--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:53:50 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2091/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -249.72 -254.54
2 -249.73 -253.71
--------------------------------------
TOTAL -249.73 -254.21
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884017 0.089050 0.361114 1.443666 0.851218 620.49 630.56 1.000
r(A<->C){all} 0.168179 0.018578 0.000001 0.434374 0.139757 121.82 145.85 1.000
r(A<->G){all} 0.157606 0.017011 0.000116 0.417112 0.121464 80.20 82.53 1.001
r(A<->T){all} 0.190473 0.024251 0.000116 0.499902 0.155081 40.30 101.15 1.000
r(C<->G){all} 0.149048 0.014835 0.000059 0.394684 0.119820 61.78 64.81 1.000
r(C<->T){all} 0.165097 0.022816 0.000009 0.480003 0.116315 61.63 89.58 1.004
r(G<->T){all} 0.169597 0.019885 0.000033 0.436970 0.133533 79.87 91.83 1.000
pi(A){all} 0.181769 0.000779 0.126299 0.235468 0.180556 562.34 656.67 1.000
pi(C){all} 0.256331 0.000976 0.191918 0.314328 0.255516 580.18 587.19 1.000
pi(G){all} 0.347398 0.001174 0.284031 0.410877 0.347297 550.72 635.79 1.000
pi(T){all} 0.214502 0.000892 0.152641 0.268272 0.213748 592.67 596.14 0.999
alpha{1,2} 0.400656 0.234640 0.000204 1.331825 0.228808 377.69 523.66 1.001
alpha{3} 0.422064 0.224224 0.000476 1.350289 0.266943 428.23 589.61 1.001
pinvar{all} 0.990197 0.000136 0.968662 0.999992 0.993853 471.86 611.43 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -232.467359
Model 2: PositiveSelection -232.467359
Model 0: one-ratio -232.467359
Model 3: discrete -232.467359
Model 7: beta -232.467359
Model 8: beta&w>1 -232.467359
Model 0 vs 1 0.0
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
>C2
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
>C3
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
>C4
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
>C5
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
>C6
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=61
C1 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
C2 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
C3 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
C4 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
C5 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
C6 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
**************************************************
C1 RLLDGLWGYGL
C2 RLLDGLWGYGL
C3 RLLDGLWGYGL
C4 RLLDGLWGYGL
C5 RLLDGLWGYGL
C6 RLLDGLWGYGL
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 61 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 61 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1830]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [1830]--->[1830]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.438 Mb, Max= 30.573 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
C2 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
C3 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
C4 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
C5 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
C6 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
**************************************************
C1 RLLDGLWGYGL
C2 RLLDGLWGYGL
C3 RLLDGLWGYGL
C4 RLLDGLWGYGL
C5 RLLDGLWGYGL
C6 RLLDGLWGYGL
***********
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
C2 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
C3 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
C4 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
C5 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
C6 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
**************************************************
C1 GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
C2 GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
C3 GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
C4 GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
C5 GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
C6 GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
**************************************************
C1 GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
C2 GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
C3 GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
C4 GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
C5 GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
C6 GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
**************************************************
C1 AGACTGCTCGACGGGTTATGGGGATATGGCTTA
C2 AGACTGCTCGACGGGTTATGGGGATATGGCTTA
C3 AGACTGCTCGACGGGTTATGGGGATATGGCTTA
C4 AGACTGCTCGACGGGTTATGGGGATATGGCTTA
C5 AGACTGCTCGACGGGTTATGGGGATATGGCTTA
C6 AGACTGCTCGACGGGTTATGGGGATATGGCTTA
*********************************
>C1
ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
AGACTGCTCGACGGGTTATGGGGATATGGCTTA
>C2
ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
AGACTGCTCGACGGGTTATGGGGATATGGCTTA
>C3
ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
AGACTGCTCGACGGGTTATGGGGATATGGCTTA
>C4
ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
AGACTGCTCGACGGGTTATGGGGATATGGCTTA
>C5
ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
AGACTGCTCGACGGGTTATGGGGATATGGCTTA
>C6
ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA
GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA
GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC
AGACTGCTCGACGGGTTATGGGGATATGGCTTA
>C1
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
>C2
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
>C3
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
>C4
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
>C5
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
>C6
MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
RLLDGLWGYGL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 183 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855981
Setting output file names to "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 292970350
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5351513260
Seed = 1193274777
Swapseed = 1579855981
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -409.562710 -- -24.965149
Chain 2 -- -409.562748 -- -24.965149
Chain 3 -- -409.562772 -- -24.965149
Chain 4 -- -409.562772 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -409.562710 -- -24.965149
Chain 2 -- -409.562772 -- -24.965149
Chain 3 -- -409.562748 -- -24.965149
Chain 4 -- -409.562710 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-409.563] (-409.563) (-409.563) (-409.563) * [-409.563] (-409.563) (-409.563) (-409.563)
500 -- (-263.354) (-268.919) (-260.318) [-266.267] * (-260.136) [-255.472] (-268.876) (-265.668) -- 0:00:00
1000 -- [-258.328] (-260.334) (-262.578) (-273.508) * (-259.230) (-265.138) [-255.899] (-264.019) -- 0:00:00
1500 -- (-253.494) (-259.105) [-257.026] (-260.146) * [-257.787] (-265.616) (-262.987) (-264.356) -- 0:00:00
2000 -- [-255.728] (-260.515) (-258.284) (-268.002) * (-256.784) (-263.645) [-257.690] (-266.329) -- 0:00:00
2500 -- (-260.236) (-255.933) (-262.588) [-262.911] * (-261.081) (-261.399) (-259.102) [-260.107] -- 0:00:00
3000 -- (-255.413) (-259.183) (-264.569) [-258.548] * [-255.835] (-258.983) (-254.822) (-257.135) -- 0:00:00
3500 -- (-262.960) [-257.150] (-260.511) (-269.945) * (-255.121) (-264.985) (-257.310) [-267.780] -- 0:00:00
4000 -- (-259.136) (-267.232) [-257.042] (-262.375) * (-259.329) (-266.214) (-268.556) [-257.830] -- 0:00:00
4500 -- [-266.893] (-270.385) (-264.983) (-267.564) * (-265.434) [-255.291] (-265.086) (-256.607) -- 0:00:00
5000 -- (-269.791) (-257.338) (-273.496) [-259.603] * (-256.878) [-264.422] (-272.731) (-255.717) -- 0:00:00
Average standard deviation of split frequencies: 0.099995
5500 -- (-257.102) [-255.819] (-266.711) (-259.225) * (-282.341) (-258.226) [-257.298] (-260.142) -- 0:00:00
6000 -- (-270.393) (-260.692) [-251.568] (-269.876) * (-270.302) [-254.906] (-258.319) (-259.717) -- 0:00:00
6500 -- (-258.140) [-258.359] (-253.593) (-258.986) * (-265.243) (-263.009) [-265.657] (-263.004) -- 0:00:00
7000 -- [-260.292] (-263.190) (-249.579) (-264.235) * [-250.901] (-263.430) (-258.166) (-266.538) -- 0:00:00
7500 -- (-258.962) (-269.442) (-249.959) [-263.679] * (-250.425) [-258.932] (-263.104) (-270.132) -- 0:00:00
8000 -- (-266.024) (-257.091) [-249.262] (-260.312) * (-252.354) (-259.631) [-260.844] (-261.772) -- 0:00:00
8500 -- (-266.739) [-262.683] (-249.592) (-261.775) * (-248.647) (-265.619) (-262.469) [-258.256] -- 0:00:00
9000 -- (-265.098) (-267.637) (-254.151) [-255.747] * (-249.751) (-261.180) [-257.187] (-274.072) -- 0:00:00
9500 -- (-261.131) (-259.603) [-249.406] (-258.963) * (-252.658) (-259.160) (-261.471) [-256.041] -- 0:00:00
10000 -- (-259.614) (-260.648) (-250.371) [-259.654] * [-251.076] (-250.260) (-266.416) (-255.621) -- 0:00:00
Average standard deviation of split frequencies: 0.058926
10500 -- [-250.812] (-257.348) (-250.087) (-258.847) * (-249.679) [-251.139] (-270.517) (-257.942) -- 0:00:00
11000 -- (-253.839) [-249.474] (-249.469) (-258.878) * [-251.867] (-251.000) (-258.484) (-264.127) -- 0:00:00
11500 -- (-248.526) (-248.513) [-250.032] (-260.795) * [-249.625] (-249.187) (-263.264) (-257.956) -- 0:00:00
12000 -- [-249.268] (-250.087) (-251.606) (-262.384) * [-251.502] (-249.182) (-257.650) (-261.284) -- 0:00:00
12500 -- (-249.571) (-252.085) (-249.943) [-261.802] * (-248.744) (-250.462) (-258.175) [-256.355] -- 0:00:00
13000 -- (-249.790) [-251.412] (-250.962) (-275.036) * (-250.220) (-249.533) (-260.818) [-259.254] -- 0:00:00
13500 -- (-250.213) (-249.011) [-251.891] (-260.778) * (-251.748) (-252.885) [-260.604] (-264.109) -- 0:00:00
14000 -- (-250.032) [-250.680] (-251.884) (-263.245) * (-249.759) (-250.784) (-256.586) [-268.334] -- 0:00:00
14500 -- (-250.948) (-251.806) [-251.435] (-262.140) * [-251.075] (-249.449) (-257.272) (-270.707) -- 0:00:00
15000 -- (-249.158) [-249.830] (-248.207) (-266.517) * (-248.557) [-249.451] (-261.128) (-259.523) -- 0:00:00
Average standard deviation of split frequencies: 0.060659
15500 -- [-250.882] (-249.997) (-251.954) (-266.266) * (-249.098) (-249.745) [-259.700] (-252.962) -- 0:00:31
16000 -- [-250.354] (-250.057) (-248.390) (-278.652) * (-249.090) (-249.614) [-263.404] (-270.244) -- 0:00:30
16500 -- (-250.631) (-248.940) [-249.541] (-270.203) * (-250.665) [-251.462] (-256.911) (-266.505) -- 0:00:29
17000 -- [-250.158] (-250.693) (-249.842) (-262.378) * (-250.388) [-249.122] (-265.719) (-263.460) -- 0:00:28
17500 -- (-251.041) (-249.021) [-252.877] (-258.374) * (-251.671) [-253.139] (-276.990) (-268.444) -- 0:00:27
18000 -- [-251.346] (-256.072) (-251.168) (-263.616) * (-251.385) (-250.100) (-263.132) [-258.574] -- 0:00:26
18500 -- [-248.663] (-251.620) (-250.211) (-260.409) * [-251.117] (-248.832) (-271.275) (-250.314) -- 0:00:26
19000 -- (-250.445) (-250.513) [-250.389] (-251.047) * (-249.661) (-250.347) (-258.362) [-249.087] -- 0:00:25
19500 -- (-253.618) (-255.041) [-248.558] (-253.284) * (-249.759) (-251.523) (-249.743) [-248.329] -- 0:00:24
20000 -- (-255.207) [-248.936] (-250.444) (-256.173) * (-249.469) (-250.321) (-255.725) [-248.882] -- 0:00:24
Average standard deviation of split frequencies: 0.048303
20500 -- (-251.478) (-249.655) (-251.377) [-251.912] * (-249.201) (-250.156) [-251.675] (-250.276) -- 0:00:23
21000 -- (-252.318) (-252.582) (-249.777) [-248.631] * (-252.374) (-249.745) (-250.342) [-249.576] -- 0:00:22
21500 -- [-249.826] (-252.801) (-249.327) (-250.430) * (-252.436) (-249.930) (-250.418) [-249.296] -- 0:00:22
