.928) (-3528.144) * (-3533.997) (-3532.458) [-3527.864] (-3534.255) -- 0:03:15 241000 -- (-3528.813) (-3534.720) (-3527.738) [-3530.025] * (-3532.566) (-3533.058) (-3526.941) [-3530.713] -- 0:03:18 241500 -- [-3531.434] (-3534.359) (-3537.205) (-3528.159) * (-3525.373) (-3529.758) [-3531.607] (-3539.434) -- 0:03:17 242000 -- (-3532.430) (-3527.522) (-3527.977) [-3533.128] * (-3527.176) [-3531.945] (-3537.087) (-3537.241) -- 0:03:17 242500 -- (-3530.516) (-3534.102) [-3529.652] (-3526.534) * [-3532.167] (-3533.904) (-3532.212) (-3539.318) -- 0:03:16 243000 -- (-3527.894) [-3534.441] (-3530.785) (-3527.480) * (-3529.783) (-3530.831) (-3537.773) [-3533.154] -- 0:03:16 243500 -- (-3535.867) [-3531.478] (-3534.224) (-3531.293) * (-3529.703) [-3532.519] (-3535.528) (-3530.807) -- 0:03:15 244000 -- (-3538.088) [-3529.373] (-3532.866) (-3530.072) * [-3535.676] (-3533.499) (-3536.294) (-3533.263) -- 0:03:15 244500 -- (-3531.378) (-3529.807) (-3530.228) [-3531.565] * [-3528.987] (-3536.235) (-3532.093) (-3535.433) -- 0:03:17 245000 -- [-3530.425] (-3539.382) (-3531.865) (-3528.847) * (-3530.494) [-3534.646] (-3533.118) (-3534.982) -- 0:03:17 Average standard deviation of split frequencies: 0.000000 245500 -- (-3531.806) [-3529.517] (-3540.209) (-3528.517) * [-3529.910] (-3532.507) (-3533.068) (-3533.843) -- 0:03:16 246000 -- (-3528.979) (-3537.012) [-3535.609] (-3533.574) * (-3527.119) (-3530.097) [-3527.830] (-3532.749) -- 0:03:16 246500 -- [-3532.195] (-3534.663) (-3527.183) (-3532.527) * (-3526.814) [-3531.954] (-3529.323) (-3535.657) -- 0:03:15 247000 -- (-3531.292) (-3531.645) [-3537.168] (-3532.379) * (-3529.505) [-3529.660] (-3533.370) (-3535.622) -- 0:03:15 247500 -- (-3538.818) (-3538.354) (-3527.454) [-3536.851] * [-3528.624] (-3534.105) (-3536.395) (-3532.373) -- 0:03:14 248000 -- (-3533.450) (-3527.814) (-3529.150) [-3531.879] * (-3533.446) (-3540.512) (-3540.859) [-3527.642] -- 0:03:14 248500 -- (-3536.781) (-3529.081) [-3525.736] (-3527.563) * [-3531.838] (-3535.813) (-3534.108) (-3536.444) -- 0:03:16 249000 -- (-3538.833) [-3525.208] (-3529.398) (-3531.502) * (-3533.239) (-3530.168) (-3530.858) [-3532.724] -- 0:03:16 249500 -- [-3530.517] (-3532.862) (-3526.887) (-3533.166) * (-3534.163) (-3534.337) (-3528.744) [-3534.145] -- 0:03:15 250000 -- (-3537.696) [-3530.495] (-3531.246) (-3532.915) * (-3531.836) (-3539.251) (-3529.416) [-3531.725] -- 0:03:14 Average standard deviation of split frequencies: 0.000000 250500 -- (-3533.460) (-3529.406) [-3529.625] (-3533.096) * (-3537.813) (-3530.348) [-3526.912] (-3532.433) -- 0:03:14 251000 -- [-3529.875] (-3530.868) (-3533.514) (-3529.288) * [-3531.926] (-3534.280) (-3524.842) (-3534.608) -- 0:03:13 251500 -- (-3532.669) [-3531.293] (-3527.825) (-3532.350) * (-3537.180) (-3536.227) (-3530.153) [-3525.936] -- 0:03:13 252000 -- [-3527.762] (-3530.190) (-3529.785) (-3533.794) * (-3533.212) (-3532.816) (-3534.045) [-3530.050] -- 0:03:12 252500 -- (-3530.147) (-3529.772) [-3529.955] (-3532.143) * (-3535.970) [-3532.859] (-3534.077) (-3527.076) -- 0:03:15 253000 -- [-3528.708] (-3528.477) (-3528.369) (-3529.635) * (-3536.136) (-3536.050) [-3527.198] (-3529.659) -- 0:03:14 253500 -- [-3529.388] (-3526.987) (-3529.781) (-3536.376) * (-3535.737) [-3533.639] (-3530.641) (-3535.820) -- 0:03:14 254000 -- [-3528.150] (-3532.632) (-3529.078) (-3537.862) * (-3530.516) (-3530.863) [-3529.336] (-3533.849) -- 0:03:13 254500 -- [-3534.368] (-3531.488) (-3533.836) (-3534.932) * [-3534.832] (-3527.747) (-3530.115) (-3534.981) -- 0:03:13 255000 -- (-3535.174) (-3529.838) [-3531.379] (-3530.219) * (-3529.271) [-3531.508] (-3539.458) (-3529.102) -- 0:03:12 Average standard deviation of split frequencies: 0.000000 255500 -- (-3536.692) [-3529.699] (-3529.975) (-3531.568) * (-3533.108) [-3528.555] (-3531.915) (-3527.065) -- 0:03:12 256000 -- (-3534.447) (-3531.312) [-3526.693] (-3532.584) * (-3530.308) [-3531.433] (-3528.295) (-3530.223) -- 0:03:14 256500 -- (-3541.341) (-3528.561) [-3535.370] (-3537.027) * (-3529.907) (-3531.848) [-3535.220] (-3533.577) -- 0:03:14 257000 -- (-3532.438) (-3533.935) [-3528.556] (-3534.371) * (-3526.328) (-3547.684) [-3531.082] (-3534.582) -- 0:03:13 257500 -- (-3534.334) [-3530.426] (-3527.644) (-3540.956) * (-3535.620) (-3534.413) (-3528.121) [-3534.783] -- 0:03:13 258000 -- [-3534.639] (-3541.451) (-3538.690) (-3532.604) * [-3535.474] (-3527.513) (-3525.871) (-3534.254) -- 0:03:12 258500 -- (-3530.216) [-3535.004] (-3533.944) (-3531.626) * (-3529.594) (-3539.098) (-3533.774) [-3531.400] -- 0:03:12 259000 -- (-3528.798) (-3528.086) (-3533.467) [-3529.721] * (-3528.463) (-3538.355) (-3535.572) [-3535.764] -- 0:03:11 259500 -- (-3541.143) (-3531.577) [-3534.145] (-3530.484) * (-3531.074) (-3529.631) (-3538.025) [-3531.582] -- 0:03:11 260000 -- (-3532.320) (-3529.101) [-3530.909] (-3530.150) * (-3530.536) (-3534.874) (-3538.346) [-3530.438] -- 0:03:13 Average standard deviation of split frequencies: 0.000000 260500 -- [-3531.536] (-3532.114) (-3528.161) (-3533.445) * (-3524.482) (-3535.192) (-3533.765) [-3537.522] -- 0:03:13 261000 -- (-3531.936) (-3533.885) [-3524.912] (-3534.089) * (-3527.717) [-3532.682] (-3536.480) (-3528.777) -- 0:03:12 261500 -- [-3527.455] (-3533.372) (-3528.656) (-3533.471) * (-3530.453) (-3531.140) [-3532.318] (-3532.717) -- 0:03:12 262000 -- [-3536.540] (-3533.599) (-3530.562) (-3537.173) * [-3530.624] (-3533.976) (-3529.789) (-3532.358) -- 0:03:11 262500 -- (-3536.744) (-3535.945) (-3530.349) [-3531.941] * (-3531.734) (-3527.858) (-3534.759) [-3535.357] -- 0:03:11 263000 -- (-3530.848) (-3535.595) (-3532.760) [-3535.706] * (-3530.725) (-3527.652) [-3533.135] (-3535.120) -- 0:03:10 263500 -- (-3528.964) (-3538.452) (-3531.932) [-3528.796] * (-3537.947) (-3531.624) (-3534.470) [-3529.601] -- 0:03:10 264000 -- (-3531.099) (-3530.214) (-3532.175) [-3532.000] * (-3536.980) [-3532.805] (-3539.777) (-3533.977) -- 0:03:12 264500 -- (-3534.288) [-3534.139] (-3532.390) (-3533.916) * [-3531.111] (-3543.084) (-3530.103) (-3536.956) -- 0:03:11 265000 -- [-3527.898] (-3532.399) (-3528.800) (-3533.802) * [-3534.754] (-3529.779) (-3533.162) (-3533.636) -- 0:03:11 Average standard deviation of split frequencies: 0.000000 265500 -- [-3526.023] (-3531.284) (-3530.577) (-3534.415) * (-3537.880) [-3526.624] (-3533.698) (-3529.809) -- 0:03:10 266000 -- (-3529.459) [-3526.538] (-3530.955) (-3536.048) * (-3533.234) (-3533.253) [-3530.571] (-3532.904) -- 0:03:10 266500 -- (-3530.548) (-3528.176) [-3533.055] (-3529.488) * (-3527.845) [-3527.461] (-3536.485) (-3532.454) -- 0:03:09 267000 -- [-3528.040] (-3531.238) (-3534.412) (-3527.924) * (-3528.398) [-3529.193] (-3534.415) (-3529.958) -- 0:03:09 267500 -- [-3528.415] (-3532.399) (-3526.534) (-3530.081) * (-3532.784) (-3530.048) (-3531.869) [-3528.858] -- 0:03:08 268000 -- [-3530.939] (-3534.416) (-3531.963) (-3531.043) * (-3528.135) (-3527.327) (-3531.920) [-3532.411] -- 0:03:11 268500 -- [-3532.683] (-3530.447) (-3531.384) (-3529.937) * (-3530.688) (-3538.908) (-3533.873) [-3528.318] -- 0:03:10 269000 -- (-3534.889) (-3530.823) (-3541.360) [-3539.053] * (-3524.421) (-3536.000) [-3526.557] (-3535.534) -- 0:03:10 269500 -- [-3531.876] (-3534.816) (-3532.763) (-3527.805) * (-3526.382) (-3542.806) (-3530.973) [-3529.007] -- 0:03:09 270000 -- (-3536.950) [-3529.890] (-3530.677) (-3533.594) * (-3526.843) (-3534.695) [-3529.423] (-3532.251) -- 0:03:09 Average standard deviation of split frequencies: 0.000000 270500 -- (-3536.089) [-3527.720] (-3541.080) (-3527.988) * (-3529.384) (-3531.970) (-3530.565) [-3528.836] -- 0:03:08 271000 -- [-3530.071] (-3528.439) (-3535.377) (-3531.092) * [-3532.476] (-3531.322) (-3534.342) (-3528.653) -- 0:03:08 271500 -- (-3533.006) (-3531.839) [-3531.812] (-3530.860) * (-3532.077) [-3526.789] (-3533.728) (-3527.126) -- 0:03:10 272000 -- (-3535.359) [-3530.696] (-3536.963) (-3533.583) * (-3525.565) [-3534.321] (-3533.507) (-3529.985) -- 0:03:10 272500 -- (-3528.104) (-3533.872) (-3533.007) [-3533.641] * (-3525.933) (-3535.849) [-3540.048] (-3534.562) -- 0:03:09 273000 -- [-3532.608] (-3530.384) (-3532.011) (-3535.790) * (-3531.159) (-3532.317) [-3528.561] (-3535.783) -- 0:03:09 273500 -- (-3528.603) (-3534.096) (-3532.034) [-3534.247] * [-3528.774] (-3533.239) (-3528.237) (-3536.904) -- 0:03:08 274000 -- (-3531.048) (-3530.602) [-3532.516] (-3532.103) * [-3529.589] (-3527.145) (-3537.683) (-3533.232) -- 0:03:08 274500 -- (-3530.994) (-3529.816) (-3530.362) [-3526.526] * (-3528.921) (-3530.316) (-3544.293) [-3532.293] -- 0:03:07 275000 -- (-3533.978) [-3531.183] (-3539.486) (-3528.157) * (-3528.767) (-3530.178) (-3529.822) [-3529.929] -- 0:03:07 Average standard deviation of split frequencies: 0.000000 275500 -- (-3533.164) (-3531.815) [-3535.415] (-3536.678) * [-3531.161] (-3531.106) (-3533.023) (-3532.599) -- 0:03:09 276000 -- (-3531.439) (-3527.473) [-3529.522] (-3535.417) * (-3526.795) [-3529.355] (-3529.477) (-3531.416) -- 0:03:08 276500 -- [-3533.101] (-3531.329) (-3527.985) (-3534.808) * [-3531.135] (-3529.414) (-3531.594) (-3527.521) -- 0:03:08 277000 -- (-3528.679) (-3531.395) (-3535.029) [-3533.948] * (-3529.144) (-3530.083) (-3528.816) [-3528.430] -- 0:03:07 277500 -- [-3526.138] (-3539.180) (-3541.641) (-3534.117) * [-3529.927] (-3528.516) (-3539.082) (-3530.874) -- 0:03:07 278000 -- [-3526.754] (-3533.267) (-3533.615) (-3534.911) * (-3528.698) (-3529.887) [-3527.387] (-3535.904) -- 0:03:06 278500 -- (-3525.373) [-3530.021] (-3528.920) (-3530.474) * (-3527.755) [-3533.400] (-3529.591) (-3532.711) -- 0:03:06 279000 -- [-3528.791] (-3529.334) (-3531.245) (-3533.246) * (-3526.818) (-3532.350) [-3526.788] (-3530.356) -- 0:03:06 279500 -- [-3529.828] (-3532.547) (-3530.717) (-3529.576) * (-3530.780) (-3533.240) [-3526.707] (-3533.823) -- 0:03:08 280000 -- (-3537.398) (-3531.569) (-3531.093) [-3533.248] * (-3540.440) (-3543.339) [-3528.768] (-3531.121) -- 0:03:07 Average standard deviation of split frequencies: 0.000000 280500 -- (-3540.663) [-3529.253] (-3528.531) (-3535.793) * [-3529.740] (-3543.015) (-3530.673) (-3529.924) -- 0:03:07 281000 -- (-3532.298) (-3531.388) [-3539.761] (-3541.791) * [-3529.999] (-3530.942) (-3531.688) (-3531.447) -- 0:03:06 281500 -- [-3538.506] (-3530.334) (-3536.001) (-3534.134) * (-3529.460) (-3528.657) [-3529.102] (-3533.382) -- 0:03:06 282000 -- [-3525.806] (-3533.016) (-3529.581) (-3531.713) * (-3537.543) [-3532.850] (-3529.563) (-3528.899) -- 0:03:05 282500 -- (-3538.057) (-3530.507) (-3532.506) [-3528.865] * (-3527.420) [-3536.786] (-3529.614) (-3537.528) -- 0:03:05 283000 -- (-3530.527) (-3531.793) [-3535.591] (-3531.927) * (-3528.101) [-3545.246] (-3529.972) (-3529.888) -- 0:03:04 283500 -- (-3531.035) (-3528.953) (-3534.418) [-3537.052] * (-3528.189) (-3537.123) [-3530.890] (-3532.885) -- 0:03:07 284000 -- [-3531.171] (-3531.482) (-3533.580) (-3533.726) * (-3526.079) (-3544.413) (-3527.466) [-3533.923] -- 0:03:06 284500 -- (-3529.702) [-3528.783] (-3528.716) (-3534.614) * (-3526.970) [-3534.095] (-3527.542) (-3536.459) -- 0:03:06 285000 -- [-3530.453] (-3532.812) (-3532.478) (-3529.569) * [-3533.132] (-3544.308) (-3538.861) (-3537.096) -- 0:03:05 Average standard deviation of split frequencies: 0.000000 285500 -- [-3536.884] (-3542.700) (-3529.226) (-3530.333) * [-3533.671] (-3531.994) (-3533.411) (-3532.434) -- 0:03:05 286000 -- (-3530.342) [-3537.759] (-3539.286) (-3533.896) * [-3531.910] (-3529.678) (-3530.804) (-3532.608) -- 0:03:04 286500 -- (-3535.375) (-3534.086) [-3530.768] (-3534.903) * (-3530.672) [-3533.578] (-3532.890) (-3532.743) -- 0:03:04 287000 -- (-3537.006) [-3530.622] (-3538.070) (-3529.942) * [-3531.483] (-3534.881) (-3527.731) (-3533.934) -- 0:03:06 287500 -- (-3533.874) (-3531.136) [-3533.054] (-3528.477) * [-3529.217] (-3534.723) (-3532.117) (-3533.910) -- 0:03:05 288000 -- (-3531.388) (-3530.749) [-3531.852] (-3528.851) * (-3527.622) (-3538.344) (-3529.467) [-3530.701] -- 0:03:05 288500 -- [-3527.475] (-3532.334) (-3528.389) (-3535.198) * [-3530.521] (-3529.935) (-3533.023) (-3527.330) -- 0:03:04 289000 -- (-3531.479) (-3531.399) [-3530.165] (-3534.679) * (-3535.155) [-3529.244] (-3534.015) (-3532.546) -- 0:03:04 289500 -- (-3534.586) (-3533.940) (-3537.435) [-3528.348] * (-3529.412) (-3533.306) [-3528.010] (-3535.205) -- 0:03:04 290000 -- (-3530.418) [-3531.338] (-3532.046) (-3524.556) * (-3533.865) (-3532.058) [-3528.743] (-3531.330) -- 0:03:03 Average standard deviation of split frequencies: 0.000000 290500 -- [-3533.585] (-3535.514) (-3537.811) (-3530.739) * (-3529.764) (-3528.444) (-3530.651) [-3526.961] -- 0:03:03 291000 -- [-3530.436] (-3534.080) (-3535.064) (-3537.994) * (-3534.170) (-3529.954) (-3526.797) [-3532.748] -- 0:03:05 291500 -- (-3529.044) (-3528.861) (-3537.960) [-3540.433] * (-3537.353) (-3533.987) (-3530.634) [-3539.967] -- 0:03:04 292000 -- [-3535.004] (-3535.918) (-3540.295) (-3537.109) * (-3533.058) (-3528.573) [-3529.605] (-3534.243) -- 0:03:04 292500 -- (-3540.031) [-3539.702] (-3529.785) (-3531.930) * (-3534.071) (-3525.228) (-3535.003) [-3533.933] -- 0:03:03 293000 -- (-3531.815) (-3535.879) (-3534.577) [-3527.706] * (-3527.593) (-3532.825) (-3529.056) [-3528.334] -- 0:03:03 293500 -- (-3530.422) (-3540.216) (-3526.761) [-3533.590] * (-3533.928) (-3530.069) (-3533.085) [-3527.588] -- 0:03:02 294000 -- (-3525.486) [-3533.961] (-3532.444) (-3533.522) * [-3532.160] (-3530.628) (-3529.801) (-3531.701) -- 0:03:02 294500 -- [-3527.053] (-3527.104) (-3538.262) (-3536.337) * [-3531.253] (-3532.695) (-3537.263) (-3533.974) -- 0:03:02 295000 -- (-3529.913) (-3531.532) [-3534.086] (-3533.057) * (-3539.282) (-3539.065) [-3529.749] (-3531.013) -- 0:03:04 Average standard deviation of split frequencies: 0.000000 295500 -- [-3527.470] (-3528.278) (-3534.860) (-3527.937) * (-3539.072) (-3532.871) (-3538.237) [-3537.956] -- 0:03:03 296000 -- (-3534.344) (-3538.323) [-3537.916] (-3531.681) * (-3533.902) (-3530.948) (-3528.538) [-3529.478] -- 0:03:03 296500 -- (-3530.220) [-3535.384] (-3538.046) (-3531.958) * (-3541.477) [-3534.510] (-3531.769) (-3531.516) -- 0:03:02 297000 -- (-3530.276) (-3534.142) (-3534.550) [-3536.464] * (-3528.153) (-3541.998) [-3534.213] (-3530.309) -- 0:03:02 297500 -- (-3531.901) [-3530.454] (-3533.168) (-3532.270) * (-3531.481) (-3537.372) (-3531.551) [-3532.529] -- 0:03:01 298000 -- (-3537.592) (-3534.014) [-3532.162] (-3531.358) * (-3529.920) (-3533.653) (-3534.550) [-3535.251] -- 0:03:01 298500 -- (-3532.200) [-3531.731] (-3532.712) (-3528.956) * (-3531.451) (-3531.708) [-3536.679] (-3544.987) -- 0:03:03 299000 -- (-3528.354) (-3530.817) (-3532.986) [-3535.101] * (-3529.333) (-3530.548) [-3532.882] (-3538.714) -- 0:03:02 299500 -- [-3527.475] (-3531.135) (-3545.332) (-3532.244) * (-3531.061) (-3529.149) [-3532.831] (-3530.980) -- 0:03:02 300000 -- (-3534.767) (-3527.724) (-3531.830) [-3529.231] * (-3531.214) (-3527.539) [-3534.496] (-3531.661) -- 0:03:01 Average standard deviation of split frequencies: 0.000000 300500 -- (-3527.993) (-3529.039) [-3533.223] (-3529.241) * (-3529.672) (-3533.095) [-3531.603] (-3534.274) -- 0:03:01 301000 -- (-3533.643) [-3530.540] (-3528.586) (-3532.059) * (-3535.423) [-3529.060] (-3530.823) (-3532.819) -- 0:03:01 301500 -- (-3532.621) (-3533.353) [-3529.374] (-3530.370) * [-3530.849] (-3531.567) (-3535.694) (-3531.027) -- 0:03:00 302000 -- (-3532.987) (-3534.025) (-3537.173) [-3536.046] * (-3530.813) [-3526.071] (-3531.848) (-3536.455) -- 0:03:00 302500 -- [-3528.648] (-3538.090) (-3530.715) (-3530.715) * (-3532.602) [-3527.251] (-3534.038) (-3533.113) -- 0:03:02 303000 -- (-3536.369) (-3541.494) (-3530.693) [-3529.183] * [-3526.925] (-3534.345) (-3527.987) (-3530.470) -- 0:03:01 