22000 -- (-248.743) [-251.824] (-250.084) (-248.924) * [-253.471] (-249.566) (-248.922) (-249.681) -- 0:00:21
22500 -- (-249.902) (-250.190) [-250.044] (-250.692) * (-250.561) [-252.072] (-251.570) (-249.423) -- 0:00:21
23000 -- [-249.004] (-255.666) (-252.309) (-249.861) * (-250.093) (-251.523) (-249.043) [-250.264] -- 0:00:20
23500 -- (-248.780) (-250.105) [-250.867] (-248.824) * [-249.991] (-253.862) (-249.574) (-251.669) -- 0:00:20
24000 -- (-248.748) (-251.562) [-250.297] (-250.996) * (-249.840) [-248.866] (-250.662) (-252.861) -- 0:00:19
24500 -- [-248.996] (-249.773) (-250.020) (-253.763) * [-249.509] (-248.897) (-253.109) (-251.203) -- 0:00:19
25000 -- (-249.235) (-249.252) (-248.631) [-251.306] * (-252.207) (-254.070) (-248.890) [-248.873] -- 0:00:19
Average standard deviation of split frequencies: 0.060739
25500 -- (-249.513) [-250.391] (-249.154) (-249.274) * (-252.140) (-256.331) [-252.059] (-248.189) -- 0:00:18
26000 -- (-250.095) (-253.676) [-249.341] (-252.168) * [-251.075] (-253.936) (-251.573) (-250.171) -- 0:00:18
26500 -- (-248.538) (-251.600) [-249.205] (-251.686) * (-248.323) (-256.942) [-248.484] (-252.913) -- 0:00:17
27000 -- (-249.303) (-249.442) (-249.837) [-249.021] * (-252.714) (-250.153) [-253.113] (-249.938) -- 0:00:17
27500 -- [-249.339] (-252.866) (-249.214) (-251.400) * (-251.045) (-252.489) (-252.696) [-249.373] -- 0:00:17
28000 -- (-248.921) [-249.461] (-253.038) (-249.634) * (-253.198) (-251.112) [-248.845] (-251.287) -- 0:00:16
28500 -- (-250.972) (-249.517) [-251.491] (-251.972) * (-250.268) (-253.751) (-252.166) [-250.769] -- 0:00:16
29000 -- [-249.839] (-253.218) (-248.917) (-249.144) * (-253.794) [-249.814] (-249.605) (-251.105) -- 0:00:16
29500 -- [-249.303] (-252.109) (-250.443) (-249.164) * (-252.444) (-248.792) (-251.783) [-250.579] -- 0:00:31
30000 -- [-250.872] (-250.438) (-249.016) (-254.542) * (-250.704) (-252.879) [-250.534] (-249.830) -- 0:00:31
Average standard deviation of split frequencies: 0.043920
30500 -- (-250.151) [-249.401] (-248.652) (-250.477) * [-249.384] (-249.705) (-250.718) (-252.570) -- 0:00:30
31000 -- (-251.765) (-252.140) [-249.578] (-252.162) * (-250.628) (-254.019) [-249.380] (-253.802) -- 0:00:30
31500 -- (-253.805) (-250.297) [-249.476] (-249.447) * (-248.957) (-252.375) [-249.249] (-256.697) -- 0:00:29
32000 -- (-252.930) (-250.067) [-250.535] (-250.417) * (-251.462) (-248.242) [-248.428] (-255.409) -- 0:00:29
32500 -- [-252.229] (-251.293) (-252.180) (-250.061) * (-250.701) (-248.658) [-253.518] (-250.931) -- 0:00:28
33000 -- (-250.989) (-249.720) [-250.467] (-251.275) * (-248.757) (-252.326) (-256.292) [-249.643] -- 0:00:28
33500 -- (-249.425) (-248.529) (-251.178) [-249.980] * [-249.527] (-248.803) (-256.118) (-250.990) -- 0:00:27
34000 -- (-249.175) [-251.542] (-248.535) (-250.228) * (-249.981) (-250.987) [-251.196] (-253.661) -- 0:00:27
34500 -- (-249.959) (-252.811) [-248.644] (-252.366) * (-253.848) [-250.144] (-248.437) (-249.167) -- 0:00:26
35000 -- (-250.433) (-251.189) (-249.121) [-250.263] * (-249.683) [-252.989] (-249.924) (-248.880) -- 0:00:26
Average standard deviation of split frequencies: 0.043212
35500 -- (-249.350) (-252.103) (-249.987) [-249.815] * (-252.641) (-249.585) [-251.683] (-248.954) -- 0:00:26
36000 -- [-253.343] (-251.962) (-249.824) (-251.581) * (-253.565) (-248.891) [-250.503] (-249.146) -- 0:00:25
36500 -- (-253.541) (-249.988) [-249.003] (-250.621) * (-251.396) [-248.967] (-253.571) (-249.828) -- 0:00:25
37000 -- [-249.989] (-249.548) (-253.370) (-248.537) * (-253.828) [-248.729] (-252.164) (-248.245) -- 0:00:25
37500 -- (-251.143) (-248.597) [-249.033] (-249.806) * (-250.690) (-250.748) [-252.587] (-249.718) -- 0:00:24
38000 -- (-249.171) [-248.631] (-249.731) (-253.201) * [-252.620] (-250.412) (-253.106) (-251.731) -- 0:00:24
38500 -- (-254.685) [-248.860] (-250.969) (-252.324) * (-248.428) [-249.827] (-250.827) (-252.080) -- 0:00:23
39000 -- (-250.928) (-249.489) [-250.239] (-249.697) * [-249.281] (-249.526) (-254.562) (-249.158) -- 0:00:23
39500 -- [-249.840] (-254.688) (-250.219) (-250.310) * (-248.464) [-249.649] (-261.224) (-250.086) -- 0:00:23
40000 -- (-251.435) (-249.313) (-249.913) [-249.676] * (-249.990) (-250.341) [-250.195] (-250.947) -- 0:00:23
Average standard deviation of split frequencies: 0.045208
40500 -- (-253.001) (-250.642) (-250.226) [-250.779] * (-252.805) (-251.888) [-250.822] (-248.555) -- 0:00:22
41000 -- (-249.751) [-250.894] (-250.053) (-252.871) * (-251.349) (-254.159) (-257.147) [-250.156] -- 0:00:22
41500 -- [-248.648] (-249.616) (-251.799) (-249.879) * (-250.408) (-250.167) [-252.564] (-249.651) -- 0:00:22
42000 -- (-250.468) [-248.817] (-250.003) (-250.675) * (-251.404) (-249.839) [-253.268] (-248.521) -- 0:00:21
42500 -- (-250.184) (-248.922) [-249.024] (-251.988) * (-250.322) [-249.613] (-252.582) (-250.381) -- 0:00:21
43000 -- (-249.596) (-251.932) [-250.364] (-249.976) * (-253.797) (-251.995) (-254.048) [-249.004] -- 0:00:21
43500 -- (-249.583) (-252.011) (-249.468) [-249.055] * [-252.668] (-254.993) (-249.767) (-249.083) -- 0:00:20
44000 -- [-250.067] (-249.991) (-251.358) (-249.681) * (-251.653) (-252.299) [-251.496] (-248.885) -- 0:00:20
44500 -- (-251.755) [-251.991] (-252.982) (-251.272) * [-251.303] (-251.181) (-250.769) (-249.624) -- 0:00:20
45000 -- [-250.703] (-249.138) (-255.927) (-249.097) * [-255.841] (-250.274) (-250.153) (-248.362) -- 0:00:20
Average standard deviation of split frequencies: 0.035253
45500 -- (-254.640) [-251.825] (-252.182) (-251.331) * (-250.641) (-250.116) (-251.968) [-250.044] -- 0:00:29
46000 -- (-254.398) [-249.068] (-253.470) (-250.787) * (-253.651) [-248.881] (-249.737) (-248.530) -- 0:00:29
46500 -- (-254.171) (-249.250) (-249.412) [-249.215] * (-251.158) (-250.124) (-251.149) [-249.545] -- 0:00:29
47000 -- (-252.394) [-249.812] (-250.372) (-248.517) * (-254.034) [-250.188] (-252.826) (-253.553) -- 0:00:28
47500 -- (-253.220) [-254.285] (-248.890) (-250.246) * (-250.594) (-251.246) (-250.244) [-251.213] -- 0:00:28
48000 -- (-251.596) [-250.747] (-250.294) (-249.148) * (-249.454) (-249.565) (-253.263) [-248.996] -- 0:00:28
48500 -- (-252.325) [-251.364] (-249.692) (-248.838) * (-249.456) (-248.446) (-251.480) [-251.527] -- 0:00:27
49000 -- (-248.949) (-249.733) (-250.325) [-248.618] * (-250.972) [-250.309] (-249.689) (-249.937) -- 0:00:27
49500 -- [-249.240] (-251.434) (-250.691) (-248.719) * (-250.710) (-248.614) [-248.825] (-249.791) -- 0:00:27
50000 -- (-252.704) [-248.214] (-249.611) (-250.110) * (-251.928) (-249.307) [-248.414] (-250.347) -- 0:00:27
Average standard deviation of split frequencies: 0.029935
50500 -- [-249.946] (-249.545) (-251.324) (-249.567) * (-252.467) (-248.824) [-250.866] (-249.923) -- 0:00:26
51000 -- (-252.833) (-250.192) [-251.416] (-249.742) * [-249.235] (-253.441) (-249.960) (-251.208) -- 0:00:26
51500 -- (-249.008) [-250.352] (-251.229) (-249.868) * [-249.549] (-249.640) (-252.076) (-250.849) -- 0:00:26
52000 -- (-252.208) (-248.905) [-251.421] (-248.964) * [-253.369] (-249.556) (-249.933) (-250.746) -- 0:00:25
52500 -- (-248.523) (-251.218) (-249.126) [-248.617] * (-251.300) [-249.956] (-250.647) (-249.874) -- 0:00:25
53000 -- (-253.017) [-248.520] (-250.318) (-249.925) * (-249.492) (-249.145) [-251.630] (-249.654) -- 0:00:25
53500 -- (-251.504) [-250.821] (-249.411) (-251.176) * [-249.321] (-250.894) (-251.592) (-251.306) -- 0:00:25
54000 -- (-249.866) (-253.490) (-250.272) [-251.070] * (-250.607) (-252.147) (-249.183) [-250.591] -- 0:00:24
54500 -- (-250.318) (-251.341) (-254.236) [-248.698] * (-255.698) [-249.537] (-249.493) (-253.252) -- 0:00:24
55000 -- (-250.897) (-250.116) [-259.958] (-249.876) * (-249.502) (-250.170) (-250.013) [-249.864] -- 0:00:24
Average standard deviation of split frequencies: 0.027469
55500 -- (-253.106) (-252.178) (-251.236) [-250.353] * (-250.808) (-250.328) [-251.426] (-252.395) -- 0:00:24
56000 -- [-249.193] (-248.771) (-254.485) (-250.434) * [-252.459] (-248.213) (-250.329) (-250.821) -- 0:00:23
56500 -- (-249.186) (-249.961) (-250.456) [-250.519] * (-251.977) (-251.707) [-249.848] (-250.521) -- 0:00:23
57000 -- (-249.589) [-250.274] (-249.707) (-249.381) * (-251.360) [-252.614] (-249.186) (-256.069) -- 0:00:23
57500 -- (-252.110) (-252.898) [-249.643] (-248.690) * [-250.390] (-250.270) (-251.503) (-253.315) -- 0:00:23
58000 -- (-250.544) (-261.256) (-249.850) [-248.729] * (-250.184) (-248.949) [-250.578] (-249.947) -- 0:00:22
58500 -- (-250.792) (-255.406) (-249.746) [-249.120] * (-250.726) [-249.656] (-251.803) (-251.514) -- 0:00:22
59000 -- (-252.040) (-250.334) [-250.989] (-251.010) * (-254.813) [-250.085] (-250.627) (-250.722) -- 0:00:22
59500 -- (-250.052) (-248.848) (-249.572) [-249.321] * (-254.085) (-249.188) [-250.172] (-251.085) -- 0:00:22
60000 -- (-249.560) (-248.594) [-248.864] (-253.767) * (-249.096) (-249.038) (-251.768) [-249.755] -- 0:00:22
Average standard deviation of split frequencies: 0.026583
60500 -- (-250.152) [-249.225] (-250.249) (-251.955) * (-249.629) (-250.691) (-253.404) [-249.703] -- 0:00:21
61000 -- (-249.005) [-249.439] (-249.359) (-249.097) * (-253.430) (-250.607) (-252.522) [-250.371] -- 0:00:28
61500 -- (-248.836) (-248.514) [-249.146] (-248.605) * (-250.024) [-249.085] (-250.313) (-248.977) -- 0:00:28
62000 -- [-249.440] (-249.565) (-251.648) (-251.669) * (-250.517) [-249.492] (-251.245) (-250.708) -- 0:00:28
62500 -- (-252.662) [-252.904] (-251.473) (-252.082) * (-248.926) (-251.641) [-250.334] (-253.544) -- 0:00:28
63000 -- (-254.727) (-249.540) [-249.119] (-251.471) * [-250.089] (-255.286) (-256.982) (-250.749) -- 0:00:27
63500 -- (-249.317) [-251.060] (-251.339) (-250.824) * [-251.545] (-256.579) (-250.361) (-254.656) -- 0:00:27
64000 -- (-249.942) [-252.726] (-249.326) (-250.143) * (-249.916) (-255.255) [-250.851] (-252.707) -- 0:00:27
64500 -- (-252.342) (-248.515) [-249.492] (-253.363) * (-254.627) (-254.952) (-253.315) [-250.170] -- 0:00:27
65000 -- [-249.077] (-251.097) (-248.711) (-251.800) * (-250.575) (-252.461) (-251.364) [-251.147] -- 0:00:26
Average standard deviation of split frequencies: 0.021427
65500 -- (-250.980) [-250.983] (-248.382) (-250.100) * (-248.822) [-250.062] (-250.561) (-251.362) -- 0:00:26
66000 -- (-249.896) [-252.903] (-248.334) (-252.153) * (-249.030) (-250.907) [-252.259] (-249.903) -- 0:00:26
66500 -- [-248.962] (-252.818) (-252.429) (-253.606) * (-251.183) (-249.687) (-254.381) [-253.252] -- 0:00:26
67000 -- [-251.422] (-251.195) (-249.757) (-248.805) * [-249.719] (-248.922) (-253.187) (-249.416) -- 0:00:25
67500 -- (-250.128) (-249.194) [-251.330] (-251.054) * (-254.221) [-248.666] (-251.161) (-249.247) -- 0:00:25
68000 -- (-249.499) (-249.750) [-248.957] (-252.771) * [-250.816] (-252.608) (-253.876) (-250.306) -- 0:00:25
68500 -- (-248.671) (-250.507) [-249.692] (-249.744) * [-251.098] (-250.098) (-249.363) (-253.220) -- 0:00:25
69000 -- (-250.033) [-248.760] (-249.266) (-252.843) * (-256.193) (-252.090) [-250.214] (-250.650) -- 0:00:24
69500 -- (-253.939) (-250.267) (-249.073) [-251.752] * (-251.322) (-250.300) (-250.434) [-252.297] -- 0:00:24
70000 -- (-250.374) (-248.602) (-251.002) [-252.413] * [-248.677] (-249.986) (-253.616) (-249.746) -- 0:00:24
Average standard deviation of split frequencies: 0.018901
70500 -- (-252.333) (-249.900) (-250.812) [-256.273] * [-249.472] (-248.643) (-251.704) (-248.919) -- 0:00:24
71000 -- (-250.036) (-253.479) [-249.932] (-249.376) * (-251.837) (-249.240) [-248.749] (-251.806) -- 0:00:24
71500 -- (-250.342) (-253.236) (-250.260) [-250.022] * (-249.464) (-250.716) (-252.410) [-249.636] -- 0:00:23
72000 -- (-252.914) (-249.996) (-249.746) [-250.991] * (-251.086) [-249.109] (-250.398) (-249.993) -- 0:00:23
72500 -- [-251.122] (-251.646) (-248.816) (-250.532) * (-248.262) (-249.127) (-248.884) [-250.446] -- 0:00:23
73000 -- (-248.970) [-249.245] (-253.000) (-254.078) * (-249.642) (-248.873) (-250.614) [-250.497] -- 0:00:23
73500 -- (-251.564) (-249.278) (-248.977) [-252.528] * (-248.165) (-249.671) (-249.461) [-250.920] -- 0:00:23
74000 -- (-251.095) [-250.231] (-249.867) (-249.985) * (-250.436) [-250.257] (-253.538) (-249.825) -- 0:00:23
74500 -- (-251.565) (-249.585) (-250.436) [-251.283] * (-252.999) [-251.433] (-253.788) (-250.653) -- 0:00:22
75000 -- (-248.845) [-251.051] (-248.916) (-249.755) * (-250.982) (-250.994) (-252.090) [-249.342] -- 0:00:22
Average standard deviation of split frequencies: 0.019587
75500 -- (-249.053) (-254.128) [-250.168] (-249.066) * [-248.658] (-250.548) (-252.999) (-250.676) -- 0:00:22
76000 -- (-251.105) [-249.485] (-251.027) (-250.346) * (-250.891) [-249.678] (-250.645) (-249.348) -- 0:00:22
76500 -- (-252.656) (-248.985) [-255.098] (-249.359) * (-250.286) (-249.448) (-249.246) [-250.793] -- 0:00:22
77000 -- (-250.556) [-253.014] (-251.890) (-249.874) * [-252.849] (-250.114) (-250.897) (-251.451) -- 0:00:21
77500 -- (-249.927) [-251.282] (-249.882) (-248.982) * (-256.351) (-250.981) [-249.313] (-254.578) -- 0:00:21
78000 -- (-249.633) [-249.412] (-253.706) (-249.312) * [-249.128] (-250.461) (-250.982) (-252.917) -- 0:00:27
78500 -- (-249.672) (-254.281) [-249.304] (-250.407) * [-253.027] (-252.653) (-253.096) (-249.385) -- 0:00:26
79000 -- (-252.003) (-249.649) (-249.825) [-249.782] * (-250.937) [-251.321] (-251.617) (-249.206) -- 0:00:26
79500 -- [-249.360] (-248.835) (-249.470) (-248.926) * (-248.740) (-254.416) (-254.511) [-250.034] -- 0:00:26
80000 -- [-251.380] (-249.665) (-250.626) (-248.594) * (-250.392) (-251.859) (-254.730) [-250.467] -- 0:00:26
Average standard deviation of split frequencies: 0.017207
80500 -- (-250.917) (-250.153) (-249.808) [-254.209] * (-250.388) [-249.270] (-250.447) (-250.396) -- 0:00:26
81000 -- (-250.163) (-251.178) [-249.249] (-251.298) * (-249.669) [-248.311] (-251.835) (-249.432) -- 0:00:25
81500 -- (-249.913) (-252.111) (-248.473) [-251.761] * (-251.904) (-250.665) (-250.769) [-249.161] -- 0:00:25
82000 -- (-249.785) (-251.502) (-250.286) [-251.975] * [-250.688] (-252.315) (-249.593) (-252.054) -- 0:00:25
82500 -- (-249.590) [-249.276] (-250.214) (-249.751) * (-250.270) (-249.245) [-250.515] (-251.373) -- 0:00:25
83000 -- (-253.361) (-250.040) [-249.047] (-251.233) * (-252.860) (-249.756) (-250.788) [-250.206] -- 0:00:25
83500 -- (-252.299) [-250.985] (-250.188) (-249.556) * (-251.236) (-252.656) [-248.502] (-249.737) -- 0:00:24
84000 -- (-251.274) (-249.175) (-252.417) [-248.442] * (-248.040) (-257.830) (-251.604) [-248.831] -- 0:00:24
84500 -- [-249.469] (-256.224) (-249.395) (-249.615) * [-253.736] (-251.584) (-254.381) (-248.443) -- 0:00:24
85000 -- (-254.886) [-251.773] (-252.187) (-256.551) * (-254.066) (-249.418) [-252.005] (-250.485) -- 0:00:24
Average standard deviation of split frequencies: 0.016733
85500 -- (-251.137) (-258.403) (-249.839) [-248.874] * (-249.210) (-252.526) [-249.375] (-249.516) -- 0:00:24
86000 -- (-253.265) [-248.924] (-249.304) (-248.894) * [-250.507] (-251.539) (-249.052) (-249.098) -- 0:00:24
86500 -- (-248.344) (-250.150) (-248.969) [-250.626] * (-252.664) [-250.828] (-249.899) (-248.632) -- 0:00:23
87000 -- (-250.973) (-249.838) (-249.208) [-251.525] * (-249.544) (-249.238) [-254.962] (-252.086) -- 0:00:23
87500 -- (-250.206) (-253.337) [-251.269] (-252.412) * (-249.660) (-250.330) (-250.238) [-249.565] -- 0:00:23
88000 -- [-249.457] (-253.195) (-249.692) (-254.425) * [-250.606] (-248.504) (-249.579) (-249.990) -- 0:00:23
88500 -- (-250.922) (-254.347) [-250.038] (-253.316) * [-249.034] (-250.281) (-250.840) (-250.243) -- 0:00:23
89000 -- (-249.789) (-251.492) (-249.509) [-252.713] * (-249.467) (-249.720) (-250.012) [-250.921] -- 0:00:23
89500 -- (-249.169) (-251.572) (-250.412) [-248.902] * (-253.222) [-251.630] (-250.165) (-251.381) -- 0:00:22
90000 -- [-250.029] (-251.948) (-251.187) (-249.791) * [-248.840] (-250.268) (-251.182) (-248.928) -- 0:00:22
Average standard deviation of split frequencies: 0.017787
90500 -- (-252.380) (-251.875) (-250.411) [-248.166] * [-251.539] (-253.477) (-249.076) (-250.372) -- 0:00:22
91000 -- (-252.700) [-249.584] (-251.641) (-251.167) * [-250.786] (-251.723) (-252.287) (-249.159) -- 0:00:22
91500 -- (-249.169) [-252.484] (-249.596) (-253.536) * (-253.655) [-249.541] (-252.695) (-250.938) -- 0:00:22
92000 -- (-250.174) (-252.992) (-251.375) [-250.524] * (-249.171) [-248.385] (-251.340) (-250.502) -- 0:00:22
92500 -- (-250.503) (-249.966) (-249.675) [-249.941] * [-251.442] (-248.936) (-249.796) (-250.329) -- 0:00:22
93000 -- (-250.792) (-252.270) (-251.307) [-251.485] * (-251.885) (-251.591) (-248.255) [-251.898] -- 0:00:21
93500 -- [-251.091] (-253.399) (-249.790) (-253.440) * (-249.221) (-251.452) [-249.427] (-250.725) -- 0:00:21
94000 -- [-249.359] (-249.984) (-250.955) (-251.271) * [-248.836] (-255.220) (-249.822) (-251.579) -- 0:00:21
94500 -- (-252.474) (-251.729) [-249.413] (-250.135) * [-251.850] (-249.665) (-250.070) (-250.021) -- 0:00:21
95000 -- (-248.919) (-250.011) (-251.560) [-248.317] * (-250.265) (-249.099) (-249.698) [-250.854] -- 0:00:25
Average standard deviation of split frequencies: 0.019915
95500 -- (-253.281) (-252.684) (-257.660) [-248.617] * (-250.319) (-248.332) (-256.061) [-250.673] -- 0:00:25
96000 -- (-249.039) (-251.843) (-251.751) [-250.176] * [-249.525] (-249.984) (-251.087) (-250.353) -- 0:00:25
96500 -- (-249.829) (-256.499) (-248.971) [-250.559] * (-250.301) [-249.705] (-251.135) (-250.014) -- 0:00:25
97000 -- (-251.145) (-253.094) [-249.002] (-253.783) * (-251.664) (-251.882) (-252.321) [-248.305] -- 0:00:24
97500 -- (-251.424) (-250.028) (-249.713) [-249.635] * (-251.558) (-250.118) (-250.294) [-249.168] -- 0:00:24
98000 -- (-250.400) [-253.974] (-252.241) (-251.108) * (-250.166) [-248.914] (-250.218) (-252.277) -- 0:00:24
98500 -- (-249.283) [-253.915] (-250.010) (-249.960) * (-250.216) [-249.594] (-252.841) (-251.231) -- 0:00:24
99000 -- (-254.608) (-251.502) (-250.173) [-249.376] * (-252.466) [-249.981] (-254.447) (-252.801) -- 0:00:24
99500 -- (-249.988) [-250.497] (-252.204) (-250.645) * (-250.759) (-249.680) (-249.515) [-248.662] -- 0:00:24
100000 -- (-248.889) (-250.941) [-251.697] (-248.998) * (-248.818) [-250.777] (-250.446) (-251.287) -- 0:00:24
Average standard deviation of split frequencies: 0.019007
100500 -- (-251.187) (-249.314) [-249.703] (-250.395) * (-249.186) (-249.994) [-250.038] (-249.201) -- 0:00:23
101000 -- (-250.631) (-250.017) [-251.005] (-251.003) * (-250.029) [-250.536] (-249.585) (-248.598) -- 0:00:23
101500 -- (-253.026) [-250.614] (-249.392) (-249.423) * (-252.533) [-248.885] (-249.358) (-251.480) -- 0:00:23
102000 -- (-250.615) [-250.172] (-250.962) (-248.575) * (-250.216) [-248.162] (-252.359) (-249.474) -- 0:00:23
102500 -- (-251.964) [-251.118] (-249.754) (-248.867) * (-250.999) (-250.787) [-248.628] (-248.761) -- 0:00:23
103000 -- (-250.374) (-251.507) (-250.812) [-250.408] * [-251.558] (-250.222) (-252.120) (-249.548) -- 0:00:23
103500 -- (-250.379) (-248.789) [-250.544] (-250.412) * (-250.021) [-250.527] (-252.684) (-251.366) -- 0:00:22
104000 -- (-250.652) [-250.941] (-249.784) (-249.776) * [-249.110] (-248.768) (-248.660) (-254.753) -- 0:00:22
104500 -- (-249.808) (-250.986) [-250.874] (-251.705) * (-252.078) [-251.288] (-252.494) (-248.413) -- 0:00:22
105000 -- (-252.327) (-254.719) [-249.386] (-251.843) * (-251.562) (-256.124) (-249.969) [-249.311] -- 0:00:22
Average standard deviation of split frequencies: 0.016455
105500 -- [-253.865] (-250.390) (-250.292) (-252.349) * (-255.323) (-252.371) [-256.513] (-249.632) -- 0:00:22
106000 -- [-249.974] (-252.935) (-249.871) (-249.002) * (-252.542) (-250.215) [-251.060] (-249.552) -- 0:00:22
106500 -- (-248.664) (-251.594) (-248.405) [-249.171] * (-252.107) [-250.116] (-252.601) (-250.750) -- 0:00:22
107000 -- (-250.190) (-251.016) (-260.550) [-248.811] * (-249.276) (-248.961) [-249.605] (-251.986) -- 0:00:22
107500 -- [-248.378] (-254.687) (-254.678) (-252.073) * [-249.568] (-253.468) (-251.750) (-250.998) -- 0:00:21
108000 -- [-248.415] (-248.360) (-248.614) (-250.225) * [-248.773] (-250.008) (-253.671) (-252.828) -- 0:00:21
108500 -- [-249.987] (-249.919) (-252.215) (-249.547) * (-250.935) [-250.242] (-254.380) (-251.830) -- 0:00:21
109000 -- [-248.755] (-253.097) (-252.794) (-251.609) * (-252.081) (-250.646) (-250.044) [-253.310] -- 0:00:21
109500 -- (-249.288) (-250.895) [-251.285] (-250.750) * (-249.550) (-252.484) [-249.289] (-252.549) -- 0:00:21
110000 -- (-250.623) (-250.142) [-250.734] (-249.416) * [-249.976] (-250.642) (-252.166) (-251.174) -- 0:00:21
Average standard deviation of split frequencies: 0.016826
110500 -- [-253.862] (-254.279) (-250.216) (-251.319) * [-249.256] (-253.266) (-249.015) (-248.971) -- 0:00:21
111000 -- (-250.474) [-251.402] (-249.769) (-250.974) * (-249.233) [-256.067] (-250.510) (-249.290) -- 0:00:21
111500 -- (-250.504) [-248.568] (-251.886) (-250.322) * (-248.729) (-252.144) (-253.696) [-252.937] -- 0:00:20
112000 -- (-249.394) [-249.395] (-253.513) (-249.780) * [-248.802] (-251.493) (-257.418) (-250.206) -- 0:00:24
112500 -- (-248.722) (-254.668) (-249.443) [-249.975] * (-250.294) [-250.386] (-253.844) (-252.353) -- 0:00:24
113000 -- (-250.545) (-256.460) [-249.734] (-249.823) * (-249.353) (-251.167) [-252.684] (-251.447) -- 0:00:23
113500 -- (-253.663) (-256.208) (-249.870) [-249.433] * [-250.671] (-250.641) (-249.810) (-252.422) -- 0:00:23
114000 -- (-251.480) (-250.631) [-250.326] (-250.208) * (-250.893) (-248.765) (-252.934) [-253.400] -- 0:00:23
114500 -- (-255.513) (-250.214) (-249.625) [-251.124] * (-249.827) [-252.573] (-255.056) (-259.087) -- 0:00:23
115000 -- [-250.789] (-251.461) (-250.621) (-249.957) * [-251.662] (-251.778) (-249.277) (-252.609) -- 0:00:23
Average standard deviation of split frequencies: 0.016459
115500 -- (-253.048) (-249.289) [-248.884] (-249.780) * (-251.660) (-249.949) [-250.361] (-249.453) -- 0:00:23
116000 -- (-248.948) (-249.440) [-248.894] (-251.103) * (-250.728) (-253.222) (-250.866) [-248.210] -- 0:00:23
116500 -- (-250.976) (-250.047) [-251.226] (-252.118) * (-249.792) [-252.053] (-248.928) (-250.010) -- 0:00:23
117000 -- (-249.163) (-249.704) [-250.020] (-254.665) * (-250.812) [-251.242] (-252.531) (-249.902) -- 0:00:22
117500 -- (-250.467) (-251.750) [-249.877] (-252.340) * (-248.929) [-251.660] (-248.909) (-248.322) -- 0:00:22
118000 -- (-250.662) (-250.397) (-249.508) [-250.860] * (-250.597) (-250.227) [-252.757] (-250.908) -- 0:00:22
118500 -- (-250.838) [-249.898] (-250.079) (-250.755) * [-252.453] (-248.741) (-251.057) (-250.178) -- 0:00:22
119000 -- [-250.316] (-249.917) (-249.800) (-251.665) * (-249.339) (-249.216) (-255.843) [-250.124] -- 0:00:22
119500 -- (-249.366) (-255.029) [-250.893] (-251.121) * (-249.885) (-249.809) [-249.696] (-253.809) -- 0:00:22
120000 -- [-249.272] (-249.200) (-251.006) (-251.565) * (-250.825) [-248.879] (-249.216) (-251.702) -- 0:00:22