303500 -- (-3538.790) (-3530.854) (-3530.882) [-3525.258] * [-3539.434] (-3532.614) (-3531.025) (-3529.186) -- 0:03:01 304000 -- (-3531.400) [-3534.575] (-3528.380) (-3529.950) * (-3526.576) (-3536.118) [-3529.013] (-3528.061) -- 0:03:00 304500 -- (-3530.264) [-3536.258] (-3534.520) (-3535.360) * (-3530.876) [-3526.510] (-3531.147) (-3541.209) -- 0:03:00 305000 -- [-3529.414] (-3527.711) (-3536.566) (-3531.405) * (-3529.536) [-3530.427] (-3534.196) (-3529.988) -- 0:03:00 Average standard deviation of split frequencies: 0.000000 305500 -- (-3532.215) (-3527.239) (-3536.797) [-3532.534] * (-3536.037) [-3530.023] (-3533.406) (-3536.349) -- 0:02:59 306000 -- (-3530.440) [-3534.086] (-3535.105) (-3527.267) * (-3532.029) [-3527.218] (-3542.708) (-3536.445) -- 0:02:59 306500 -- (-3531.793) [-3532.940] (-3530.467) (-3527.745) * (-3535.308) [-3527.793] (-3536.808) (-3534.599) -- 0:03:01 307000 -- (-3531.769) (-3535.155) [-3528.649] (-3535.734) * (-3533.110) (-3529.650) [-3534.012] (-3528.755) -- 0:03:00 307500 -- (-3532.101) (-3540.462) [-3533.054] (-3543.035) * (-3536.160) (-3533.906) (-3531.790) [-3527.880] -- 0:03:00 308000 -- (-3529.591) [-3537.589] (-3534.936) (-3536.517) * (-3538.651) [-3535.594] (-3532.805) (-3527.651) -- 0:02:59 308500 -- (-3531.757) (-3530.849) [-3530.158] (-3536.653) * [-3534.178] (-3531.846) (-3545.631) (-3533.524) -- 0:02:59 309000 -- (-3529.927) (-3537.362) [-3532.735] (-3533.481) * [-3535.169] (-3534.229) (-3532.644) (-3532.842) -- 0:02:58 309500 -- [-3525.202] (-3533.005) (-3532.527) (-3536.605) * (-3536.812) [-3526.809] (-3530.306) (-3529.450) -- 0:02:58 310000 -- [-3532.319] (-3531.759) (-3529.189) (-3530.177) * (-3545.641) [-3526.423] (-3533.502) (-3536.014) -- 0:03:00 Average standard deviation of split frequencies: 0.000000 310500 -- [-3532.436] (-3530.450) (-3531.627) (-3529.912) * (-3532.921) [-3537.673] (-3533.002) (-3529.483) -- 0:02:59 311000 -- (-3533.639) (-3537.922) (-3528.258) [-3536.147] * (-3534.685) (-3532.718) (-3536.976) [-3533.144] -- 0:02:59 311500 -- (-3527.297) (-3531.880) [-3527.306] (-3529.825) * (-3533.386) (-3530.972) [-3530.954] (-3533.902) -- 0:02:59 312000 -- (-3533.451) (-3529.619) (-3528.718) [-3528.510] * (-3527.426) [-3530.003] (-3532.874) (-3532.477) -- 0:02:58 312500 -- [-3525.686] (-3535.252) (-3532.859) (-3530.834) * [-3529.192] (-3537.676) (-3534.246) (-3530.837) -- 0:02:58 313000 -- [-3525.996] (-3532.093) (-3528.922) (-3529.068) * (-3538.172) (-3535.103) [-3529.980] (-3530.534) -- 0:02:57 313500 -- (-3530.955) (-3535.599) [-3535.877] (-3534.761) * (-3530.740) (-3532.161) [-3532.112] (-3526.110) -- 0:02:57 314000 -- (-3533.865) [-3537.504] (-3536.815) (-3529.901) * [-3530.237] (-3535.235) (-3533.705) (-3527.613) -- 0:02:59 314500 -- (-3533.883) [-3529.480] (-3535.048) (-3536.110) * (-3535.166) (-3526.439) (-3531.212) [-3525.340] -- 0:02:58 315000 -- [-3527.648] (-3536.556) (-3532.983) (-3539.461) * (-3537.935) (-3534.325) [-3527.676] (-3531.844) -- 0:02:58 Average standard deviation of split frequencies: 0.000000 315500 -- [-3523.561] (-3540.158) (-3531.074) (-3530.494) * (-3534.367) [-3529.608] (-3527.888) (-3532.500) -- 0:02:57 316000 -- [-3527.505] (-3538.524) (-3531.017) (-3531.568) * (-3533.911) (-3535.044) [-3530.806] (-3533.991) -- 0:02:57 316500 -- (-3527.248) [-3526.603] (-3533.216) (-3527.670) * [-3532.233] (-3541.179) (-3526.506) (-3528.803) -- 0:02:57 317000 -- (-3535.522) [-3529.371] (-3536.600) (-3528.986) * (-3527.107) (-3531.734) [-3529.186] (-3526.731) -- 0:02:56 317500 -- (-3531.284) [-3528.109] (-3534.101) (-3535.489) * [-3527.183] (-3530.211) (-3530.141) (-3542.560) -- 0:02:56 318000 -- [-3533.810] (-3542.314) (-3533.313) (-3534.146) * (-3528.100) [-3532.622] (-3533.775) (-3533.242) -- 0:02:58 318500 -- (-3527.584) (-3531.610) (-3533.261) [-3526.387] * [-3529.514] (-3530.717) (-3530.189) (-3533.560) -- 0:02:57 319000 -- [-3532.266] (-3529.250) (-3532.662) (-3534.336) * [-3532.448] (-3525.221) (-3529.604) (-3528.692) -- 0:02:57 319500 -- (-3528.235) (-3532.884) (-3536.593) [-3536.866] * (-3528.471) (-3534.541) [-3531.475] (-3527.305) -- 0:02:56 320000 -- (-3534.619) [-3528.130] (-3527.628) (-3528.560) * [-3530.847] (-3530.250) (-3528.401) (-3530.055) -- 0:02:56 Average standard deviation of split frequencies: 0.000000 320500 -- (-3532.309) [-3530.275] (-3533.595) (-3537.040) * (-3533.206) [-3527.429] (-3528.101) (-3531.653) -- 0:02:55 321000 -- (-3533.981) (-3532.436) [-3531.612] (-3531.868) * (-3533.839) (-3536.653) [-3529.719] (-3535.190) -- 0:02:55 321500 -- (-3532.813) (-3532.352) [-3531.370] (-3530.865) * [-3532.023] (-3532.221) (-3539.995) (-3527.965) -- 0:02:57 322000 -- [-3530.137] (-3534.809) (-3539.902) (-3533.037) * (-3535.625) (-3531.614) [-3530.715] (-3532.825) -- 0:02:56 322500 -- [-3531.956] (-3529.880) (-3531.631) (-3530.793) * (-3539.854) (-3538.183) [-3529.718] (-3535.449) -- 0:02:56 323000 -- (-3525.919) [-3526.860] (-3529.612) (-3531.636) * (-3530.755) (-3542.214) (-3528.700) [-3530.985] -- 0:02:56 323500 -- [-3529.893] (-3526.543) (-3528.987) (-3536.076) * (-3533.796) (-3536.103) (-3536.467) [-3534.257] -- 0:02:55 324000 -- (-3535.703) (-3537.601) [-3527.476] (-3531.590) * (-3529.873) [-3532.307] (-3529.987) (-3535.416) -- 0:02:55 324500 -- (-3535.812) (-3532.647) [-3531.891] (-3531.669) * (-3530.876) (-3531.118) [-3527.080] (-3532.340) -- 0:02:54 325000 -- [-3526.048] (-3534.810) (-3526.913) (-3532.322) * (-3537.420) [-3527.953] (-3533.042) (-3533.966) -- 0:02:54 Average standard deviation of split frequencies: 0.000000 325500 -- (-3529.776) [-3530.385] (-3530.667) (-3528.969) * (-3537.453) (-3542.316) (-3531.749) [-3525.684] -- 0:02:56 326000 -- (-3530.299) [-3533.758] (-3528.329) (-3532.035) * (-3534.353) [-3529.536] (-3540.550) (-3530.815) -- 0:02:55 326500 -- (-3528.955) (-3533.549) (-3529.966) [-3528.058] * [-3532.089] (-3531.151) (-3536.433) (-3531.080) -- 0:02:55 327000 -- (-3531.374) (-3530.458) [-3527.954] (-3534.326) * (-3526.555) [-3530.757] (-3540.254) (-3527.898) -- 0:02:54 327500 -- (-3531.516) (-3530.486) [-3527.823] (-3533.759) * (-3529.690) (-3528.571) [-3538.447] (-3529.189) -- 0:02:54 328000 -- (-3525.130) [-3539.194] (-3530.212) (-3531.061) * (-3528.801) [-3528.534] (-3530.994) (-3539.186) -- 0:02:54 328500 -- [-3525.679] (-3530.944) (-3534.163) (-3527.844) * (-3527.035) (-3529.057) [-3528.648] (-3532.746) -- 0:02:53 329000 -- (-3532.276) (-3531.804) [-3533.969] (-3534.613) * (-3530.951) (-3530.454) (-3531.219) [-3531.589] -- 0:02:55 329500 -- [-3530.038] (-3533.642) (-3532.315) (-3533.359) * (-3530.868) [-3529.975] (-3535.151) (-3537.882) -- 0:02:55 330000 -- (-3531.651) (-3532.925) (-3526.174) [-3535.138] * (-3534.693) (-3534.624) [-3532.063] (-3533.709) -- 0:02:54 Average standard deviation of split frequencies: 0.000000 330500 -- (-3529.359) [-3530.659] (-3528.612) (-3532.865) * (-3531.093) (-3540.959) [-3531.688] (-3534.237) -- 0:02:54 331000 -- (-3534.545) (-3528.309) [-3524.588] (-3531.843) * (-3534.175) (-3534.025) (-3537.731) [-3534.065] -- 0:02:53 331500 -- (-3542.112) (-3526.581) (-3527.750) [-3528.891] * (-3529.773) (-3534.146) [-3535.173] (-3534.172) -- 0:02:53 332000 -- (-3533.963) (-3537.157) (-3526.455) [-3532.987] * (-3535.078) (-3534.591) (-3529.102) [-3534.364] -- 0:02:53 332500 -- (-3532.080) [-3530.409] (-3532.665) (-3531.357) * (-3528.843) (-3530.318) [-3529.108] (-3528.239) -- 0:02:52 333000 -- [-3530.870] (-3530.460) (-3525.413) (-3528.907) * (-3534.380) [-3531.856] (-3530.518) (-3542.334) -- 0:02:54 333500 -- (-3525.830) [-3535.506] (-3537.996) (-3534.331) * (-3530.476) [-3526.782] (-3536.899) (-3532.643) -- 0:02:53 334000 -- (-3535.419) (-3530.739) [-3532.265] (-3533.520) * (-3538.185) (-3528.684) (-3533.428) [-3534.562] -- 0:02:53 334500 -- (-3531.571) (-3530.993) [-3528.262] (-3533.339) * [-3533.595] (-3534.859) (-3531.354) (-3533.231) -- 