Average standard deviation of split frequencies: 0.016603
120500 -- (-249.645) (-248.326) [-249.742] (-249.935) * (-250.217) (-253.601) [-248.762] (-252.706) -- 0:00:22
121000 -- (-250.100) (-250.171) (-252.283) [-250.261] * (-254.379) [-251.288] (-249.095) (-250.894) -- 0:00:21
121500 -- (-249.185) [-250.150] (-248.718) (-249.764) * (-257.359) (-250.460) [-250.872] (-249.198) -- 0:00:21
122000 -- (-248.202) (-249.324) (-248.993) [-250.035] * (-254.833) (-249.377) [-251.125] (-249.376) -- 0:00:21
122500 -- [-250.509] (-249.450) (-248.248) (-248.919) * (-253.421) (-251.510) [-250.607] (-250.261) -- 0:00:21
123000 -- (-248.835) (-249.928) (-248.171) [-248.725] * (-251.537) (-253.888) [-258.848] (-251.315) -- 0:00:21
123500 -- [-248.857] (-249.902) (-250.214) (-248.557) * (-251.211) [-249.026] (-253.643) (-251.622) -- 0:00:21
124000 -- (-257.789) [-251.150] (-252.431) (-248.611) * (-252.883) (-253.132) [-250.727] (-251.506) -- 0:00:21
124500 -- (-252.309) (-251.528) (-249.585) [-249.045] * (-249.515) [-251.512] (-251.689) (-252.856) -- 0:00:21
125000 -- (-249.956) (-250.147) [-248.797] (-249.696) * (-249.849) (-249.927) (-249.699) [-248.050] -- 0:00:21
Average standard deviation of split frequencies: 0.016147
125500 -- (-251.757) (-249.624) (-249.625) [-249.469] * (-250.518) [-250.329] (-255.288) (-248.125) -- 0:00:20
126000 -- [-255.085] (-249.502) (-253.988) (-249.880) * (-248.535) (-250.173) (-252.891) [-248.917] -- 0:00:20
126500 -- (-257.587) (-250.634) (-251.384) [-248.623] * (-252.634) (-250.837) [-250.038] (-248.129) -- 0:00:20
127000 -- [-258.835] (-250.820) (-248.940) (-248.230) * [-253.220] (-254.044) (-248.793) (-252.699) -- 0:00:20
127500 -- (-251.090) (-250.576) [-248.510] (-254.126) * [-250.094] (-251.766) (-249.890) (-251.784) -- 0:00:20
128000 -- [-253.877] (-249.196) (-256.607) (-251.461) * [-251.823] (-250.477) (-249.700) (-250.248) -- 0:00:20
128500 -- (-248.835) (-249.687) (-249.770) [-249.756] * (-252.760) (-248.578) [-249.683] (-252.029) -- 0:00:20
129000 -- (-250.018) (-251.380) [-253.142] (-251.160) * (-250.743) (-249.150) (-250.124) [-248.728] -- 0:00:20
129500 -- (-249.725) (-252.540) (-248.907) [-250.882] * [-249.905] (-252.482) (-253.122) (-251.238) -- 0:00:22
130000 -- (-252.029) (-249.118) (-249.012) [-250.811] * (-250.110) [-248.507] (-250.307) (-253.776) -- 0:00:22
Average standard deviation of split frequencies: 0.016956
130500 -- (-251.044) (-249.158) [-249.322] (-250.801) * (-250.435) [-248.685] (-251.191) (-252.022) -- 0:00:22
131000 -- (-251.756) (-252.830) [-248.595] (-252.101) * (-251.425) (-249.189) [-249.103] (-252.947) -- 0:00:22
131500 -- [-252.472] (-252.500) (-250.654) (-253.568) * (-251.216) [-248.293] (-250.109) (-256.445) -- 0:00:22
132000 -- [-254.371] (-255.828) (-250.524) (-251.273) * (-249.310) [-249.756] (-250.690) (-253.740) -- 0:00:22
132500 -- [-250.032] (-252.754) (-249.205) (-248.434) * (-249.965) [-248.746] (-248.610) (-263.240) -- 0:00:22
133000 -- [-250.165] (-252.181) (-250.941) (-248.873) * [-249.235] (-250.986) (-249.222) (-256.097) -- 0:00:22
133500 -- (-248.807) (-253.133) (-248.083) [-251.864] * (-254.941) (-251.157) [-249.319] (-250.118) -- 0:00:21
134000 -- (-254.443) [-249.934] (-248.508) (-249.323) * (-250.885) (-250.245) (-251.630) [-250.746] -- 0:00:21
134500 -- (-251.168) [-251.507] (-249.132) (-248.719) * (-249.668) (-251.802) [-248.786] (-250.758) -- 0:00:21
135000 -- (-249.784) (-252.779) [-249.013] (-249.834) * (-252.946) [-249.776] (-250.025) (-249.984) -- 0:00:21
Average standard deviation of split frequencies: 0.018608
135500 -- (-250.035) (-252.694) (-250.733) [-250.580] * (-249.634) [-249.621] (-249.597) (-251.401) -- 0:00:21
136000 -- (-252.521) (-249.871) [-249.383] (-249.053) * (-249.729) [-248.485] (-249.852) (-250.644) -- 0:00:21
136500 -- (-249.954) (-249.225) (-253.072) [-248.376] * [-248.903] (-252.371) (-249.121) (-251.859) -- 0:00:21
137000 -- [-249.264] (-253.906) (-251.280) (-249.182) * [-250.894] (-248.992) (-249.573) (-254.304) -- 0:00:21
137500 -- (-250.920) [-251.376] (-248.681) (-250.340) * (-250.435) [-250.050] (-250.346) (-253.063) -- 0:00:21
138000 -- (-252.353) [-252.026] (-251.411) (-256.653) * (-250.355) (-254.483) (-249.466) [-251.888] -- 0:00:20
138500 -- (-251.303) (-249.349) (-249.899) [-249.605] * (-253.814) [-251.882] (-251.696) (-253.144) -- 0:00:20
139000 -- (-249.468) (-250.537) [-252.800] (-248.894) * (-252.195) (-250.035) (-252.038) [-249.920] -- 0:00:20
139500 -- [-252.359] (-249.536) (-250.285) (-248.956) * [-249.687] (-250.167) (-251.318) (-250.125) -- 0:00:20
140000 -- (-251.997) [-251.779] (-250.800) (-251.989) * [-249.679] (-249.577) (-250.204) (-250.104) -- 0:00:20
Average standard deviation of split frequencies: 0.017109
140500 -- (-249.829) (-258.739) (-248.281) [-251.638] * [-248.755] (-249.861) (-253.606) (-249.796) -- 0:00:20
141000 -- (-251.181) [-250.985] (-249.532) (-249.836) * (-248.957) [-254.019] (-250.491) (-250.375) -- 0:00:20
141500 -- (-253.912) (-251.611) (-250.349) [-250.972] * [-248.788] (-251.290) (-249.157) (-252.184) -- 0:00:20
142000 -- [-251.045] (-248.289) (-248.867) (-250.288) * (-249.595) (-250.203) (-249.551) [-251.129] -- 0:00:20
142500 -- (-250.704) [-249.372] (-250.871) (-250.038) * (-253.615) (-252.576) [-249.762] (-248.336) -- 0:00:20
143000 -- (-250.125) (-253.532) [-253.087] (-253.416) * [-249.052] (-250.167) (-252.117) (-252.034) -- 0:00:19
143500 -- (-248.995) [-252.175] (-249.514) (-249.144) * (-251.395) (-248.222) (-255.536) [-248.948] -- 0:00:19
144000 -- (-252.228) (-252.571) [-250.936] (-249.754) * (-249.593) (-250.582) [-251.233] (-255.799) -- 0:00:19
144500 -- (-253.173) (-252.810) (-249.836) [-249.656] * (-249.702) (-252.879) [-248.532] (-252.266) -- 0:00:19
145000 -- [-251.515] (-252.956) (-249.286) (-249.471) * (-254.462) (-250.027) (-249.141) [-251.554] -- 0:00:19
Average standard deviation of split frequencies: 0.015660
145500 -- (-253.198) (-249.943) (-252.590) [-250.050] * (-249.126) [-250.042] (-255.956) (-249.702) -- 0:00:19
146000 -- (-250.838) (-248.260) [-250.859] (-251.247) * (-248.508) (-250.419) [-249.875] (-251.681) -- 0:00:19
146500 -- (-251.373) [-250.970] (-253.531) (-251.355) * (-256.623) (-249.927) (-250.908) [-254.062] -- 0:00:19
147000 -- (-251.736) [-253.541] (-252.294) (-250.396) * [-251.760] (-249.580) (-253.832) (-251.378) -- 0:00:21
147500 -- [-251.391] (-248.660) (-251.237) (-251.713) * (-248.721) (-248.952) (-252.102) [-249.403] -- 0:00:21
148000 -- (-251.326) [-249.648] (-251.713) (-248.535) * [-250.283] (-254.064) (-251.096) (-248.915) -- 0:00:21
148500 -- (-250.587) (-249.532) (-249.685) [-250.263] * (-251.519) [-249.677] (-249.703) (-250.106) -- 0:00:21
149000 -- (-251.323) (-250.605) (-249.006) [-250.322] * (-251.820) (-248.765) (-249.366) [-250.938] -- 0:00:21
149500 -- (-249.885) [-249.890] (-248.940) (-253.521) * (-251.782) (-252.755) [-249.542] (-250.707) -- 0:00:21
150000 -- (-248.976) (-251.360) [-248.773] (-250.682) * (-249.063) (-249.011) [-253.067] (-249.119) -- 0:00:21
Average standard deviation of split frequencies: 0.020163
150500 -- (-249.531) [-249.626] (-250.643) (-253.086) * (-249.636) [-249.682] (-248.416) (-250.781) -- 0:00:20
151000 -- (-257.720) (-249.581) [-249.278] (-250.258) * (-251.626) (-251.277) (-249.057) [-249.578] -- 0:00:20
151500 -- [-251.146] (-251.996) (-253.344) (-251.112) * [-252.318] (-250.236) (-250.000) (-248.740) -- 0:00:20
152000 -- [-250.276] (-252.916) (-249.222) (-249.524) * (-249.665) [-249.081] (-250.713) (-251.120) -- 0:00:20
152500 -- (-250.522) (-251.437) [-250.523] (-256.431) * (-248.716) [-250.622] (-252.459) (-248.906) -- 0:00:20
153000 -- (-251.551) [-252.138] (-249.918) (-251.391) * (-249.803) [-250.072] (-249.142) (-250.406) -- 0:00:20
153500 -- (-248.966) (-253.774) [-248.730] (-249.479) * (-252.468) (-250.831) [-248.369] (-249.663) -- 0:00:20
154000 -- (-252.264) [-251.203] (-249.954) (-250.810) * (-248.638) (-249.357) [-248.450] (-252.511) -- 0:00:20
154500 -- (-250.815) [-249.333] (-249.373) (-249.602) * (-251.329) [-249.424] (-249.697) (-250.877) -- 0:00:20
155000 -- (-252.311) (-252.886) [-251.435] (-249.612) * (-255.373) [-250.181] (-251.720) (-249.815) -- 0:00:20
Average standard deviation of split frequencies: 0.018608
155500 -- (-250.545) (-252.142) [-249.848] (-253.136) * (-251.234) (-252.130) (-251.294) [-249.894] -- 0:00:19
156000 -- (-251.324) (-251.524) (-249.920) [-251.825] * [-249.632] (-251.798) (-249.797) (-253.877) -- 0:00:19
156500 -- (-248.850) (-252.491) [-250.943] (-252.530) * (-250.464) (-251.061) [-254.013] (-248.639) -- 0:00:19
157000 -- [-249.884] (-250.916) (-250.087) (-250.254) * (-250.052) (-249.827) [-252.239] (-249.650) -- 0:00:19
157500 -- (-250.710) (-249.308) (-250.104) [-250.137] * (-252.039) (-249.763) [-249.030] (-252.099) -- 0:00:19
158000 -- (-254.100) (-248.916) [-249.263] (-251.691) * (-250.734) (-250.518) (-250.019) [-250.215] -- 0:00:19
158500 -- [-254.194] (-252.677) (-252.662) (-249.956) * (-251.426) [-251.436] (-250.516) (-253.377) -- 0:00:19
159000 -- (-249.759) [-249.760] (-250.751) (-251.643) * (-248.627) (-250.441) (-250.233) [-249.354] -- 0:00:19
159500 -- (-255.433) (-254.197) (-249.977) [-251.030] * (-252.263) (-248.129) (-252.931) [-249.916] -- 0:00:19
160000 -- (-251.286) (-253.634) (-249.511) [-249.208] * (-250.539) (-251.870) [-248.287] (-255.222) -- 0:00:19
Average standard deviation of split frequencies: 0.018582
160500 -- (-253.612) (-250.314) (-249.180) [-250.525] * (-250.369) (-249.591) [-250.634] (-248.560) -- 0:00:19
161000 -- (-249.022) [-251.298] (-249.305) (-249.784) * (-249.342) [-252.132] (-248.897) (-253.597) -- 0:00:18
161500 -- (-249.535) (-249.358) (-252.230) [-252.571] * (-248.791) (-249.556) [-253.031] (-250.875) -- 0:00:18
162000 -- (-251.044) [-248.116] (-248.866) (-249.901) * [-251.933] (-250.016) (-252.132) (-250.898) -- 0:00:18
162500 -- (-248.514) (-249.307) (-250.727) [-249.338] * (-249.051) (-250.380) (-255.902) [-250.914] -- 0:00:18
163000 -- (-249.647) (-250.262) [-251.624] (-251.019) * (-253.923) (-248.553) (-251.220) [-250.677] -- 0:00:18
163500 -- [-251.633] (-249.314) (-248.781) (-251.344) * (-248.744) [-252.992] (-252.982) (-249.617) -- 0:00:18
164000 -- (-253.447) [-251.276] (-249.979) (-252.205) * (-249.456) [-250.484] (-251.794) (-249.494) -- 0:00:18
164500 -- (-249.810) [-251.099] (-248.941) (-250.071) * (-250.278) (-250.691) [-252.311] (-250.847) -- 0:00:20
165000 -- [-250.469] (-253.104) (-248.500) (-250.298) * (-249.587) [-252.145] (-248.662) (-253.737) -- 0:00:20
Average standard deviation of split frequencies: 0.017188
165500 -- (-249.006) (-251.364) [-248.609] (-249.633) * (-248.914) (-250.816) (-250.746) [-248.537] -- 0:00:20
166000 -- (-248.586) (-249.711) (-250.878) [-253.919] * (-248.702) [-249.460] (-250.266) (-249.484) -- 0:00:20
166500 -- (-251.545) (-251.041) (-250.186) [-249.508] * (-250.580) (-250.226) (-253.791) [-250.116] -- 0:00:20
167000 -- (-254.184) [-251.432] (-253.725) (-252.905) * (-251.303) [-250.971] (-252.640) (-250.695) -- 0:00:19
167500 -- [-251.013] (-250.888) (-251.303) (-251.618) * (-249.993) [-249.541] (-252.751) (-254.467) -- 0:00:19
168000 -- [-249.023] (-249.269) (-251.309) (-250.589) * (-251.998) [-249.808] (-252.013) (-249.317) -- 0:00:19
168500 -- (-249.264) (-249.531) (-249.113) [-255.395] * (-250.306) (-252.387) (-250.616) [-248.096] -- 0:00:19