0:02:53 335000 -- (-3529.678) (-3533.338) [-3531.573] (-3536.994) * [-3529.569] (-3531.624) (-3530.568) (-3543.119) -- 0:02:52 Average standard deviation of split frequencies: 0.000000 335500 -- (-3529.461) (-3529.351) (-3528.869) [-3530.775] * (-3531.013) (-3528.738) [-3529.692] (-3539.690) -- 0:02:52 336000 -- (-3531.660) (-3530.360) [-3534.037] (-3534.296) * (-3535.839) [-3530.922] (-3535.852) (-3533.901) -- 0:02:51 336500 -- [-3534.376] (-3530.836) (-3532.066) (-3530.401) * (-3539.567) (-3529.144) (-3536.245) [-3529.707] -- 0:02:53 337000 -- (-3528.186) (-3529.897) [-3529.677] (-3527.901) * (-3529.797) [-3531.915] (-3531.151) (-3531.298) -- 0:02:53 337500 -- [-3529.713] (-3530.333) (-3529.897) (-3535.180) * [-3527.801] (-3537.189) (-3530.126) (-3527.342) -- 0:02:52 338000 -- [-3534.947] (-3531.360) (-3532.944) (-3524.516) * (-3528.369) (-3532.768) (-3537.167) [-3529.041] -- 0:02:52 338500 -- [-3531.093] (-3529.943) (-3530.395) (-3532.364) * [-3528.452] (-3527.986) (-3537.171) (-3533.644) -- 0:02:51 339000 -- (-3528.472) (-3529.969) (-3528.889) [-3529.485] * (-3529.659) (-3529.880) [-3531.865] (-3530.467) -- 0:02:51 339500 -- [-3528.655] (-3526.729) (-3534.351) (-3526.767) * (-3534.787) [-3529.609] (-3530.788) (-3533.183) -- 0:02:51 340000 -- [-3539.180] (-3537.555) (-3530.864) (-3525.097) * [-3532.499] (-3538.030) (-3535.421) (-3526.225) -- 0:02:50 Average standard deviation of split frequencies: 0.000000 340500 -- (-3529.688) (-3531.082) (-3529.182) [-3532.390] * (-3526.176) [-3534.884] (-3529.196) (-3531.076) -- 0:02:52 341000 -- [-3533.400] (-3534.378) (-3533.208) (-3530.639) * [-3531.168] (-3535.179) (-3532.735) (-3531.460) -- 0:02:51 341500 -- [-3529.741] (-3540.123) (-3531.012) (-3533.453) * (-3529.419) (-3537.718) (-3537.432) [-3526.863] -- 0:02:51 342000 -- (-3529.805) (-3545.278) [-3533.275] (-3531.175) * (-3530.327) (-3533.247) [-3535.440] (-3531.653) -- 0:02:51 342500 -- [-3530.568] (-3540.713) (-3532.683) (-3535.792) * (-3547.812) (-3534.368) (-3544.163) [-3530.529] -- 0:02:50 343000 -- [-3528.478] (-3533.614) (-3530.092) (-3529.116) * [-3532.283] (-3530.287) (-3534.828) (-3529.959) -- 0:02:50 343500 -- (-3530.632) (-3532.560) (-3532.350) [-3527.900] * (-3534.073) [-3528.023] (-3538.645) (-3534.054) -- 0:02:50 344000 -- (-3529.055) [-3529.724] (-3532.534) (-3532.178) * (-3531.599) (-3532.079) [-3536.268] (-3530.175) -- 0:02:49 344500 -- [-3529.390] (-3532.495) (-3528.925) (-3526.673) * [-3534.181] (-3527.511) (-3527.321) (-3537.701) -- 0:02:51 345000 -- (-3531.369) (-3530.086) [-3529.627] (-3533.385) * (-3529.175) (-3528.430) [-3533.817] (-3531.336) -- 0:02:50 Average standard deviation of split frequencies: 0.000000 345500 -- [-3530.721] (-3531.457) (-3534.661) (-3534.207) * (-3528.537) (-3531.950) [-3526.786] (-3527.355) -- 0:02:50 346000 -- (-3535.355) (-3530.537) (-3531.933) [-3532.204] * (-3534.881) (-3528.749) (-3527.829) [-3525.929] -- 0:02:50 346500 -- (-3530.374) [-3532.748] (-3537.724) (-3535.388) * (-3530.810) [-3529.451] (-3529.602) (-3529.312) -- 0:02:49 347000 -- (-3531.776) (-3534.574) (-3525.903) [-3529.864] * (-3532.105) (-3531.214) [-3528.109] (-3531.998) -- 0:02:49 347500 -- (-3529.813) (-3533.178) [-3527.529] (-3535.966) * (-3526.969) (-3529.181) (-3531.220) [-3528.287] -- 0:02:48 348000 -- (-3535.952) (-3529.665) (-3532.006) [-3533.260] * (-3525.060) (-3530.477) [-3532.743] (-3534.059) -- 0:02:50 348500 -- [-3530.654] (-3538.227) (-3531.208) (-3530.939) * (-3532.005) (-3535.349) (-3531.231) [-3529.061] -- 0:02:50 349000 -- [-3529.767] (-3532.726) (-3526.106) (-3527.582) * (-3532.561) (-3533.456) (-3528.755) [-3530.737] -- 0:02:49 349500 -- [-3533.907] (-3539.760) (-3530.396) (-3532.648) * (-3529.425) (-3531.236) [-3529.824] (-3533.541) -- 0:02:49 350000 -- [-3530.326] (-3534.718) (-3526.935) (-3527.654) * (-3528.584) (-3539.922) (-3529.035) [-3532.055] -- 0:02:48 Average standard deviation of split frequencies: 0.000000 350500 -- (-3528.643) (-3534.855) [-3529.195] (-3529.749) * [-3529.069] (-3540.327) (-3534.370) (-3531.063) -- 0:02:48 351000 -- (-3528.688) (-3533.500) (-3532.585) [-3528.094] * (-3529.746) [-3535.908] (-3532.899) (-3534.578) -- 0:02:48 351500 -- (-3528.906) (-3531.769) (-3533.317) [-3536.474] * (-3532.181) (-3532.441) [-3530.909] (-3527.107) -- 0:02:47 352000 -- (-3531.894) (-3537.512) (-3529.838) [-3537.584] * (-3527.731) (-3538.630) [-3531.504] (-3531.222) -- 0:02:49 352500 -- (-3532.702) (-3537.714) [-3534.472] (-3532.583) * [-3531.035] (-3530.979) (-3531.539) (-3529.261) -- 0:02:48 353000 -- (-3534.588) [-3533.927] (-3531.350) (-3530.892) * (-3532.595) [-3528.822] (-3531.072) (-3528.217) -- 0:02:48 353500 -- (-3530.736) (-3526.933) (-3528.750) [-3530.380] * (-3534.651) [-3530.861] (-3533.339) (-3533.033) -- 0:02:48 354000 -- (-3539.624) (-3525.862) [-3531.182] (-3534.063) * (-3532.286) (-3531.688) (-3540.495) [-3526.786] -- 0:02:47 354500 -- [-3531.540] (-3532.469) (-3539.810) (-3528.579) * [-3531.132] (-3534.762) (-3535.183) (-3530.955) -- 0:02:47 355000 -- (-3532.892) (-3531.435) [-3530.076] (-3539.069) * [-3530.283] (-3530.500) (-3532.887) (-3529.673) -- 0:02:47 Average standard deviation of split frequencies: 0.000000 355500 -- (-3536.868) (-3532.729) [-3532.868] (-3530.688) * (-3532.234) (-3532.784) (-3528.986) [-3528.335] -- 0:02:46 356000 -- (-3538.007) [-3526.836] (-3531.811) (-3537.158) * (-3531.897) [-3530.172] (-3528.872) (-3533.757) -- 0:02:48 356500 -- (-3530.574) [-3528.301] (-3535.748) (-3534.309) * (-3531.122) (-3527.014) [-3524.792] (-3531.824) -- 0:02:47 357000 -- (-3527.166) (-3532.337) (-3533.415) [-3530.366] * (-3534.263) [-3530.459] (-3531.164) (-3528.425) -- 0:02:47 357500 -- (-3532.253) (-3528.876) (-3534.604) [-3528.420] * (-3529.318) [-3528.413] (-3540.007) (-3528.677) -- 0:02:47 358000 -- (-3529.414) (-3536.043) [-3529.810] (-3532.702) * (-3535.532) (-3529.175) [-3532.583] (-3531.757) -- 0:02:46 358500 -- [-3527.639] (-3532.204) (-3529.916) (-3531.574) * (-3535.842) [-3530.833] (-3533.950) (-3534.974) -- 0:02:46 359000 -- (-3532.903) (-3528.805) [-3528.332] (-3533.918) * [-3529.582] (-3533.025) (-3530.648) (-3531.775) -- 0:02:46 359500 -- (-3529.686) [-3530.613] (-3539.096) (-3527.096) * (-3532.423) (-3538.490) (-3530.666) [-3530.778] -- 0:02:45 360000 -- (-3539.368) [-3534.278] (-3533.522) (-3532.904) * (-3532.863) [-3533.426] (-3526.706) (-3527.935) -- 0:02:47 Average standard deviation of split frequencies: 0.000000 360500 -- (-3530.204) (-3534.563) (-3534.887) [-3527.073] * (-3540.471) (-3529.137) [-3528.279] (-3527.426) -- 0:02:46 361000 -- (-3533.452) (-3532.964) [-3531.139] (-3528.909) * (-3530.630) [-3532.224] (-3528.134) (-3530.387) -- 0:02:46 361500 -- (-3532.652) (-3531.425) (-3535.166) [-3525.669] * [-3530.438] (-3533.611) (-3532.528) (-3537.915) -- 0:02:46 362000 -- (-3531.716) (-3531.874) [-3532.331] (-3526.994) * (-3533.551) (-3536.166) [-3533.251] (-3536.012) -- 0:02:45 362500 -- [-3539.321] (-3535.784) (-3527.217) (-3533.583) * (-3528.407) [-3526.280] (-3532.209) (-3533.749) -- 0:02:45 363000 -- [-3533.128] (-3532.733) (-3527.622) (-3535.759) * [-3526.281] (-3531.885) (-3536.284) (-3529.819) -- 0:02:44 363500 -- (-3538.392) (-3530.832) (-3529.207) [-3532.790] * (-3528.638) [-3530.462] (-3535.005) (-3530.827) -- 0:02:46 364000 -- [-3529.457] (-3535.129) (-3533.268) (-3535.280) * [-3528.970] (-3528.465) (-3542.137) (-3532.525) -- 0:02:45 364500 -- (-3536.571) (-3538.586) [-3533.743] (-3532.090) * [-3529.010] (-3536.639) (-3537.263) (-3533.451) -- 0:02:45 365000 -- [-3528.007] (-3540.663) (-3531.673) (-3538.865) * (-3532.682) (-3531.350) [-3528.006] (-3530.645) -- 0:02:45 Average standard deviation of split frequencies: 0.000000 365500 -- (-3528.009) (-3534.208) (-3529.423) [-3539.864] * (-3539.544) (-3537.578) (-3527.298) [-3528.013] -- 0:02:44 366000 -- (-3532.264) (-3531.460) [-3526.866] (-3541.389) * (-3530.345) (-3534.587) [-3527.034] (-3530.831) -- 0:02:44 366500 -- [-3532.087] (-3535.916) (-3533.705) (-3531.996) * (-3528.669) [-3531.604] (-3529.640) (-3532.885) -- 0:02:44 367000 -- (-3536.066) [-3529.120] (-3537.399) (-3531.391) * (-3525.525) [-3534.410] (-3543.146) (-3529.245) -- 0:02:43 367500 -- (-3533.980) (-3534.376) (-3533.071) [-3532.287] * [-3528.461] (-3534.820) (-3537.499) (-3538.220) -- 0:02:45 368000 -- (-3542.177) [-3532.914] (-3538.007) (-3526.855) * [-3533.246] (-3530.511) (-3536.959) (-3536.867) -- 0:02:44 368500 -- [-3534.169] (-3527.080) (-3534.879) (-3527.611) * (-3531.936) [-3530.701] (-3533.831) (-3534.360) -- 0:02:44 369000 -- [-3532.687] (-3533.675) (-3535.278) (-3535.880) * (-3531.536) (-3543.518) [-3532.083] (-3531.349) -- 0:02:44 369500 -- (-3530.847) (-3541.404) (-3533.326) [-3538.234] * (-3534.908) (-3529.134) [-3528.155] (-3533.592) -- 0:02:43 370000 -- (-3537.295) (-3537.181) [-3530.901] (-3530.542) * (-3532.978) (-3530.407) [-3530.427] (-3529.396) -- 0:02:43 Average standard deviation of split frequencies: 0.000000 370500 -- (-3536.377) (-3532.632) (-3530.702) [-3531.693] * [-3537.513] (-3532.868) (-3529.888) (-3528.035) -- 0:02:43 371000 -- (-3539.251) [-3527.000] (-3534.173) (-3527.799) * [-3532.594] (-3532.642) (-3530.352) (-3528.420) -- 0:02:42 371500 -- [-3532.345] (-3530.763) (-3530.858) (-3527.282) * (-3532.185) (-3531.176) (-3530.599) [-3531.987] -- 0:02:44 372000 -- (-3527.336) (-3539.184) [-3529.455] (-3539.400) * (-3535.614) [-3529.118] (-3530.689) (-3532.462) -- 0:02:43 372500 -- [-3529.776] (-3533.726) (-3528.995) (-3538.453) * (-3528.600) (-3533.251) (-3530.861) [-3528.553] -- 0:02:43 373000 -- [-3531.956] (-3532.985) (-3529.191) (-3530.749) * (-3532.514) (-3534.415) [-3530.156] (-3530.466) -- 0:02:43 373500 -- (-3530.374) (-3525.678) (-3528.376) [-3526.429] * [-3527.610] (-3538.953) (-3532.917) (-3529.999) -- 0:02:42 374000 -- (-3536.519) [-3524.880] (-3532.231) (-3534.320) * (-3529.416) (-3535.242) [-3529.065] (-3532.896) -- 0:02:42 374500 -- (-3534.580) [-3528.540] (-3529.525) (-3535.369) * (-3533.650) (-3533.521) [-3533.167] (-3526.957) -- 0:02:42 375000 -- [-3527.373] (-3531.812) (-3533.072) (-3535.249) * (-3531.838) [-3534.032] (-3536.647) (-3532.426) -- 0:02:41 Average standard deviation of split frequencies: 0.000000 375500 -- [-3530.193] (-3537.645) (-3541.713) (-3532.808) * (-3533.230) (-3528.940) (-3536.967) [-3528.780] -- 0:02:42 376000 -- (-3529.193) (-3539.284) [-3535.346] (-3533.721) * (-3530.860) [-3528.878] (-3532.074) (-3533.944) -- 0:02:42 376500 -- (-3530.826) [-3541.162] (-3536.176) (-3542.681) * (-3531.317) (-3531.642) [-3531.750] (-3531.458) -- 0:02:42 377000 -- (-3531.232) (-3539.252) (-3528.659) [-3536.591] * [-3531.911] (-3531.891) (-3531.223) (-3535.727) -- 0:02:41 377500 -- (-3532.911) [-3529.602] (-3528.521) (-3531.252) * (-3536.791) (-3531.203) (-3526.431) [-3538.826] -- 0:02:41 378000 -- (-3535.828) (-3532.572) (-3534.895) [-3531.251] * [-3535.329] (-3534.920) (-3536.029) (-3532.269) -- 0:02:41 378500 -- [-3530.493] (-3528.037) (-3528.227) (-3532.221) * (-3532.874) (-3530.767) (-3540.958) [-3535.517] -- 0:02:40 379000 -- [-3536.932] (-3526.937) (-3538.248) (-3529.676) * (-3531.440) (-3537.028) [-3532.583] (-3533.782) -- 0:02:42 379500 -- [-3532.070] (-3530.629) (-3531.616) (-3533.034) * (-3533.954) (-3535.295) (-3531.009) [-3542.445] -- 0:02:41 380000 -- [-3528.852] (-3533.853) (-3539.242) (-3526.813) * (-3534.143) (-3532.778) [-3533.598] (-3537.676) -- 0:02:41 Average standard deviation of split frequencies: 0.000000 380500 -- (-3533.842) (-3544.074) (-3537.824) [-3530.631] * [-3527.304] (-3534.163) (-3526.355) (-3529.157) -- 0:02:41 381000 -- (-3540.099) (-3535.473) [-3533.073] (-3528.334) * [-3527.492] (-3533.112) (-3531.899) (-3530.565) -- 0:02:40 381500 -- (-3532.657) (-3536.977) [-3527.614] (-3528.224) * (-3539.378) (-3526.888) [-3531.931] (-3533.358) -- 0:02:40 382000 -- (-3530.973) (-3535.881) (-3525.106) [-3528.083] * [-3532.201] (-3533.454) (-3526.031) (-3541.209) -- 0:02:40 382500 -- (-3527.977) (-3539.953) [-3538.979] (-3537.625) * [-3531.000] (-3536.716) (-3532.786) (-3531.788) -- 0:02:39 383000 -- [-3533.193] (-3538.443) (-3529.403) (-3532.367) * (-3530.435) [-3527.615] (-3528.881) (-3528.338) -- 0:02:41 383500 -- [-3528.515] (-3537.667) (-3531.513) (-3536.078) * (-3530.968) [-3525.719] (-3530.486) (-3537.296) -- 0:02:40 384000 -- (-3530.924) (-3545.406) [-3531.475] (-3528.471) * (-3533.960) (-3539.152) [-3528.239] (-3533.389) -- 0:02:40 384500 -- (-3531.493) (-3533.302) [-3529.910] (-3530.020) * [-3539.587] (-3528.933) (-3530.180) (-3531.215) -- 0:02:40 385000 -- (-3535.684) (-3535.378) [-3529.196] (-3528.309) * (-3533.265) [-3532.385] (-3532.084) (-3528.016) -- 0:02:39 Average standard deviation of split frequencies: 0.000000 385500 -- [-3526.348] (-3540.684) (-3533.551) (-3529.416) * (-3533.168) (-3532.118) [-3529.760] (-3532.929) -- 0:02:39 386000 -- (-3526.281) (-3534.421) [-3530.018] (-3529.917) * (-3532.311) (-3539.101) (-3527.159) [-3530.209] -- 0:02:39 386500 -- [-3532.603] (-3532.068) (-3532.300) (-3531.791) * (-3533.331) (-3531.213) (-3529.770) [-3528.162] -- 0:02:40 387000 -- (-3532.023) (-3531.031) [-3531.350] (-3526.207) * [-3534.343] (-3532.445) (-3530.418) (-3534.674) -- 0:02:39 387500 -- (-3530.388) (-3539.594) (-3529.701) [-3526.124] * [-3530.055] (-3531.793) (-3529.717) (-3536.890) -- 0:02:39 388000 -- (-3537.875) (-3527.742) [-3531.404] (-3528.603) * (-3533.859) [-3526.091] (-3530.900) (-3535.168) -- 0:02:39 388500 -- (-3532.744) [-3526.680] (-3527.566) (-3530.181) * (-3530.432) (-3523.659) (-3534.296) [-3529.460] -- 0:02:38 389000 -- [-3539.101] (-3533.764) (-3531.246) (-3534.190) * (-3536.687) [-3529.450] (-3539.467) (-3529.663) -- 0:02:38 389500 -- (-3532.783) [-3529.241] (-3534.269) (-3529.964) * (-3532.017) (-3527.917) (-3540.321) [-3527.428] -- 0:02:38 390000 -- [-3529.420] (-3526.766) (-3532.717) (-3531.080) * (-3528.350) (-3532.125) [-3529.745] (-3539.726) -- 0:02:37 Average standard deviation of split frequencies: 0.000000 390500 -- (-3531.105) (-3527.826) [-3533.537] (-3531.646) * (-3532.624) (-3529.284) (-3534.176) [-3532.927] -- 0:02:39 391000 -- (-3545.576) (-3532.452) (-3530.183) [-3528.166] * (-3529.902) (-3539.969) (-3531.882) [-3533.745] -- 0:02:38 391500 -- (-3531.106) (-3529.924) (-3530.898) [-3529.409] * (-3531.187) (-3537.025) (-3526.277) [-3528.934] -- 0:02:38 392000 -- (-3529.574) (-3533.866) [-3528.482] (-3532.401) * (-3529.652) (-3528.809) [-3530.681] (-3533.612) -- 0:02:38 392500 -- (-3535.529) [-3529.693] (-3526.260) (-3531.633) * (-3542.304) (-3531.445) (-3537.239) [-3533.782] -- 0:02:37 393000 -- (-3535.275) [-3530.303] (-3526.323) (-3533.625) * (-3544.738) [-3532.426] (-3534.061) (-3541.213) -- 0:02:37 393500 -- (-3535.096) (-3535.214) [-3532.807] (-3532.189) * (-3528.915) (-3532.854) [-3528.731] (-3541.736) -- 0:02:37 394000 -- (-3539.098) (-3526.228) (-3536.282) [-3528.442] * [-3529.397] (-3533.453) (-3530.627) (-3539.247) -- 0:02:36 394500 -- [-3526.654] (-3528.454) (-3537.411) (-3524.725) * [-3531.574] (-3537.472) (-3532.270) (-3537.423) -- 0:02:38 395000 -- [-3526.210] (-3537.252) (-3527.915) (-3528.202) * (-3536.100) [-3525.219] (-3532.140) (-3538.679) -- 0:02:37 Average standard deviation of split frequencies: 0.000000 395500 -- (-3525.439) (-3539.979) [-3528.029] (-3529.431) * (-3532.117) [-3527.097] (-3533.322) (-3541.714) -- 0:02:37 396000 -- (-3528.679) (-3530.269) (-3532.127) [-3533.455] * (-3539.643) (-3528.393) [-3533.284] (-3536.559) -- 0:02:37 396500 -- [-3531.075] (-3539.745) (-3532.994) (-3529.147) * (-3537.566) (-3533.976) [-3530.369] (-3531.907) -- 0:02:36 397000 -- (-3529.743) (-3530.347) (-3530.387) [-3537.969] * (-3544.691) (-3534.913) [-3538.127] (-3539.353) -- 0:02:36 397500 -- (-3533.083) [-3526.422] (-3533.079) (-3529.966) * (-3538.259) [-3532.387] (-3534.207) (-3533.863) -- 0:02:36 398000 -- (-3532.665) [-3528.260] (-3531.288) (-3530.563) * (-3528.133) (-3527.908) (-3527.949) [-3530.570] -- 0:02:35 398500 -- (-3533.934) (-3533.609) (-3535.211) [-3527.273] * (-3529.723) [-3528.173] (-3531.257) (-3536.823) -- 0:02:36 399000 -- (-3529.577) [-3532.940] (-3536.805) (-3528.430) * [-3528.107] (-3533.322) (-3528.606) (-3532.665) -- 0:02:36 399500 -- (-3531.696) (-3534.892) [-3535.992] (-3530.961) * (-3533.154) [-3530.936] (-3535.029) (-3532.590) -- 0:02:36 400000 -- (-3533.221) [-3532.171] (-3532.784) (-3531.369) * (-3525.960) [-3528.521] (-3529.172) (-3538.894) -- 0:02:36 Average standard deviation of split frequencies: 0.000000 400500 -- (-3540.683) (-3532.876) (-3526.247) [-3526.939] * (-3534.547) (-3529.276) [-3526.934] (-3537.545) -- 0:02:35 401000 -- (-3535.257) [-3528.137] (-3528.215) (-3530.572) * (-3534.503) [-3527.410] (-3529.844) (-3535.546) -- 0:02:35 401500 -- (-3527.845) [-3528.056] (-3526.649) (-3533.986) * (-3530.666) (-3531.169) (-3532.380) [-3534.794] -- 0:02:35 402000 -- (-3526.074) [-3532.349] (-3534.126) (-3530.917) * (-3527.675) [-3530.376] (-3537.522) (-3539.024) -- 0:02:36 402500 -- (-3526.531) (-3532.023) (-3529.949) [-3530.016] * (-3534.054) (-3531.223) (-3530.381) [-3532.618] -- 0:02:35 403000 -- (-3527.030) [-3528.977] (-3533.814) (-3541.496) * (-3530.533) [-3529.022] (-3534.357) (-3532.692) -- 0:02:35 403500 -- [-3529.811] (-3532.994) (-3530.515) (-3531.573) * (-3541.998) [-3533.553] (-3530.900) (-3530.472) -- 0:02:35 404000 -- [-3524.410] (-3528.349) (-3528.391) (-3529.894) * [-3529.375] (-3530.159) (-3528.101) (-3529.982) -- 0:02:34 404500 -- (-3538.408) [-3528.230] (-3528.919) (-3535.089) * [-3529.665] (-3539.188) (-3530.930) (-3530.282) -- 0:02:34 405000 -- (-3537.083) (-3541.766) [-3532.065] (-3532.940) * [-3531.855] (-3529.373) (-3532.869) (-3537.097) -- 0:02:34 Average standard deviation of split frequencies: 0.000000 405500 -- [-3532.111] (-3532.111) (-3531.333) (-3525.016) * (-3528.207) (-3526.180) (-3531.378) [-3528.238] -- 0:02:33 406000 -- (-3534.676) (-3534.802) [-3530.769] (-3529.774) * (-3531.852) (-3534.645) [-3534.018] (-3531.781) -- 0:02:35 406500 -- [-3528.818] (-3524.613) (-3532.722) (-3528.037) * (-3531.527) (-3532.419) (-3541.605) [-3538.964] -- 0:02:34 407000 -- [-3529.405] (-3531.604) (-3531.716) (-3530.404) * (-3533.207) [-3527.835] (-3536.849) (-3535.214) -- 0:02:34 407500 -- (-3527.055) (-3537.985) (-3533.286) [-3534.420] * (-3528.634) [-3533.618] (-3535.727) (-3534.544) -- 0:02:34 408000 -- [-3531.890] (-3534.012) (-3532.541) (-3531.464) * [-3527.872] (-3528.967) (-3537.388) (-3527.902) -- 0:02:33 408500 -- (-3535.932) (-3527.209) [-3535.988] (-3527.838) * (-3536.031) (-3527.229) [-3534.181] (-3531.132) -- 0:02:33 409000 -- (-3530.238) [-3526.739] (-3535.995) (-3535.325) * (-3536.696) [-3533.253] (-3536.212) (-3532.307) -- 0:02:33 409500 -- [-3535.736] (-3528.126) (-3538.913) (-3537.924) * (-3545.956) (-3525.460) (-3536.655) [-3531.383] -- 0:02:34 410000 -- [-3530.213] (-3536.465) (-3530.018) (-3528.576) * (-3530.673) [-3527.039] (-3533.336) (-3531.099) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 410500 -- (-3537.383) (-3536.230) [-3529.613] (-3535.155) * (-3529.763) [-3531.926] (-3533.987) (-3530.410) -- 0:02:33 411000 -- [-3533.091] (-3529.845) (-3531.232) (-3536.506) * [-3525.603] (-3536.441) (-3527.492) (-3529.830) -- 0:02:33 411500 -- (-3530.673) (-3532.040) (-3529.182) [-3528.163] * (-3533.095) [-3526.392] (-3530.855) (-3528.658) -- 0:02:33 412000 -- (-3532.242) (-3534.557) [-3527.346] (-3531.983) * (-3537.062) [-3524.595] (-3542.429) (-3533.868) -- 0:02:32 412500 -- (-3533.200) (-3528.890) (-3536.850) [-3528.332] * (-3539.364) (-3530.419) (-3532.750) [-3531.624] -- 0:02:32 413000 -- [-3532.606] (-3528.689) (-3537.318) (-3529.734) * [-3535.925] (-3530.178) (-3530.810) (-3534.464) -- 0:02:33 413500 -- (-3531.867) [-3528.155] (-3533.494) (-3528.778) * [-3528.921] (-3545.967) (-3536.153) (-3531.865) -- 0:02:33 414000 -- (-3539.287) (-3534.975) [-3535.383] (-3526.794) * (-3530.500) [-3533.199] (-3540.298) (-3535.220) -- 0:02:32 414500 -- (-3533.789) [-3533.103] (-3525.462) (-3531.127) * (-3530.471) (-3530.117) (-3528.110) [-3534.123] -- 0:02:32 415000 -- [-3530.858] (-3533.609) (-3532.646) (-3534.701) * (-3534.821) (-3535.884) (-3537.428) [-3532.088] -- 0:02:32 Average standard deviation of split frequencies: 0.000000 415500 -- [-3528.691] (-3533.452) (-3527.666) (-3530.623) * (-3535.506) (-3533.872) [-3534.653] (-3541.389) -- 0:02:31 416000 -- (-3540.265) [-3534.513] (-3529.273) (-3532.169) * (-3524.542) (-3531.182) (-3529.633) [-3532.923] -- 0:02:31 416500 -- [-3531.147] (-3538.929) (-3527.583) (-3536.759) * (-3528.487) (-3529.653) [-3527.598] (-3535.464) -- 0:02:32 417000 -- (-3537.198) (-3530.699) (-3532.344) [-3532.179] * (-3529.429) (-3537.391) [-3529.136] (-3530.501) -- 0:02:32 417500 -- (-3531.880) [-3533.595] (-3532.962) (-3534.160) * (-3533.171) (-3531.380) (-3529.291) [-3530.794] -- 0:02:32 418000 -- (-3540.572) (-3531.264) (-3530.858) [-3536.082] * (-3530.554) (-3534.178) (-3530.561) [-3530.616] -- 0:02:31 418500 -- (-3533.282) [-3534.357] (-3537.299) (-3529.289) * (-3526.639) (-3531.881) (-3529.781) [-3527.279] -- 0:02:31 419000 -- (-3540.806) [-3534.156] (-3528.741) (-3530.513) * (-3529.646) (-3532.154) (-3526.213) [-3530.232] -- 0:02:31 419500 -- (-3531.736) [-3536.773] (-3533.234) (-3542.416) * (-3531.453) (-3536.932) (-3527.538) [-3531.832] -- 0:02:30 420000 -- (-3530.988) (-3536.887) [-3532.041] (-3533.507) * (-3535.861) [-3535.644] (-3529.928) (-3531.310) -- 0:02:31 Average standard deviation of split frequencies: 0.000000 420500 -- (-3536.857) (-3531.665) (-3534.108) [-3529.772] * (-3529.148) (-3532.369) [-3534.281] (-3526.829) -- 0:02:31 421000 -- (-3541.802) [-3536.514] (-3532.663) (-3528.538) * (-3531.030) (-3536.088) [-3527.907] (-3531.382) -- 0:02:31 421500 -- (-3535.196) [-3530.530] (-3527.125) (-3530.525) * (-3526.339) (-3532.062) [-3526.514] (-3531.654) -- 0:02:30 422000 -- (-3541.326) (-3535.238) [-3528.387] (-3528.137) * (-3532.605) [-3527.835] (-3530.900) (-3533.677) -- 0:02:30 422500 -- (-3530.194) (-3533.241) [-3529.578] (-3539.499) * [-3530.183] (-3535.005) (-3528.863) (-3531.957) -- 0:02:30 423000 -- (-3528.280) [-3529.319] (-3525.805) (-3527.919) * [-3534.484] (-3534.489) (-3530.539) (-3530.761) -- 0:02:30 423500 -- [-3528.730] (-3529.935) (-3533.503) (-3531.293) * (-3536.332) (-3534.141) (-3533.297) [-3526.297] -- 0:02:29 424000 -- (-3529.222) (-3530.863) [-3528.500] (-3532.095) * [-3534.864] (-3528.591) (-3534.741) (-3530.872) -- 0:02:30 424500 -- [-3531.422] (-3531.325) (-3526.479) (-3538.650) * (-3538.106) (-3533.937) [-3534.685] (-3527.841) -- 0:02:30 425000 -- [-3527.849] (-3530.791) (-3529.441) (-3526.571) * (-3529.490) (-3533.483) (-3533.338) [-3535.357] -- 0:02:30 Average standard deviation of split frequencies: 0.000000 425500 -- [-3530.124] (-3535.715) (-3536.174) (-3532.963) * (-3537.431) [-3528.472] (-3533.587) (-3528.981) -- 0:02:29 426000 -- (-3533.430) (-3530.644) [-3536.646] (-3527.785) * (-3533.527) [-3532.291] (-3529.693) (-3535.718) -- 0:02:29 426500 -- [-3528.713] (-3537.102) (-3527.846) (-3532.240) * (-3531.691) [-3527.060] (-3529.713) (-3534.478) -- 0:02:29 427000 -- (-3531.700) (-3530.413) (-3532.752) [-3532.617] * (-3528.069) [-3533.006] (-3528.055) (-3541.037) -- 0:02:30 427500 -- (-3530.878) [-3533.455] (-3532.950) (-3531.199) * [-3534.538] (-3533.378) (-3535.497) (-3533.376) -- 0:02:29 428000 -- [-3533.889] (-3535.081) (-3529.816) (-3530.352) * [-3531.075] (-3534.842) (-3537.739) (-3536.689) -- 0:02:29 428500 -- [-3532.371] (-3530.308) (-3537.455) (-3530.950) * (-3533.775) (-3537.436) [-3531.573] (-3530.761) -- 