169000 -- (-252.846) (-248.889) [-249.135] (-252.201) * (-249.701) (-248.468) (-250.836) [-251.638] -- 0:00:19
169500 -- (-250.289) (-249.439) [-249.803] (-249.269) * [-250.281] (-249.702) (-248.136) (-248.840) -- 0:00:19
170000 -- [-249.091] (-250.527) (-248.894) (-250.940) * (-249.798) (-250.507) (-248.725) [-248.149] -- 0:00:19
Average standard deviation of split frequencies: 0.018027
170500 -- [-251.733] (-257.526) (-249.369) (-254.004) * [-248.835] (-252.021) (-249.280) (-249.167) -- 0:00:19
171000 -- (-249.505) (-250.568) (-250.787) [-249.787] * (-249.584) [-251.697] (-252.622) (-248.105) -- 0:00:19
171500 -- (-250.814) (-251.448) (-250.142) [-248.862] * [-250.857] (-251.560) (-250.300) (-254.542) -- 0:00:19
172000 -- (-249.767) [-249.611] (-250.850) (-249.198) * [-249.272] (-250.538) (-252.844) (-249.984) -- 0:00:19
172500 -- (-249.278) [-249.968] (-248.489) (-249.989) * (-249.419) (-250.072) [-249.755] (-250.562) -- 0:00:18
173000 -- [-248.665] (-249.219) (-249.082) (-249.757) * (-252.960) [-251.302] (-253.257) (-257.685) -- 0:00:18
173500 -- [-248.355] (-251.930) (-251.493) (-249.737) * (-249.454) (-253.553) (-249.555) [-250.094] -- 0:00:18
174000 -- (-248.657) (-249.276) [-248.822] (-249.565) * [-251.036] (-250.446) (-251.062) (-251.193) -- 0:00:18
174500 -- [-248.644] (-249.336) (-250.936) (-251.763) * (-250.606) (-249.397) (-249.558) [-251.236] -- 0:00:18
175000 -- [-249.605] (-250.304) (-252.375) (-251.192) * [-250.989] (-250.694) (-251.020) (-250.260) -- 0:00:18
Average standard deviation of split frequencies: 0.018890
175500 -- (-249.191) (-251.449) (-252.356) [-250.553] * (-251.923) [-250.259] (-250.926) (-249.092) -- 0:00:18
176000 -- (-251.753) (-249.123) (-250.548) [-252.419] * [-251.522] (-252.127) (-252.088) (-248.870) -- 0:00:18
176500 -- (-250.998) (-249.917) (-258.579) [-250.066] * [-249.224] (-254.659) (-251.304) (-248.301) -- 0:00:18
177000 -- (-251.006) (-248.886) (-250.642) [-248.749] * (-248.337) [-251.369] (-254.178) (-248.870) -- 0:00:18
177500 -- [-250.139] (-251.255) (-250.982) (-249.970) * (-250.816) (-249.395) (-252.233) [-249.331] -- 0:00:18
178000 -- [-253.317] (-252.000) (-255.215) (-252.334) * (-251.946) (-249.311) (-251.127) [-249.921] -- 0:00:18
178500 -- (-249.041) [-248.531] (-251.782) (-250.784) * [-249.668] (-250.172) (-252.279) (-250.021) -- 0:00:18
179000 -- (-249.861) (-251.679) (-248.561) [-251.091] * (-252.026) (-249.367) [-251.157] (-250.635) -- 0:00:17
179500 -- (-250.159) [-249.762] (-249.416) (-251.421) * (-253.854) (-249.562) [-248.620] (-251.283) -- 0:00:17
180000 -- (-250.944) [-250.340] (-253.038) (-250.158) * (-254.919) [-250.290] (-249.476) (-254.563) -- 0:00:17
Average standard deviation of split frequencies: 0.021454
180500 -- (-249.970) (-250.778) (-253.205) [-249.127] * (-248.619) (-249.319) [-249.086] (-251.373) -- 0:00:17
181000 -- (-250.008) (-249.294) [-250.820] (-256.272) * [-249.987] (-249.988) (-253.447) (-251.993) -- 0:00:17
181500 -- (-249.488) (-249.816) (-250.434) [-252.277] * [-251.187] (-250.873) (-249.172) (-257.634) -- 0:00:19
182000 -- (-249.101) [-249.149] (-252.223) (-251.036) * [-249.414] (-249.890) (-252.038) (-250.846) -- 0:00:19
182500 -- (-250.482) [-251.696] (-250.825) (-248.591) * (-250.787) [-249.238] (-255.426) (-248.723) -- 0:00:19
183000 -- (-250.045) (-251.573) [-251.686] (-249.270) * (-251.498) (-253.903) (-253.564) [-248.996] -- 0:00:19
183500 -- [-250.547] (-249.052) (-249.912) (-250.966) * (-250.401) (-249.092) (-251.060) [-252.345] -- 0:00:18
184000 -- [-248.304] (-249.745) (-252.906) (-250.131) * (-248.907) [-248.316] (-251.555) (-251.751) -- 0:00:18
184500 -- (-249.379) (-249.167) [-250.120] (-250.227) * (-248.992) (-248.650) (-250.191) [-250.808] -- 0:00:18
185000 -- (-249.838) [-249.362] (-252.021) (-248.421) * [-250.366] (-250.233) (-249.088) (-249.032) -- 0:00:18
Average standard deviation of split frequencies: 0.019895
185500 -- (-249.687) (-250.041) [-251.051] (-249.011) * [-249.692] (-254.423) (-249.230) (-250.084) -- 0:00:18
186000 -- (-249.359) [-248.777] (-249.541) (-249.418) * (-249.490) [-251.686] (-250.466) (-248.731) -- 0:00:18
186500 -- (-253.767) [-250.939] (-252.552) (-248.923) * (-251.248) (-250.813) [-248.658] (-252.087) -- 0:00:18
187000 -- (-252.115) [-251.464] (-251.910) (-248.345) * (-249.660) (-249.766) (-250.028) [-249.865] -- 0:00:18
187500 -- (-249.741) (-249.741) (-248.766) [-248.776] * (-249.133) (-249.651) (-248.878) [-249.559] -- 0:00:18
188000 -- (-252.730) [-250.295] (-251.279) (-248.772) * (-249.110) (-254.510) (-250.003) [-250.029] -- 0:00:18
188500 -- [-253.667] (-250.511) (-249.336) (-253.893) * [-249.047] (-253.664) (-250.055) (-252.086) -- 0:00:18
189000 -- [-250.401] (-256.762) (-250.228) (-251.911) * (-249.652) (-250.249) [-254.933] (-250.667) -- 0:00:18
189500 -- (-249.122) (-253.067) (-251.399) [-252.291] * [-249.525] (-249.190) (-251.191) (-250.585) -- 0:00:18
190000 -- [-249.222] (-252.489) (-251.055) (-252.804) * (-249.771) (-251.283) (-252.770) [-249.488] -- 0:00:17
Average standard deviation of split frequencies: 0.018478
190500 -- (-251.154) [-249.154] (-250.011) (-250.139) * (-249.306) [-251.415] (-256.201) (-249.166) -- 0:00:17
191000 -- (-249.523) (-250.210) [-249.038] (-251.892) * [-251.925] (-250.141) (-252.658) (-250.025) -- 0:00:17
191500 -- (-252.021) (-252.473) (-251.752) [-250.267] * (-250.208) (-248.599) (-253.574) [-249.762] -- 0:00:17
192000 -- (-252.132) (-257.879) [-250.371] (-250.719) * (-251.249) (-248.719) [-250.748] (-249.269) -- 0:00:17
192500 -- (-252.878) (-248.420) [-249.236] (-250.942) * (-251.172) (-249.680) (-253.615) [-250.115] -- 0:00:17
193000 -- (-249.083) [-249.466] (-253.170) (-250.756) * (-253.714) [-251.314] (-251.973) (-249.317) -- 0:00:17
193500 -- (-249.964) (-251.401) [-250.480] (-250.823) * (-249.173) [-249.965] (-249.720) (-248.972) -- 0:00:17
194000 -- (-248.450) (-250.313) [-249.512] (-252.155) * (-249.052) (-248.467) [-248.563] (-254.630) -- 0:00:17
194500 -- (-248.234) (-248.295) (-249.239) [-252.781] * (-250.309) (-249.173) [-254.263] (-254.666) -- 0:00:17
195000 -- (-250.966) (-248.599) (-253.056) [-249.854] * [-249.078] (-250.524) (-251.067) (-250.290) -- 0:00:17
Average standard deviation of split frequencies: 0.015767
195500 -- (-251.951) (-249.381) (-250.258) [-252.885] * (-249.779) (-254.667) [-250.750] (-253.172) -- 0:00:17
196000 -- (-250.398) (-252.707) [-249.272] (-250.224) * (-249.167) [-249.301] (-252.465) (-253.489) -- 0:00:17
196500 -- (-250.487) (-250.369) [-250.626] (-249.048) * (-251.234) (-248.840) [-249.119] (-253.716) -- 0:00:16
197000 -- (-251.850) (-248.436) [-248.528] (-249.224) * (-255.175) (-250.974) [-250.372] (-254.196) -- 0:00:16
197500 -- (-250.186) (-251.676) (-249.417) [-248.379] * [-253.376] (-248.366) (-254.223) (-250.305) -- 0:00:16
198000 -- [-250.951] (-249.868) (-250.665) (-249.922) * (-252.238) (-249.153) (-250.419) [-251.671] -- 0:00:16
198500 -- [-249.188] (-249.832) (-251.612) (-252.451) * (-250.636) (-248.282) [-250.483] (-253.183) -- 0:00:16
199000 -- (-253.156) [-249.549] (-249.412) (-256.031) * [-250.142] (-248.278) (-249.340) (-249.588) -- 0:00:18
199500 -- (-250.388) (-253.248) [-249.251] (-254.424) * (-253.127) (-250.532) [-250.226] (-249.339) -- 0:00:18
200000 -- (-251.756) (-249.906) (-251.457) [-248.768] * [-251.613] (-251.261) (-252.715) (-252.516) -- 0:00:18
Average standard deviation of split frequencies: 0.016444
200500 -- (-249.730) (-249.269) (-250.064) [-249.200] * (-253.389) (-251.731) [-252.218] (-252.530) -- 0:00:17
201000 -- [-250.578] (-251.883) (-250.835) (-251.168) * (-250.595) (-249.842) (-251.407) [-249.443] -- 0:00:17
201500 -- [-250.080] (-252.646) (-251.056) (-249.520) * (-255.216) [-248.595] (-250.394) (-251.575) -- 0:00:17
202000 -- (-249.479) (-251.700) (-249.867) [-250.655] * [-248.868] (-250.656) (-248.460) (-251.226) -- 0:00:17
202500 -- (-250.049) (-250.650) [-249.987] (-249.808) * (-252.047) (-252.992) (-248.217) [-248.508] -- 0:00:17
203000 -- (-249.282) (-249.320) [-249.593] (-250.646) * (-249.418) (-251.694) [-249.248] (-250.138) -- 0:00:17
203500 -- [-249.495] (-248.772) (-249.447) (-248.857) * (-250.286) (-251.888) (-248.821) [-251.986] -- 0:00:17
204000 -- (-249.688) [-248.492] (-249.355) (-251.869) * (-251.716) (-251.216) [-248.330] (-250.468) -- 0:00:17
204500 -- (-249.427) (-249.673) [-248.359] (-251.380) * [-249.988] (-248.701) (-251.883) (-249.776) -- 0:00:17
205000 -- (-248.329) (-249.618) [-250.756] (-249.043) * (-248.520) (-257.528) [-252.241] (-248.547) -- 0:00:17
Average standard deviation of split frequencies: 0.015637
205500 -- (-249.774) [-250.953] (-251.312) (-251.494) * [-249.867] (-250.128) (-249.687) (-251.996) -- 0:00:17
206000 -- (-252.460) (-251.176) [-251.087] (-249.527) * (-250.449) (-250.976) [-249.665] (-249.608) -- 0:00:17
206500 -- (-249.833) [-251.295] (-250.755) (-253.089) * (-253.366) (-251.035) (-248.631) [-249.326] -- 0:00:17
207000 -- (-250.062) (-251.246) (-251.553) [-253.490] * (-251.162) (-252.395) (-248.892) [-249.624] -- 0:00:16
207500 -- (-249.296) (-254.505) [-251.000] (-249.517) * (-252.582) (-250.494) (-250.265) [-250.548] -- 0:00:16
208000 -- [-249.690] (-249.287) (-250.212) (-249.038) * (-255.064) (-251.195) (-251.927) [-253.200] -- 0:00:16
208500 -- (-253.077) [-250.655] (-251.656) (-249.159) * (-249.181) [-252.007] (-251.613) (-251.527) -- 0:00:16
209000 -- (-250.361) (-248.850) [-248.872] (-249.416) * (-249.475) [-249.096] (-251.770) (-253.651) -- 0:00:16
209500 -- (-250.656) (-255.604) (-249.298) [-250.808] * [-249.817] (-252.568) (-250.750) (-250.058) -- 0:00:16
210000 -- (-251.493) [-255.511] (-249.337) (-249.766) * [-250.200] (-254.757) (-253.284) (-250.550) -- 0:00:16
Average standard deviation of split frequencies: 0.013308
210500 -- (-249.197) (-253.414) [-248.101] (-249.100) * (-253.750) (-250.069) [-250.252] (-248.831) -- 0:00:16
211000 -- (-249.044) (-254.062) (-249.783) [-249.888] * (-255.656) (-249.350) [-250.357] (-250.403) -- 0:00:16
211500 -- (-250.213) [-253.471] (-248.516) (-251.863) * (-252.155) [-251.657] (-250.399) (-252.055) -- 0:00:16
212000 -- (-248.227) [-249.799] (-249.706) (-251.313) * (-251.466) [-249.597] (-250.465) (-253.259) -- 0:00:16
212500 -- (-250.909) (-249.338) [-250.695] (-251.003) * [-251.090] (-252.032) (-251.933) (-251.801) -- 0:00:16
213000 -- (-249.774) [-249.421] (-251.737) (-250.729) * (-250.517) [-250.804] (-250.255) (-250.740) -- 0:00:16
213500 -- (-254.643) [-251.482] (-249.596) (-250.731) * (-252.239) (-250.070) [-249.589] (-252.470) -- 0:00:16
214000 -- (-253.060) (-251.224) [-249.416] (-251.737) * (-250.292) (-249.329) (-254.162) [-254.028] -- 0:00:16
214500 -- [-251.141] (-251.788) (-250.027) (-249.863) * (-253.648) (-250.104) (-255.041) [-250.752] -- 0:00:15
215000 -- (-252.463) [-251.015] (-250.351) (-250.722) * (-251.389) (-250.310) (-256.763) [-250.144] -- 0:00:15
Average standard deviation of split frequencies: 0.012731
215500 -- (-250.914) (-249.354) (-249.673) [-249.635] * (-251.464) (-249.197) [-252.367] (-253.895) -- 0:00:15
216000 -- (-250.981) [-250.135] (-252.164) (-249.457) * (-252.533) [-248.489] (-253.842) (-255.247) -- 0:00:15
216500 -- [-251.945] (-249.809) (-248.326) (-248.773) * [-249.238] (-252.193) (-254.462) (-251.449) -- 0:00:17
217000 -- [-252.138] (-251.038) (-252.301) (-252.325) * (-249.534) (-251.553) (-251.810) [-248.826] -- 0:00:16
217500 -- [-255.683] (-250.103) (-248.501) (-248.857) * (-253.050) (-249.155) [-251.421] (-249.238) -- 0:00:16