0:02:29 429000 -- (-3533.108) [-3529.714] (-3532.802) (-3541.210) * [-3531.636] (-3532.594) (-3529.079) (-3531.356) -- 0:02:29 429500 -- (-3534.696) (-3526.405) [-3531.596] (-3531.023) * (-3529.046) (-3533.062) (-3534.056) [-3533.833] -- 0:02:28 430000 -- (-3542.499) [-3527.298] (-3532.730) (-3528.462) * [-3533.017] (-3533.950) (-3534.303) (-3540.835) -- 0:02:28 Average standard deviation of split frequencies: 0.000000 430500 -- (-3537.282) [-3528.649] (-3535.774) (-3531.386) * (-3531.668) (-3527.933) [-3531.968] (-3541.929) -- 0:02:28 431000 -- (-3528.676) (-3534.251) (-3538.128) [-3530.619] * (-3538.225) (-3532.345) (-3532.801) [-3529.592] -- 0:02:29 431500 -- (-3531.347) (-3532.418) (-3538.241) [-3532.083] * (-3536.618) (-3530.015) [-3532.782] (-3531.941) -- 0:02:28 432000 -- (-3540.021) (-3534.232) [-3536.244] (-3533.241) * (-3532.615) (-3528.060) (-3528.868) [-3531.291] -- 0:02:28 432500 -- (-3536.056) [-3529.171] (-3533.589) (-3532.298) * (-3532.952) (-3532.106) [-3527.148] (-3535.102) -- 0:02:28 433000 -- (-3540.319) (-3533.513) (-3529.943) [-3527.259] * (-3544.471) (-3535.220) [-3533.900] (-3537.259) -- 0:02:27 433500 -- (-3531.984) [-3525.727] (-3532.483) (-3533.247) * (-3530.667) [-3528.551] (-3543.174) (-3536.150) -- 0:02:27 434000 -- (-3530.049) (-3531.887) (-3531.997) [-3529.400] * (-3530.295) (-3532.536) (-3531.373) [-3528.201] -- 0:02:27 434500 -- [-3528.015] (-3535.750) (-3535.731) (-3531.791) * (-3527.281) (-3535.121) (-3537.888) [-3530.646] -- 0:02:28 435000 -- [-3529.840] (-3528.198) (-3531.358) (-3530.704) * (-3527.410) (-3526.323) [-3537.710] (-3531.562) -- 0:02:28 Average standard deviation of split frequencies: 0.000000 435500 -- (-3528.420) (-3530.875) (-3530.301) [-3534.695] * (-3532.669) (-3533.350) [-3540.185] (-3537.183) -- 0:02:27 436000 -- [-3527.043] (-3527.054) (-3541.175) (-3544.029) * (-3531.372) [-3538.582] (-3533.857) (-3532.788) -- 0:02:27 436500 -- (-3526.928) [-3533.625] (-3535.559) (-3528.504) * (-3525.289) (-3528.537) (-3535.329) [-3531.591] -- 0:02:27 437000 -- [-3526.075] (-3533.352) (-3531.976) (-3530.362) * (-3528.562) (-3531.403) (-3531.741) [-3535.257] -- 0:02:26 437500 -- (-3524.980) (-3532.842) (-3532.302) [-3533.363] * (-3529.925) (-3528.395) (-3537.101) [-3530.249] -- 0:02:26 438000 -- [-3532.747] (-3535.339) (-3534.395) (-3536.276) * (-3534.670) (-3537.275) (-3536.399) [-3526.970] -- 0:02:27 438500 -- (-3528.118) (-3531.948) (-3531.214) [-3531.389] * (-3529.906) [-3530.379] (-3547.251) (-3528.551) -- 0:02:27 439000 -- (-3534.930) [-3534.675] (-3531.394) (-3533.551) * (-3532.364) [-3533.931] (-3528.960) (-3532.079) -- 0:02:26 439500 -- [-3533.369] (-3540.111) (-3536.540) (-3529.022) * (-3539.250) (-3537.862) (-3531.457) [-3527.802] -- 0:02:26 440000 -- (-3530.102) (-3533.729) (-3536.005) [-3526.392] * (-3532.846) (-3532.510) (-3533.102) [-3530.846] -- 0:02:26 Average standard deviation of split frequencies: 0.000000 440500 -- (-3532.833) (-3533.095) (-3533.098) [-3531.770] * [-3534.331] (-3527.546) (-3526.392) (-3531.509) -- 0:02:26 441000 -- [-3530.504] (-3531.483) (-3530.817) (-3529.086) * (-3539.923) (-3530.265) (-3529.030) [-3529.008] -- 0:02:25 441500 -- (-3535.241) [-3530.999] (-3537.740) (-3528.403) * (-3537.452) (-3535.465) [-3528.344] (-3531.454) -- 0:02:26 442000 -- (-3542.321) (-3534.901) [-3530.263] (-3533.888) * (-3526.113) (-3541.778) (-3532.601) [-3534.823] -- 0:02:26 442500 -- [-3533.141] (-3530.702) (-3536.203) (-3530.802) * [-3535.364] (-3541.115) (-3532.655) (-3535.292) -- 0:02:26 443000 -- (-3529.262) [-3529.336] (-3532.422) (-3535.284) * [-3528.794] (-3530.336) (-3533.411) (-3539.751) -- 0:02:25 443500 -- [-3531.149] (-3533.149) (-3530.954) (-3529.171) * (-3533.829) (-3533.437) [-3530.855] (-3538.733) -- 0:02:25 444000 -- [-3532.484] (-3532.800) (-3542.158) (-3530.714) * (-3530.081) (-3538.352) [-3528.632] (-3534.726) -- 0:02:25 444500 -- (-3532.073) (-3529.388) [-3532.786] (-3537.018) * (-3532.548) [-3525.280] (-3535.745) (-3531.302) -- 0:02:24 445000 -- (-3541.008) (-3528.517) [-3529.181] (-3540.720) * (-3528.375) (-3529.243) (-3526.743) [-3530.376] -- 0:02:25 Average standard deviation of split frequencies: 0.000000 445500 -- (-3535.112) (-3528.678) [-3532.652] (-3534.106) * [-3527.634] (-3534.777) (-3530.174) (-3532.815) -- 0:02:25 446000 -- (-3535.560) (-3531.833) (-3538.755) [-3531.917] * (-3530.698) [-3532.741] (-3530.199) (-3534.886) -- 0:02:25 446500 -- [-3534.924] (-3537.812) (-3527.896) (-3529.746) * [-3532.871] (-3528.039) (-3536.431) (-3532.465) -- 0:02:25 447000 -- (-3537.285) [-3532.581] (-3532.613) (-3532.759) * (-3530.373) [-3528.180] (-3532.433) (-3534.304) -- 0:02:24 447500 -- (-3537.162) (-3536.319) (-3531.895) [-3530.250] * [-3530.104] (-3529.722) (-3527.750) (-3543.171) -- 0:02:24 448000 -- (-3527.892) (-3536.072) (-3536.847) [-3531.407] * (-3538.744) (-3528.852) (-3530.196) [-3532.937] -- 0:02:24 448500 -- (-3534.434) [-3531.558] (-3535.940) (-3533.912) * (-3531.143) (-3530.533) (-3529.835) [-3530.007] -- 0:02:25 449000 -- [-3529.852] (-3527.117) (-3530.541) (-3536.392) * (-3533.972) [-3529.941] (-3532.161) (-3532.638) -- 0:02:24 449500 -- [-3530.270] (-3526.265) (-3535.722) (-3527.999) * (-3531.257) (-3530.111) [-3537.003] (-3528.684) -- 0:02:24 450000 -- (-3530.022) [-3529.269] (-3537.073) (-3537.896) * (-3536.253) (-3535.190) (-3539.063) [-3532.278] -- 0:02:24 Average standard deviation of split frequencies: 0.000000 450500 -- (-3527.802) (-3532.982) [-3527.289] (-3545.823) * [-3533.496] (-3535.239) (-3533.419) (-3528.898) -- 0:02:23 451000 -- (-3527.623) [-3529.428] (-3531.530) (-3529.951) * (-3530.836) (-3525.691) (-3533.819) [-3533.433] -- 0:02:23 451500 -- (-3533.114) [-3527.426] (-3532.947) (-3531.561) * (-3538.419) (-3526.368) (-3534.978) [-3535.962] -- 0:02:24 452000 -- (-3530.251) [-3528.550] (-3527.927) (-3528.385) * (-3535.355) (-3531.086) (-3534.908) [-3532.190] -- 0:02:24 452500 -- (-3528.950) (-3532.702) (-3529.321) [-3531.353] * (-3531.921) (-3529.205) [-3526.676] (-3530.082) -- 0:02:23 453000 -- (-3526.840) [-3528.556] (-3533.737) (-3533.532) * (-3533.624) (-3528.011) [-3530.540] (-3531.906) -- 0:02:23 453500 -- (-3531.709) (-3534.104) [-3536.231] (-3539.086) * [-3536.373] (-3537.212) (-3538.226) (-3529.236) -- 0:02:23 454000 -- [-3532.250] (-3529.279) (-3535.656) (-3539.065) * (-3545.389) [-3528.863] (-3537.268) (-3532.398) -- 0:02:23 454500 -- (-3534.375) (-3529.065) (-3535.621) [-3532.790] * (-3531.074) (-3534.795) [-3530.617] (-3531.662) -- 0:02:22 455000 -- (-3534.776) (-3527.441) [-3540.998] (-3528.843) * (-3535.906) [-3533.751] (-3533.380) (-3535.515) -- 0:02:23 Average standard deviation of split frequencies: 0.000000 455500 -- (-3532.331) [-3535.101] (-3529.976) (-3528.355) * [-3526.902] (-3528.836) (-3531.029) (-3528.261) -- 0:02:23 456000 -- (-3534.050) (-3532.301) (-3534.517) [-3527.389] * [-3529.200] (-3532.452) (-3530.008) (-3526.736) -- 0:02:23 456500 -- [-3533.402] (-3531.371) (-3533.509) (-3532.642) * [-3528.274] (-3531.082) (-3527.676) (-3536.992) -- 0:02:22 457000 -- [-3533.889] (-3530.927) (-3533.176) (-3540.214) * (-3529.011) (-3531.283) (-3532.269) [-3536.847] -- 0:02:22 457500 -- [-3536.658] (-3530.135) (-3529.779) (-3530.282) * (-3537.069) (-3537.841) [-3528.969] (-3541.711) -- 0:02:22 458000 -- (-3535.013) (-3529.506) (-3530.391) [-3532.601] * (-3540.039) [-3530.566] (-3534.366) (-3529.372) -- 0:02:23 458500 -- [-3533.543] (-3537.530) (-3535.809) (-3536.617) * (-3540.633) [-3532.165] (-3529.224) (-3527.456) -- 0:02:22 459000 -- (-3533.334) (-3536.333) [-3530.075] (-3535.929) * (-3533.128) [-3530.045] (-3530.143) (-3530.879) -- 0:02:22 459500 -- (-3535.653) [-3531.325] (-3529.076) (-3532.084) * (-3527.182) [-3529.286] (-3531.102) (-3535.320) -- 0:02:22 460000 -- (-3535.555) (-3527.736) [-3526.792] (-3530.074) * [-3528.887] (-3528.203) (-3536.540) (-3534.612) -- 0:02:22 Average standard deviation of split frequencies: 0.000000 460500 -- (-3530.991) (-3527.890) (-3531.489) [-3529.657] * (-3533.484) (-3525.897) [-3532.882] (-3534.286) -- 0:02:21 461000 -- (-3532.027) (-3533.629) [-3528.388] (-3533.766) * (-3527.210) (-3525.632) (-3535.211) [-3539.621] -- 0:02:21 461500 -- [-3535.253] (-3533.932) (-3534.693) (-3527.978) * [-3534.146] (-3529.664) (-3532.189) (-3531.312) -- 0:02:22 462000 -- (-3530.922) [-3527.394] (-3537.853) (-3531.194) * (-3530.440) (-3531.655) (-3530.795) [-3535.284] -- 0:02:22 462500 -- [-3532.331] (-3528.224) (-3532.068) (-3529.130) * (-3533.306) (-3529.831) [-3530.607] (-3536.874) -- 0:02:21 463000 -- (-3530.229) (-3529.276) (-3539.464) [-3533.712] * (-3526.890) (-3534.672) (-3530.215) [-3528.672] -- 0:02:21 463500 -- [-3535.065] (-3530.781) (-3539.707) (-3535.829) * (-3527.719) [-3531.708] (-3535.986) (-3529.412) -- 0:02:21 464000 -- [-3533.347] (-3529.371) (-3537.962) (-3533.371) * (-3530.026) [-3529.721] (-3530.400) (-3537.749) -- 0:02:20 464500 -- (-3529.362) (-3525.700) (-3535.886) [-3530.418] * (-3533.256) (-3531.663) (-3539.281) [-3529.363] -- 0:02:20 465000 -- [-3531.900] (-3532.763) (-3529.306) (-3536.474) * (-3532.379) (-3530.324) [-3535.601] (-3528.001) -- 0:02:20 Average standard deviation of split frequencies: 0.000000 465500 -- [-3533.799] (-3532.324) (-3532.420) (-3529.290) * (-3533.366) [-3536.393] (-3534.580) (-3528.860) -- 0:02:21 466000 -- (-3530.361) (-3535.383) (-3531.387) [-3525.062] * [-3528.730] (-3538.023) (-3528.490) (-3531.081) -- 0:02:20 466500 -- (-3527.390) (-3527.639) (-3533.562) [-3531.452] * (-3529.632) (-3534.151) [-3532.536] (-3537.691) -- 0:02:20 467000 -- [-3527.424] (-3524.285) (-3532.010) (-3534.833) * (-3531.445) [-3528.135] (-3528.552) (-3533.791) -- 0:02:20 467500 -- (-3531.758) (-3530.990) (-3531.500) [-3532.675] * [-3530.905] (-3529.741) (-3535.151) (-3537.079) -- 0:02:20 468000 -- (-3544.248) (-3531.013) (-3532.160) [-3529.748] * (-3530.027) (-3535.950) [-3537.282] (-3537.103) -- 0:02:19 468500 -- (-3541.912) (-3531.431) [-3530.520] (-3534.602) * [-3528.137] (-3531.413) (-3534.640) (-3529.436) -- 0:02:20 469000 -- (-3528.215) (-3529.937) [-3532.354] (-3530.362) * (-3535.133) (-3536.013) (-3537.883) [-3532.984] -- 0:02:20 469500 -- (-3528.777) [-3524.609] (-3532.377) (-3531.176) * (-3530.136) [-3531.720] (-3528.535) (-3531.281) -- 0:02:20 470000 -- (-3527.276) (-3537.882) [-3531.393] (-3529.434) * [-3529.532] (-3530.641) (-3525.268) (-3532.651) -- 0:02:19 Average standard deviation of split frequencies: 0.000000 470500 -- (-3531.742) (-3528.414) (-3531.824) [-3527.271] * (-3527.416) (-3534.340) [-3527.488] (-3533.833) -- 0:02:19 471000 -- (-3531.750) (-3533.964) (-3527.314) [-3532.683] * [-3525.322] (-3527.833) (-3532.048) (-3533.446) -- 0:02:19 471500 -- (-3534.019) (-3535.618) [-3526.449] (-3529.725) * (-3535.896) (-3531.161) (-3532.816) [-3527.620] -- 0:02:18 472000 -- (-3530.039) (-3535.743) (-3531.606) [-3532.681] * (-3532.255) [-3530.736] (-3531.065) (-3535.475) -- 0:02:19 472500 -- (-3528.437) (-3538.587) [-3534.688] (-3531.709) * (-3533.818) (-3530.189) [-3529.991] (-3540.083) -- 0:02:19 473000 -- (-3531.435) (-3530.734) [-3532.364] (-3526.303) * (-3535.815) [-3527.463] (-3529.307) (-3528.838) -- 0:02:19 473500 -- (-3530.851) (-3532.627) (-3531.312) [-3529.546] * [-3533.648] (-3531.727) (-3531.880) (-3527.805) -- 0:02:18 474000 -- (-3534.061) (-3536.318) [-3528.709] (-3529.102) * [-3528.898] (-3527.640) (-3533.378) (-3527.653) -- 0:02:18 474500 -- (-3530.544) (-3536.678) (-3530.948) [-3527.861] * [-3530.201] (-3529.946) (-3531.871) (-3536.434) -- 0:02:18 475000 -- (-3530.439) [-3530.622] (-3527.514) (-3528.791) * (-3528.960) (-3529.822) [-3531.792] (-3539.036) -- 0:02:19 Average standard deviation of split frequencies: 0.000000 475500 -- [-3529.500] (-3536.099) (-3529.137) (-3531.141) * (-3540.433) [-3531.761] (-3529.177) (-3533.945) -- 0:02:18 476000 -- (-3536.535) (-3538.051) [-3534.595] (-3528.561) * (-3534.990) (-3534.749) [-3533.100] (-3534.432) -- 0:02:18 476500 -- (-3530.790) [-3533.737] (-3541.285) (-3531.401) * (-3530.920) [-3531.421] (-3532.210) (-3526.849) -- 0:02:18 477000 -- (-3535.194) (-3533.032) (-3530.288) [-3529.671] * (-3530.548) (-3529.844) [-3529.548] (-3543.554) -- 0:02:18 477500 -- (-3533.891) (-3530.722) (-3529.660) [-3534.705] * [-3525.878] (-3527.606) (-3530.396) (-3536.027) -- 0:02:17 478000 -- [-3526.689] (-3528.736) (-3530.409) (-3530.168) * [-3528.336] (-3526.103) (-3537.027) (-3532.433) -- 0:02:17 478500 -- [-3528.951] (-3528.758) (-3532.472) (-3532.487) * (-3526.881) [-3532.724] (-3533.000) (-3533.720) -- 0:02:18 479000 -- (-3527.446) [-3530.686] (-3528.134) (-3532.960) * (-3531.243) [-3533.243] (-3531.143) (-3533.337) -- 0:02:18 479500 -- [-3531.113] (-3536.163) (-3531.750) (-3536.741) * (-3528.284) (-3536.314) [-3534.124] (-3530.510) -- 0:02:17 480000 -- (-3529.663) (-3530.688) (-3530.632) [-3531.625] * [-3528.599] (-3527.679) (-3531.952) (-3529.492) -- 0:02:17 Average standard deviation of split frequencies: 0.000000 480500 -- [-3525.693] (-3533.300) (-3527.175) (-3531.365) * (-3534.304) (-3529.742) (-3525.909) [-3529.850] -- 0:02:17 481000 -- (-3529.490) (-3527.747) (-3530.636) [-3532.590] * (-3535.414) (-3531.618) [-3531.205] (-3537.057) -- 0:02:17 481500 -- [-3526.090] (-3525.726) (-3534.856) (-3534.621) * (-3536.226) (-3536.183) (-3531.307) [-3527.515] -- 0:02:17 482000 -- [-3531.577] (-3527.624) (-3530.939) (-3535.751) * (-3528.713) (-3532.689) (-3532.338) [-3527.190] -- 0:02:17 482500 -- [-3534.551] (-3528.673) (-3534.444) (-3534.927) * (-3528.559) (-3536.285) [-3535.314] (-3539.183) -- 0:02:17 483000 -- (-3529.724) (-3530.114) (-3535.907) [-3537.517] * (-3527.294) [-3528.894] (-3530.975) (-3536.141) -- 0:02:17 483500 -- (-3527.972) [-3534.468] (-3537.860) (-3536.169) * (-3534.129) [-3529.637] (-3534.956) (-3527.772) -- 0:02:16 484000 -- (-3531.348) (-3531.472) [-3531.013] (-3532.280) * (-3529.513) (-3527.276) (-3528.348) [-3531.397] -- 0:02:16 484500 -- [-3534.417] (-3532.939) (-3529.881) (-3533.118) * (-3534.531) (-3531.413) [-3527.958] (-3533.581) -- 0:02:17 485000 -- [-3535.375] (-3535.544) (-3537.573) (-3531.564) * (-3528.402) [-3537.125] (-3532.630) (-3537.447) -- 0:02:16 Average standard deviation of split frequencies: 0.000000 485500 -- (-3535.262) (-3529.853) [-3531.792] (-3536.262) * (-3537.426) (-3535.520) (-3529.815) [-3534.784] -- 0:02:16 486000 -- [-3527.798] (-3530.909) (-3530.322) (-3536.500) * (-3532.114) [-3526.799] (-3530.431) (-3534.829) -- 0:02:16 486500 -- (-3529.255) (-3531.677) [-3526.412] (-3531.134) * (-3537.167) [-3535.565] (-3533.394) (-3532.624) -- 0:02:16 487000 -- (-3531.553) (-3534.219) (-3531.131) [-3535.326] * (-3535.782) (-3532.975) (-3529.951) [-3535.578] -- 0:02:15 487500 -- (-3530.081) (-3533.669) (-3528.615) [-3534.558] * (-3539.126) [-3536.037] (-3531.318) (-3527.855) -- 0:02:16 488000 -- (-3528.911) (-3531.946) (-3530.020) [-3532.075] * (-3531.430) (-3535.841) (-3528.701) [-3529.493] -- 0:02:16 488500 -- (-3529.652) [-3533.251] (-3529.939) (-3528.889) * [-3529.865] (-3531.739) (-3535.002) (-3531.265) -- 0:02:16 489000 -- (-3533.337) [-3530.805] (-3528.287) (-3529.446) * (-3530.823) (-3535.212) [-3524.640] (-3532.033) -- 0:02:15 489500 -- [-3533.426] (-3535.059) (-3529.131) (-3529.283) * (-3533.657) [-3527.908] (-3532.813) (-3530.073) -- 0:02:15 490000 -- (-3531.964) (-3534.009) [-3533.469] (-3533.374) * (-3533.301) (-3529.436) [-3528.602] (-3528.650) -- 0:02:15 Average standard deviation of split frequencies: 0.000000 490500 -- (-3538.230) (-3526.889) [-3527.261] (-3534.049) * (-3537.569) [-3529.354] (-3532.432) (-3532.159) -- 0:02:16 491000 -- (-3533.777) [-3532.426] (-3538.749) (-3537.195) * (-3535.646) (-3528.131) [-3530.994] (-3528.335) -- 0:02:15 491500 --