218000 -- [-249.274] (-252.900) (-248.403) (-249.331) * (-250.629) (-250.336) [-249.414] (-248.897) -- 0:00:16
218500 -- (-252.391) (-248.644) [-249.290] (-248.465) * (-252.000) (-251.711) (-250.253) [-249.533] -- 0:00:16
219000 -- (-249.237) (-249.563) [-252.798] (-250.804) * [-250.342] (-249.705) (-252.544) (-251.499) -- 0:00:16
219500 -- (-248.851) (-250.011) [-253.882] (-252.147) * (-251.621) (-249.474) [-251.259] (-249.162) -- 0:00:16
220000 -- (-251.071) (-251.305) (-250.795) [-249.317] * (-251.557) (-255.502) (-252.113) [-249.557] -- 0:00:16
Average standard deviation of split frequencies: 0.013174
220500 -- (-251.263) [-249.202] (-250.256) (-253.405) * [-248.685] (-252.244) (-250.071) (-252.803) -- 0:00:16
221000 -- [-249.596] (-251.736) (-249.579) (-250.525) * (-250.292) [-252.527] (-253.111) (-255.669) -- 0:00:16
221500 -- [-248.695] (-250.001) (-250.211) (-250.659) * (-249.271) [-249.898] (-252.387) (-254.455) -- 0:00:16
222000 -- (-249.636) (-249.815) (-249.095) [-249.064] * (-249.644) (-252.237) (-249.689) [-249.714] -- 0:00:16
222500 -- [-248.964] (-249.215) (-249.756) (-249.371) * [-252.637] (-251.636) (-248.512) (-248.461) -- 0:00:16
223000 -- (-250.082) (-251.735) [-252.695] (-248.812) * (-255.057) [-249.721] (-248.934) (-256.091) -- 0:00:16
223500 -- (-250.654) (-249.496) [-249.450] (-249.969) * [-250.448] (-250.485) (-249.692) (-255.835) -- 0:00:16
224000 -- (-249.792) (-248.072) (-249.773) [-249.932] * (-254.547) (-251.803) (-248.275) [-249.175] -- 0:00:16
224500 -- (-250.030) [-251.345] (-249.481) (-255.371) * (-248.658) [-248.907] (-250.212) (-250.141) -- 0:00:15
225000 -- [-250.538] (-250.741) (-248.536) (-256.001) * (-249.929) (-250.178) [-254.056] (-251.081) -- 0:00:15
Average standard deviation of split frequencies: 0.012052
225500 -- [-253.478] (-250.273) (-252.818) (-250.338) * [-249.667] (-249.201) (-253.116) (-248.613) -- 0:00:15
226000 -- (-251.820) (-250.413) (-250.284) [-249.561] * [-249.316] (-249.980) (-248.813) (-248.854) -- 0:00:15
226500 -- (-259.018) [-251.161] (-252.736) (-250.652) * (-249.053) [-252.953] (-250.562) (-250.755) -- 0:00:15
227000 -- (-248.989) [-250.922] (-254.704) (-252.752) * (-251.903) (-251.409) (-264.236) [-249.725] -- 0:00:15
227500 -- (-250.372) (-250.308) (-249.398) [-251.431] * [-252.524] (-250.223) (-254.173) (-251.906) -- 0:00:15
228000 -- [-249.741] (-251.312) (-249.060) (-250.219) * (-248.664) (-252.780) (-252.350) [-251.146] -- 0:00:15
228500 -- (-249.627) [-250.469] (-249.237) (-249.907) * (-250.777) (-249.654) (-252.336) [-248.928] -- 0:00:15
229000 -- (-254.325) [-250.775] (-252.556) (-249.824) * (-249.940) (-249.214) (-254.681) [-249.947] -- 0:00:15
229500 -- (-249.654) [-249.581] (-250.364) (-249.636) * (-251.528) (-249.386) (-252.188) [-250.955] -- 0:00:15
230000 -- [-248.451] (-252.748) (-249.361) (-248.581) * (-252.669) (-249.851) [-249.930] (-250.040) -- 0:00:15
Average standard deviation of split frequencies: 0.012262
230500 -- [-251.121] (-253.400) (-253.438) (-248.792) * (-249.979) [-251.988] (-249.047) (-250.272) -- 0:00:15
231000 -- (-250.872) (-252.384) [-250.017] (-250.725) * [-249.415] (-250.452) (-249.088) (-252.086) -- 0:00:15
231500 -- [-248.399] (-252.471) (-250.810) (-251.660) * (-250.460) [-250.560] (-252.532) (-253.201) -- 0:00:15
232000 -- (-249.916) [-249.875] (-250.706) (-253.279) * (-249.283) [-251.285] (-252.135) (-252.785) -- 0:00:15
232500 -- (-250.172) [-249.934] (-254.192) (-250.003) * (-251.278) (-249.953) (-249.317) [-249.612] -- 0:00:14
233000 -- (-254.296) (-250.327) [-249.368] (-251.005) * [-249.297] (-250.711) (-250.516) (-250.674) -- 0:00:14
233500 -- (-250.781) (-254.365) (-250.933) [-250.665] * [-250.453] (-250.573) (-249.418) (-248.514) -- 0:00:14
234000 -- (-249.882) (-248.897) (-249.180) [-251.599] * [-248.795] (-250.114) (-252.023) (-251.233) -- 0:00:15
234500 -- (-249.313) (-250.493) [-249.332] (-249.982) * (-248.236) (-253.770) (-251.533) [-250.606] -- 0:00:15
235000 -- (-249.522) [-248.829] (-251.227) (-250.318) * (-248.790) [-249.770] (-251.615) (-250.191) -- 0:00:15
Average standard deviation of split frequencies: 0.012455
235500 -- (-249.275) (-249.700) [-250.310] (-252.186) * [-248.909] (-250.807) (-249.636) (-252.438) -- 0:00:15
236000 -- [-249.423] (-250.512) (-251.053) (-255.382) * [-250.442] (-253.052) (-251.725) (-250.899) -- 0:00:15
236500 -- (-249.038) [-249.931] (-249.352) (-249.948) * [-249.023] (-250.410) (-248.086) (-252.640) -- 0:00:15
237000 -- (-249.478) (-253.598) [-250.780] (-250.878) * [-248.847] (-250.344) (-248.925) (-249.916) -- 0:00:15
237500 -- (-248.769) (-249.276) (-251.351) [-252.963] * [-249.645] (-249.137) (-249.399) (-251.638) -- 0:00:15
238000 -- [-250.002] (-250.207) (-248.799) (-248.778) * [-249.203] (-249.655) (-250.674) (-251.695) -- 0:00:15
238500 -- (-250.311) [-251.156] (-248.590) (-248.957) * (-250.464) (-249.761) [-249.977] (-250.201) -- 0:00:15
239000 -- (-249.343) [-253.214] (-248.562) (-250.033) * (-252.119) (-252.007) [-249.422] (-253.427) -- 0:00:15
239500 -- (-250.823) (-249.383) [-250.030] (-249.430) * (-250.510) (-255.025) [-251.207] (-249.609) -- 0:00:15
240000 -- (-250.377) (-250.678) [-249.951] (-249.939) * [-251.166] (-252.726) (-249.805) (-252.884) -- 0:00:15
Average standard deviation of split frequencies: 0.011140
240500 -- [-252.096] (-249.580) (-250.327) (-250.513) * (-251.610) (-249.410) (-249.533) [-249.207] -- 0:00:15
241000 -- (-250.629) (-252.470) [-248.685] (-249.835) * (-249.879) (-254.234) [-250.442] (-250.997) -- 0:00:15
241500 -- (-252.688) (-250.527) (-253.376) [-252.467] * [-250.568] (-250.368) (-249.818) (-250.061) -- 0:00:14
242000 -- [-251.604] (-249.025) (-249.822) (-252.526) * (-255.357) [-249.575] (-249.227) (-253.823) -- 0:00:14
242500 -- (-249.678) (-250.330) (-248.698) [-249.727] * (-256.580) [-249.918] (-250.594) (-249.062) -- 0:00:14
243000 -- (-251.693) (-249.959) (-250.794) [-253.526] * [-251.776] (-252.487) (-254.938) (-252.504) -- 0:00:14
243500 -- [-251.656] (-248.828) (-249.301) (-254.145) * (-248.695) (-249.199) [-252.442] (-251.055) -- 0:00:14
244000 -- (-251.210) [-250.777] (-250.697) (-251.673) * [-248.524] (-253.821) (-250.033) (-252.972) -- 0:00:14
244500 -- [-249.074] (-248.229) (-251.727) (-253.084) * (-251.231) (-253.430) (-249.632) [-253.565] -- 0:00:14
245000 -- (-248.535) [-249.116] (-249.874) (-250.090) * (-249.795) (-251.185) (-249.862) [-255.034] -- 0:00:14
Average standard deviation of split frequencies: 0.009920
245500 -- (-248.968) (-248.640) (-250.901) [-249.969] * (-252.297) (-250.246) (-248.670) [-249.634] -- 0:00:14
246000 -- [-251.776] (-250.182) (-252.659) (-252.385) * (-253.251) [-248.916] (-249.116) (-252.022) -- 0:00:14
246500 -- (-251.066) (-250.391) (-248.803) [-252.095] * (-250.117) (-248.454) (-251.260) [-250.123] -- 0:00:14
247000 -- [-248.657] (-249.524) (-251.384) (-252.712) * (-249.342) (-253.865) [-249.960] (-251.144) -- 0:00:14
247500 -- (-248.295) (-249.153) (-253.574) [-249.534] * (-251.308) [-249.246] (-252.039) (-249.491) -- 0:00:14
248000 -- (-249.034) [-250.335] (-250.912) (-255.847) * [-250.947] (-250.897) (-252.285) (-251.911) -- 0:00:14
248500 -- (-250.491) (-258.056) [-251.136] (-257.414) * (-253.309) (-250.037) [-254.830] (-251.060) -- 0:00:14
249000 -- (-250.689) (-253.540) [-251.509] (-253.297) * (-249.733) (-249.914) [-251.496] (-250.949) -- 0:00:14
249500 -- [-250.016] (-254.179) (-253.395) (-249.880) * (-256.416) [-250.852] (-248.876) (-253.209) -- 0:00:14
250000 -- (-252.718) (-254.953) [-249.089] (-253.865) * (-254.138) (-252.111) [-250.085] (-252.698) -- 0:00:14
Average standard deviation of split frequencies: 0.010108
250500 -- [-250.467] (-257.627) (-253.097) (-250.793) * [-250.740] (-249.149) (-255.031) (-254.731) -- 0:00:13
251000 -- [-249.574] (-251.595) (-253.049) (-250.045) * (-248.598) [-255.169] (-251.455) (-249.827) -- 0:00:14
251500 -- (-250.323) (-248.641) [-248.690] (-249.230) * [-248.633] (-253.468) (-252.925) (-248.577) -- 0:00:14
252000 -- [-249.633] (-250.370) (-249.629) (-251.439) * (-248.903) [-250.229] (-251.770) (-250.931) -- 0:00:14
252500 -- [-249.718] (-248.488) (-252.621) (-250.776) * [-251.466] (-252.525) (-253.579) (-252.089) -- 0:00:14
253000 -- (-249.003) [-250.242] (-250.432) (-250.470) * (-250.824) [-251.374] (-251.164) (-249.494) -- 0:00:14
253500 -- (-252.423) [-249.722] (-249.603) (-248.874) * (-255.103) [-249.364] (-250.636) (-249.608) -- 0:00:14
254000 -- (-251.847) (-250.608) [-248.536] (-249.054) * [-254.195] (-250.981) (-250.870) (-249.509) -- 0:00:14
254500 -- (-249.829) (-252.677) [-251.132] (-248.198) * (-249.030) (-249.375) [-250.792] (-249.642) -- 0:00:14
255000 -- (-249.890) (-251.952) [-252.248] (-250.389) * [-252.065] (-250.761) (-250.120) (-249.219) -- 0:00:14
Average standard deviation of split frequencies: 0.010832
255500 -- (-253.697) (-252.445) [-250.342] (-251.532) * [-250.277] (-249.373) (-249.955) (-250.670) -- 0:00:14
256000 -- [-250.354] (-252.299) (-250.742) (-251.751) * (-249.090) (-249.225) (-250.542) [-249.551] -- 0:00:14
256500 -- (-250.538) (-249.772) (-254.594) [-249.823] * [-248.755] (-249.420) (-254.177) (-251.175) -- 0:00:14
257000 -- (-249.575) (-249.558) [-252.680] (-251.381) * (-249.308) [-249.012] (-251.207) (-248.892) -- 0:00:14
257500 -- (-252.020) (-248.688) [-249.898] (-251.252) * [-249.229] (-249.375) (-248.467) (-249.667) -- 0:00:14
258000 -- (-252.373) (-251.058) [-250.784] (-248.880) * [-249.550] (-250.010) (-252.635) (-249.663) -- 0:00:14
258500 -- (-249.445) (-249.634) [-251.945] (-250.341) * (-250.176) (-249.020) [-249.961] (-249.373) -- 0:00:14
259000 -- (-253.489) (-250.768) [-253.984] (-250.446) * (-249.283) (-249.128) (-250.076) [-249.457] -- 0:00:13
259500 -- (-249.628) (-250.660) [-251.361] (-250.410) * (-249.640) (-251.280) [-251.224] (-249.929) -- 0:00:13
260000 -- [-249.818] (-251.223) (-250.322) (-252.106) * [-248.982] (-250.094) (-249.241) (-248.283) -- 0:00:13
Average standard deviation of split frequencies: 0.011642
260500 -- (-248.880) (-252.011) (-249.678) [-251.276] * (-249.266) [-249.278] (-250.197) (-250.030) -- 0:00:13
261000 -- (-251.770) (-248.831) (-252.807) [-249.168] * (-254.648) [-250.260] (-251.915) (-253.866) -- 0:00:13
261500 -- (-248.963) (-251.114) [-251.135] (-249.930) * (-249.246) (-253.233) [-249.889] (-253.891) -- 0:00:13
262000 -- [-248.288] (-250.339) (-250.143) (-250.177) * (-248.913) [-251.281] (-249.278) (-252.486) -- 0:00:13
262500 -- (-248.226) [-249.579] (-252.122) (-249.622) * (-251.544) [-250.054] (-248.921) (-251.482) -- 0:00:13
263000 -- (-248.979) (-252.405) (-251.099) [-249.957] * (-251.141) (-249.082) [-250.277] (-249.800) -- 0:00:13
263500 -- [-249.569] (-256.225) (-251.376) (-252.807) * (-252.578) (-248.503) (-250.550) [-251.928] -- 0:00:13
264000 -- [-248.720] (-252.687) (-251.371) (-251.806) * (-251.636) [-251.768] (-252.361) (-249.154) -- 0:00:13
264500 -- (-251.332) (-250.656) (-250.951) [-249.397] * [-250.263] (-251.844) (-253.876) (-248.451) -- 0:00:13
265000 -- (-250.614) (-249.308) [-250.594] (-254.277) * (-253.717) [-250.959] (-250.048) (-254.033) -- 0:00:13
Average standard deviation of split frequencies: 0.010744
265500 -- (-250.020) (-251.311) (-249.416) [-250.622] * (-251.018) [-249.177] (-249.882) (-250.621) -- 0:00:13
266000 -- [-249.396] (-250.668) (-248.244) (-249.837) * (-249.032) (-252.413) (-250.061) [-248.958] -- 0:00:13
266500 -- (-249.348) (-253.843) [-253.436] (-251.112) * (-250.805) (-248.153) (-253.406) [-250.151] -- 0:00:13
267000 -- (-250.677) (-258.608) [-248.751] (-248.934) * (-253.633) (-249.358) [-251.557] (-250.919) -- 0:00:13
267500 -- (-248.887) (-253.023) [-248.802] (-248.274) * (-252.897) [-249.339] (-249.868) (-253.120) -- 0:00:13
268000 -- (-252.030) [-250.492] (-252.554) (-251.246) * (-250.595) [-249.293] (-250.821) (-249.030) -- 0:00:12
268500 -- (-252.893) [-251.715] (-249.572) (-251.953) * (-255.491) [-249.880] (-250.209) (-251.632) -- 0:00:13
269000 -- [-251.500] (-249.679) (-248.974) (-249.601) * (-254.058) [-249.043] (-249.730) (-250.386) -- 0:00:13
269500 -- (-253.285) [-249.602] (-249.203) (-251.237) * (-254.299) (-253.016) [-250.246] (-251.992) -- 0:00:13
270000 -- (-252.022) [-253.562] (-256.037) (-251.792) * (-250.153) (-252.683) (-253.603) [-249.962] -- 0:00:13
Average standard deviation of split frequencies: 0.009252
270500 -- (-249.661) [-251.727] (-250.662) (-250.267) * [-250.232] (-250.417) (-250.486) (-255.177) -- 0:00:13
271000 -- [-250.251] (-251.989) (-250.595) (-248.565) * (-254.807) (-250.071) (-254.154) [-249.200] -- 0:00:13
271500 -- (-249.999) (-254.471) (-252.562) [-250.489] * (-252.701) [-253.771] (-250.480) (-251.112) -- 0:00:13
272000 -- (-250.640) [-250.096] (-249.146) (-251.952) * (-250.965) [-251.946] (-251.016) (-250.170) -- 0:00:13
272500 -- (-252.038) (-250.638) (-250.438) [-249.284] * (-248.563) (-250.079) (-250.922) [-250.225] -- 0:00:13
273000 -- (-248.942) (-253.624) (-249.152) [-248.758] * (-248.735) (-249.365) (-248.874) [-251.049] -- 0:00:13
273500 -- (-248.118) (-249.220) [-249.579] (-250.297) * (-248.716) (-249.494) (-250.238) [-251.955] -- 0:00:13
274000 -- [-249.339] (-250.206) (-251.132) (-248.266) * (-253.327) (-249.581) [-252.251] (-253.729) -- 0:00:13
274500 -- (-250.942) (-250.125) [-249.693] (-250.176) * (-252.973) (-250.180) (-251.018) [-249.515] -- 0:00:13
275000 -- (-249.473) (-249.251) (-250.218) [-249.886] * (-252.543) [-250.693] (-252.492) (-251.008) -- 0:00:13
Average standard deviation of split frequencies: 0.009394
275500 -- (-248.779) [-252.461] (-249.187) (-250.904) * (-250.552) (-252.542) (-249.229) [-252.477] -- 0:00:13
276000 -- (-249.241) (-248.912) [-248.262] (-248.767) * [-250.002] (-252.151) (-249.955) (-250.746) -- 0:00:12
276500 -- (-248.918) [-253.104] (-249.529) (-249.525) * (-250.608) (-251.313) (-250.542) [-248.198] -- 0:00:12
277000 -- [-250.954] (-250.082) (-251.272) (-251.663) * (-249.595) [-251.163] (-249.310) (-248.393) -- 0:00:12
277500 -- (-249.402) [-249.303] (-249.391) (-249.907) * (-250.929) (-249.422) [-250.177] (-248.859) -- 0:00:12
278000 -- (-249.871) (-249.428) [-248.621] (-250.628) * (-250.414) (-252.641) [-249.224] (-249.737) -- 0:00:12
278500 -- (-250.057) (-253.289) (-248.720) [-249.400] * (-253.544) (-249.359) [-250.289] (-251.070) -- 0:00:12
279000 -- (-249.348) (-252.954) [-248.974] (-248.625) * [-249.893] (-249.656) (-249.636) (-250.443) -- 0:00:12
279500 -- [-248.584] (-249.259) (-250.129) (-249.091) * (-250.384) (-249.781) [-251.245] (-250.533) -- 0:00:12
280000 -- (-256.788) (-250.461) [-255.105] (-251.296) * (-250.345) [-249.768] (-249.186) (-252.568) -- 0:00:12
Average standard deviation of split frequencies: 0.008923
280500 -- (-253.080) (-250.436) (-255.115) [-249.861] * (-251.309) [-249.341] (-250.305) (-249.452) -- 0:00:12
281000 -- (-258.097) [-249.832] (-252.138) (-250.176) * (-249.769) (-251.761) (-251.436) [-249.565] -- 0:00:12
281500 -- [-251.075] (-250.771) (-249.553) (-255.452) * (-252.123) [-249.389] (-251.568) (-250.327) -- 0:00:12
282000 -- (-252.482) (-249.412) [-251.982] (-252.212) * (-249.287) [-249.055] (-252.261) (-251.553) -- 0:00:12
282500 -- (-251.987) (-250.373) [-249.238] (-252.917) * (-250.926) [-251.848] (-253.231) (-252.423) -- 0:00:12
283000 -- [-251.302] (-254.665) (-249.490) (-250.024) * [-249.746] (-251.088) (-252.397) (-251.245) -- 0:00:12
283500 -- (-250.848) [-252.463] (-251.251) (-251.679) * [-251.002] (-252.266) (-250.777) (-250.478) -- 0:00:12
284000 -- (-250.569) [-249.207] (-249.986) (-250.020) * (-251.002) (-252.071) [-248.772] (-251.439) -- 0:00:12
284500 -- (-251.203) [-248.900] (-254.160) (-252.123) * (-251.518) (-249.737) [-248.852] (-253.914) -- 0:00:12
285000 -- [-254.561] (-251.186) (-252.477) (-251.468) * (-248.842) (-252.404) (-250.694) [-249.863] -- 0:00:12
Average standard deviation of split frequencies: 0.009065
285500 -- (-250.626) (-250.561) [-249.772] (-248.341) * [-250.644] (-248.685) (-249.312) (-249.653) -- 0:00:12
286000 -- [-250.263] (-249.185) (-249.764) (-250.074) * (-248.900) [-249.712] (-249.096) (-253.973) -- 0:00:12
286500 -- [-249.826] (-255.386) (-256.373) (-250.023) * [-249.952] (-249.081) (-251.680) (-249.064) -- 0:00:12
287000 -- (-254.431) (-251.978) (-256.255) [-249.838] * (-248.609) [-251.569] (-250.059) (-249.712) -- 0:00:12
287500 -- (-252.352) (-249.282) [-252.642] (-248.722) * [-252.675] (-253.114) (-252.904) (-248.778) -- 0:00:12
288000 -- (-249.420) (-253.492) [-249.374] (-251.017) * (-250.481) (-256.183) (-252.883) [-249.987] -- 0:00:12
288500 -- (-249.877) (-252.160) (-249.216) [-249.995] * (-250.090) (-250.440) (-249.848) [-250.092] -- 0:00:12
289000 -- [-250.643] (-252.067) (-251.012) (-250.518) * [-250.543] (-252.090) (-250.512) (-248.597) -- 0:00:12
289500 -- (-250.411) [-250.741] (-249.409) (-248.391) * (-252.212) [-253.121] (-249.483) (-248.885) -- 0:00:12
290000 -- (-251.934) (-249.244) (-253.878) [-250.942] * [-250.679] (-250.309) (-249.412) (-249.024) -- 0:00:12
Average standard deviation of split frequencies: 0.009528
290500 -- (-254.002) (-249.883) [-253.942] (-249.497) * [-251.009] (-251.943) (-248.733) (-250.545) -- 0:00:12
291000 -- (-249.815) (-249.328) (-251.749) [-254.093] * (-249.643) (-250.889) [-249.820] (-252.176) -- 0:00:12
291500 -- (-249.473) [-249.867] (-254.069) (-250.343) * (-250.350) (-248.766) (-250.558) [-249.715] -- 0:00:12
292000 -- (-249.431) (-250.084) (-252.355) [-251.192] * (-252.444) (-248.639) (-250.360) [-249.465] -- 0:00:12
292500 -- [-251.091] (-249.030) (-252.039) (-253.132) * [-252.291] (-250.074) (-248.600) (-253.366) -- 0:00:12
293000 -- [-249.437] (-252.479) (-252.581) (-249.512) * (-250.811) (-250.145) (-248.523) [-248.663] -- 0:00:12
293500 -- (-252.820) (-252.713) (-250.733) [-250.625] * (-249.069) (-250.066) [-249.651] (-250.186) -- 0:00:11
294000 -- [-250.128] (-249.822) (-249.561) (-254.201) * (-253.317) (-251.367) [-251.057] (-249.821) -- 0:00:11
294500 -- (-251.522) (-249.177) [-249.420] (-249.461) * (-250.916) (-250.638) (-250.796) [-250.706] -- 0:00:11
295000 -- (-249.734) (-249.266) (-249.442) [-251.169] * (-251.679) (-248.838) [-249.034] (-250.132) -- 0:00:11
Average standard deviation of split frequencies: 0.009854
295500 -- (-253.389) (-250.454) (-249.792) [-250.237] * [-251.003] (-248.872) (-254.133) (-251.250) -- 0:00:11
296000 -- (-249.592) [-249.752] (-251.473) (-251.312) * (-250.079) [-249.279] (-254.711) (-249.324) -- 0:00:11
296500 -- (-250.378) [-248.888] (-248.856) (-250.065) * [-253.722] (-249.353) (-252.107) (-251.787) -- 0:00:11
297000 -- [-249.570] (-248.564) (-252.748) (-250.369) * (-249.563) (-253.919) [-250.010] (-251.989) -- 0:00:11
297500 -- (-250.638) (-249.249) (-251.761) [-251.788] * (-250.054) [-249.590] (-248.592) (-251.634) -- 0:00:11
298000 -- (-249.198) (-249.764) [-250.796] (-248.937) * [-249.681] (-249.289) (-253.331) (-248.876) -- 0:00:11
298500 -- (-248.493) (-249.025) (-249.993) [-250.724] * (-251.514) [-249.435] (-249.964) (-250.012) -- 0:00:11
299000 -- [-249.829] (-249.160) (-249.342) (-248.809) * (-249.997) [-249.069] (-250.539) (-250.120) -- 0:00:11
299500 -- (-251.573) (-252.653) [-249.426] (-249.574) * (-249.586) (-249.421) [-253.348] (-251.346) -- 0:00:11
300000 -- [-253.232] (-250.378) (-252.899) (-249.735) * [-249.608] (-250.167) (-250.053) (-253.286) -- 0:00:11
Average standard deviation of split frequencies: 0.009407
300500 -- (-249.673) (-251.045) [-249.883] (-253.635) * (-249.743) (-249.902) [-249.950] (-253.952) -- 0:00:11
301000 -- (-252.429) [-250.226] (-251.835) (-251.199) * (-250.949) [-248.219] (-250.412) (-249.351) -- 0:00:11
301500 -- (-254.062) (-250.425) (-254.023) [-254.653] * [-250.415] (-250.068) (-250.146) (-249.760) -- 0:00:11
302000 -- (-250.456) (-252.158) (-250.573) [-248.885] * [-250.641] (-251.506) (-249.342) (-249.289) -- 0:00:11
302500 -- [-252.906] (-248.456) (-250.030) (-252.194) * (-257.633) (-251.980) (-249.407) [-248.804] -- 0:00:11
303000 -- (-250.282) (-251.037) (-254.867) [-250.136] * (-252.027) [-251.378] (-249.294) (-249.522) -- 0:00:11
303500 -- (-250.426) [-249.879] (-254.301) (-248.409) * (-252.386) [-251.538] (-250.533) (-254.275) -- 0:00:11
304000 -- (-249.034) (-252.647) [-251.813] (-249.201) * (-252.160) (-251.712) [-251.995] (-250.341) -- 0:00:11
304500 -- [-252.417] (-252.979) (-248.223) (-249.173) * [-248.814] (-249.594) (-250.196) (-251.302) -- 0:00:11
305000 -- (-250.935) (-248.370) [-260.422] (-250.511) * (-248.732) (-249.685) (-249.405) [-251.732] -- 0:00:11
Average standard deviation of split frequencies: 0.009243
305500 -- [-249.222] (-250.786) (-251.537) (-249.559) * (-251.236) [-251.997] (-249.610) (-252.984) -- 0:00:11
306000 -- (-251.605) [-250.667] (-253.915) (-249.859) * (-248.030) [-250.438] (-250.408) (-252.268) -- 0:00:11
306500 -- (-249.920) [-251.035] (-250.532) (-249.748) * (-248.594) (-257.132) (-250.209) [-251.386] -- 0:00:11
307000 -- (-250.151) [-249.675] (-250.980) (-250.018) * (-253.500) [-249.620] (-252.203) (-254.097) -- 0:00:11
307500 -- (-249.096) (-251.822) (-254.179) [-250.311] * (-250.644) (-248.946) [-250.458] (-249.506) -- 0:00:11
308000 -- [-253.456] (-248.581) (-251.427) (-249.527) * [-252.085] (-249.760) (-249.893) (-250.595) -- 0:00:11
308500 -- (-251.644) (-250.086) (-252.459) [-249.267] * [-254.749] (-249.788) (-250.425) (-250.775) -- 0:00:11
309000 -- (-251.491) [-251.997] (-250.249) (-249.898) * (-257.070) (-253.401) [-250.537] (-254.007) -- 0:00:11
309500 -- (-248.478) (-253.424) (-249.510) [-249.466] * [-249.570] (-248.456) (-248.891) (-249.018) -- 0:00:11
310000 -- [-248.832] (-250.169) (-250.129) (-250.038) * (-251.085) [-251.320] (-248.493) (-248.750) -- 0:00:11
Average standard deviation of split frequencies: 0.009199
310500 -- (-248.496) [-251.110] (-248.976) (-248.294) * (-249.863) (-249.252) (-248.996) [-250.966] -- 0:00:10
311000 -- (-250.197) [-249.154] (-249.598) (-253.413) * [-249.933] (-249.624) (-250.342) (-250.823) -- 0:00:10
311500 -- (-248.960) (-249.339) (-251.691) [-249.271] * (-250.199) [-249.047] (-253.174) (-249.272) -- 0:00:10
312000 -- (-250.434) (-250.517) (-249.855) [-249.359] * [-250.193] (-251.343) (-249.688) (-254.025) -- 0:00:10
312500 -- (-249.068) [-248.577] (-251.488) (-249.243) * (-248.683) [-250.672] (-250.725) (-254.561) -- 0:00:10
313000 -- (-249.357) [-249.684] (-253.365) (-250.530) * (-249.885) (-251.371) [-250.402] (-254.346) -- 0:00:10
313500 -- [-250.056] (-253.534) (-249.062) (-249.768) * (-249.847) (-251.337) [-249.538] (-253.016) -- 0:00:10
314000 -- (-248.946) (-251.152) [-250.084] (-251.419) * [-251.004] (-248.783) (-249.318) (-250.017) -- 0:00:10
314500 -- (-249.952) (-252.628) [-250.003] (-249.108) * (-250.513) (-250.046) [-249.470] (-249.714) -- 0:00:10
315000 -- [-248.920] (-249.786) (-248.861) (-249.120) * (-249.627) (-250.959) (-248.631) [-252.607] -- 0:00:10
Average standard deviation of split frequencies: 0.009417
315500 -- (-249.713) (-249.011) [-248.313] (-249.919) * [-252.942] (-250.137) (-248.764) (-250.286) -- 0:00:10
316000 -- [-249.205] (-251.324) (-248.753) (-248.952) * (-250.174) [-252.414] (-250.140) (-249.924) -- 0:00:10
316500 -- (-252.667) [-251.130] (-250.067) (-252.677) * (-250.609) (-253.647) [-249.121] (-255.040) -- 0:00:10
317000 -- (-253.795) (-253.904) (-252.131) [-249.540] * [-250.869] (-252.691) (-249.204) (-249.036) -- 0:00:10
317500 -- [-250.497] (-252.238) (-248.238) (-250.296) * (-251.697) (-252.139) (-250.599) [-248.629] -- 0:00:10
318000 -- (-249.413) (-253.145) (-249.030) [-249.970] * (-252.032) (-253.854) (-252.235) [-249.387] -- 0:00:10
318500 -- (-249.960) (-249.274) (-249.752) [-249.658] * (-249.423) (-249.776) (-252.763) [-249.906] -- 0:00:10
319000 -- [-249.535] (-249.715) (-249.658) (-250.731) * (-250.005) (-250.926) [-249.812] (-248.623) -- 0:00:10
319500 -- [-253.362] (-250.202) (-250.593) (-251.361) * [-250.195] (-250.082) (-249.719) (-251.983) -- 0:00:10
320000 -- (-248.469) [-249.463] (-251.994) (-249.326) * (-253.153) [-249.661] (-249.945) (-251.909) -- 0:00:10
Average standard deviation of split frequencies: 0.010723
320500 -- (-250.376) (-250.877) [-254.598] (-249.693) * (-249.422) [-250.163] (-248.804) (-250.759) -- 0:00:10
321000 -- [-252.326] (-251.723) (-250.888) (-250.311) * [-252.533] (-248.441) (-251.013) (-250.312) -- 0:00:10
321500 -- (-250.911) [-250.494] (-252.338) (-248.479) * (-248.612) [-249.852] (-250.205) (-250.858) -- 0:00:10
322000 -- (-251.238) [-251.475] (-251.276) (-255.513) * (-248.540) (-250.173) (-248.745) [-248.912] -- 0:00:10
322500 -- (-250.500) (-249.251) [-249.938] (-251.596) * (-250.590) (-249.585) (-248.534) [-249.251] -- 0:00:10
323000 -- [-248.654] (-248.411) (-250.017) (-249.577) * [-248.730] (-256.875) (-251.351) (-248.213) -- 0:00:10
323500 -- (-251.320) (-250.448) [-248.502] (-248.933) * (-248.355) (-249.340) [-253.865] (-248.939) -- 0:00:10
324000 -- (-250.555) [-250.420] (-248.752) (-250.685) * (-251.171) (-250.434) [-250.226] (-249.024) -- 0:00:10
324500 -- [-251.641] (-248.755) (-249.841) (-251.120) * [-249.751] (-256.708) (-252.914) (-248.622) -- 0:00:10
325000 -- [-248.663] (-250.546) (-254.601) (-252.326) * (-253.713) (-250.123) (-250.951) [-249.012] -- 0:00:10
Average standard deviation of split frequencies: 0.011809
325500 -- [-248.728] (-252.561) (-252.627) (-254.178) * (-252.387) (-251.627) [-252.625] (-248.791) -- 0:00:10
326000 -- (-253.518) [-249.429] (-250.947) (-252.445) * [-256.229] (-252.134) (-249.429) (-249.919) -- 0:00:10
326500 -- (-248.957) (-256.081) [-252.402] (-249.353) * (-250.070) [-249.599] (-248.387) (-249.194) -- 0:00:10
327000 -- (-249.424) (-250.108) (-250.938) [-254.929] * (-249.326) (-249.898) (-250.078) [-248.916] -- 0:00:10
327500 -- (-248.647) (-250.383) (-251.278) [-252.851] * (-249.785) (-251.050) [-249.701] (-252.182) -- 0:00:10
328000 -- (-250.209) [-248.399] (-250.658) (-248.707) * (-249.991) [-249.739] (-251.895) (-251.187) -- 0:00:09
328500 -- (-252.078) (-248.444) (-252.632) [-248.827] * (-249.181) (-251.493) [-249.758] (-251.327) -- 0:00:09
329000 -- [-249.720] (-250.981) (-251.979) (-250.748) * (-250.276) (-252.565) [-250.229] (-260.325) -- 0:00:09
329500 -- (-250.394) (-249.109) (-251.167) [-248.641] * (-251.134) (-250.003) [-249.110] (-254.022) -- 0:00:09
330000 -- (-252.950) (-253.575) [-250.954] (-248.486) * [-250.302] (-248.813) (-254.283) (-249.090) -- 0:00:09
Average standard deviation of split frequencies: 0.011573
330500 -- (-254.182) [-249.685] (-250.731) (-249.322) * [-250.417] (-250.042) (-249.084) (-248.928) -- 0:00:09
331000 -- (-250.544) (-255.097) [-249.762] (-249.887) * (-254.904) (-252.652) (-250.728) [-250.101] -- 0:00:09
331500 -- (-249.283) [-249.350] (-249.997) (-250.293) * (-248.886) (-254.459) (-250.836) [-249.907] -- 0:00:09
332000 -- [-249.830] (-252.612) (-249.543) (-248.907) * (-252.098) (-253.989) [-250.770] (-249.862) -- 0:00:09
332500 -- (-251.489) [-250.207] (-248.998) (-248.666) * (-250.203) (-255.533) [-250.067] (-250.317) -- 0:00:09
333000 -- (-252.227) (-252.710) [-255.285] (-250.077) * (-249.815) (-252.994) [-250.324] (-251.757) -- 0:00:09
333500 -- (-258.477) (-248.793) (-250.414) [-249.505] * [-249.180] (-252.391) (-249.592) (-254.456) -- 0:00:09
334000 -- (-252.488) (-249.647) (-251.021) [-249.455] * (-249.374) (-250.252) (-248.596) [-248.205] -- 0:00:09
334500 -- (-251.912) (-249.287) [-249.323] (-252.512) * (-249.048) [-250.474] (-252.131) (-251.420) -- 0:00:09
335000 -- (-248.337) [-250.780] (-248.999) (-250.285) * (-252.850) [-250.422] (-252.585) (-252.794) -- 0:00:09
Average standard deviation of split frequencies: 0.011847
335500 -- (-248.446) [-251.326] (-253.168) (-251.498) * (-252.193) [-250.581] (-249.300) (-248.532) -- 0:00:09
336000 -- (-249.345) (-252.342) [-249.191] (-249.114) * (-253.187) (-250.804) (-251.673) [-249.398] -- 0:00:09
336500 -- (-252.972) (-252.400) (-248.264) [-249.453] * (-249.869) [-250.316] (-250.116) (-249.422) -- 0:00:09
337000 -- (-256.486) [-249.200] (-250.990) (-250.886) * (-251.259) [-254.657] (-250.046) (-249.115) -- 0:00:09
337500 -- (-252.020) (-249.706) [-252.628] (-250.042) * (-249.683) [-249.458] (-252.567) (-251.988) -- 0:00:09
338000 -- (-250.396) (-251.982) [-249.193] (-255.128) * (-250.202) [-250.488] (-250.387) (-250.189) -- 0:00:09
338500 -- (-257.616) (-251.811) [-252.665] (-249.638) * (-250.971) [-249.387] (-250.484) (-251.403) -- 0:00:09
339000 -- (-253.983) (-255.006) (-251.831) [-250.513] * (-252.405) [-252.636] (-251.093) (-249.951) -- 0:00:09
339500 -- [-253.285] (-248.713) (-250.947) (-250.828) * (-248.861) (-249.539) [-249.048] (-252.795) -- 0:00:09
340000 -- (-248.897) (-249.151) (-258.028) [-249.147] * [-249.640] (-255.070) (-250.060) (-249.653) -- 0:00:09
Average standard deviation of split frequencies: 0.011762
340500 -- (-249.583) (-250.941) (-254.520) [-248.761] * (-251.894) [-251.893] (-250.355) (-255.673) -- 0:00:09
341000 -- (-249.612) [-249.403] (-254.170) (-250.680) * (-248.541) (-251.533) [-250.507] (-252.128) -- 0:00:09
341500 -- (-252.221) [-248.714] (-250.709) (-252.643) * (-249.818) [-251.159] (-249.750) (-254.758) -- 0:00:09
342000 -- (-251.694) (-249.677) [-252.731] (-253.199) * (-249.592) (-249.726) [-251.122] (-250.717) -- 0:00:09
342500 -- (-248.584) (-253.011) (-249.967) [-250.353] * [-251.250] (-249.748) (-253.014) (-253.372) -- 0:00:09
343000 -- (-253.281) (-251.013) (-249.621) [-249.187] * (-249.436) (-248.978) (-249.105) [-250.963] -- 0:00:09
343500 -- (-253.910) (-249.309) [-250.039] (-249.329) * (-253.809) (-252.451) (-249.483) [-250.218] -- 0:00:09
344000 -- (-252.877) [-250.756] (-251.091) (-249.650) * [-252.188] (-250.028) (-249.141) (-250.249) -- 0:00:09
344500 -- (-251.672) (-250.201) (-255.501) [-250.412] * (-250.733) [-250.200] (-251.192) (-248.333) -- 0:00:09
345000 -- [-250.091] (-252.026) (-262.109) (-250.101) * (-251.028) [-250.129] (-250.341) (-249.422) -- 0:00:08
Average standard deviation of split frequencies: 0.011202
345500 -- (-249.809) [-251.723] (-259.286) (-249.821) * (-254.821) [-249.545] (-250.681) (-248.731) -- 0:00:08
346000 -- (-249.082) (-257.747) (-253.819) [-251.089] * [-249.426] (-250.607) (-250.702) (-255.958) -- 0:00:08
346500 -- (-249.884) (-251.837) (-252.165) [-248.984] * [-249.888] (-252.266) (-248.678) (-252.600) -- 0:00:08
347000 -- (-250.042) [-255.309] (-250.674) (-249.312) * [-250.147] (-251.800) (-251.174) (-251.517) -- 0:00:08
347500 -- (-250.422) [-251.667] (-248.632) (-251.766) * (-250.033) (-249.306) [-249.390] (-250.079) -- 0:00:08
348000 -- (-254.253) (-252.148) (-252.632) [-250.647] * (-252.509) [-250.074] (-249.257) (-252.856) -- 0:00:08
348500 -- (-250.462) (-253.580) [-248.624] (-249.148) * (-249.481) (-250.261) (-250.247) [-249.250] -- 0:00:08
349000 -- [-249.066] (-248.462) (-250.699) (-250.454) * (-250.245) (-251.763) (-252.572) [-249.875] -- 0:00:08
349500 -- (-248.970) [-248.771] (-253.523) (-250.053) * (-251.739) (-255.331) [-250.534] (-249.406) -- 0:00:08
350000 -- (-251.790) (-251.801) (-249.327) [-252.374] * (-249.135) [-251.786] (-253.143) (-250.339) -- 0:00:08
Average standard deviation of split frequencies: 0.011501
350500 -- [-251.855] (-248.770) (-251.524) (-250.127) * (-250.921) (-252.223) [-252.918] (-250.780) -- 0:00:08
351000 -- [-248.175] (-249.488) (-248.893) (-251.004) * (-252.557) (-253.307) [-249.693] (-251.952) -- 0:00:08
351500 -- [-249.121] (-249.009) (-249.331) (-252.876) * [-249.927] (-251.333) (-251.486) (-252.616) -- 0:00:08
352000 -- (-252.103) [-249.067] (-251.208) (-251.685) * (-254.833) [-249.628] (-249.665) (-250.435) -- 0:00:08
352500 -- (-250.904) [-249.208] (-252.005) (-253.805) * (-250.200) [-252.026] (-248.984) (-251.100) -- 0:00:08
353000 -- (-251.420) [-249.404] (-250.976) (-252.941) * (-253.706) [-254.099] (-250.475) (-258.587) -- 0:00:08
353500 -- (-250.084) (-253.044) (-248.378) [-250.337] * (-249.407) [-251.832] (-255.209) (-255.836) -- 0:00:08
354000 -- (-249.574) [-251.581] (-250.565) (-248.596) * (-252.866) (-253.902) [-250.015] (-253.800) -- 0:00:08
354500 -- (-248.977) (-251.370) (-251.440) [-249.483] * (-252.015) [-248.584] (-252.301) (-251.142) -- 0:00:08
355000 -- (-249.133) [-250.608] (-250.546) (-250.295) * (-252.195) [-248.202] (-250.020) (-248.801) -- 0:00:08
Average standard deviation of split frequencies: 0.011255
355500 -- (-254.201) (-249.459) (-253.975) [-248.802] * (-249.385) [-251.560] (-249.076) (-249.930) -- 0:00:08
356000 -- (-250.347) (-251.621) (-249.452) [-249.874] * [-253.035] (-251.573) (-251.152) (-250.592) -- 0:00:08
356500 -- (-250.473) [-251.473] (-250.905) (-250.529) * (-251.473) (-253.576) (-250.712) [-253.075] -- 0:00:08
357000 -- (-251.512) (-250.051) [-254.079] (-253.337) * [-248.666] (-252.124) (-250.989) (-250.292) -- 0:00:08
357500 -- [-249.592] (-249.871) (-250.146) (-255.966) * (-250.129) (-251.840) [-255.025] (-248.307) -- 0:00:08
358000 -- (-254.011) (-249.965) (-249.561) [-252.050] * (-250.717) (-249.627) (-251.137) [-249.079] -- 0:00:08
358500 -- (-249.249) (-252.838) [-249.019] (-250.296) * (-257.853) (-253.682) (-252.406) [-249.768] -- 0:00:08
359000 -- (-251.309) (-251.042) [-249.785] (-248.942) * (-248.754) (-249.385) (-257.963) [-249.810] -- 0:00:08
359500 -- (-253.422) (-250.514) (-250.318) [-250.103] * [-251.512] (-248.441) (-250.562) (-250.213) -- 0:00:08
360000 -- (-249.094) (-248.693) [-251.589] (-248.734) * (-248.743) [-250.654] (-256.310) (-250.436) -- 0:00:08
Average standard deviation of split frequencies: 0.011456
360500 -- (-249.854) (-250.394) (-250.016) [-251.361] * (-251.778) (-248.291) (-249.490) [-249.413] -- 0:00:08
361000 -- (-250.639) (-252.056) (-248.973) [-248.638] * (-250.185) (-249.405) (-250.801) [-248.619] -- 0:00:08
361500 -- (-254.901) (-254.286) [-250.575] (-251.388) * (-249.452) (-249.691) (-257.182) [-250.953] -- 0:00:08
362000 -- (-252.341) (-251.096) [-249.382] (-250.196) * (-248.914) [-249.769] (-250.137) (-252.302) -- 0:00:08
362500 -- [-249.099] (-251.776) (-249.099) (-252.584) * [-249.170] (-248.788) (-251.230) (-251.132) -- 0:00:07
363000 -- [-250.027] (-250.839) (-252.354) (-248.863) * [-253.532] (-250.797) (-250.127) (-254.441) -- 0:00:07
363500 -- (-248.340) (-248.582) (-251.170) [-249.671] * [-248.769] (-253.192) (-254.221) (-249.612) -- 0:00:07
364000 -- (-252.150) (-252.840) (-250.468) [-251.479] * [-248.626] (-252.051) (-251.591) (-250.925) -- 0:00:07
364500 -- (-255.055) (-259.563) (-250.876) [-251.440] * (-249.228) (-256.637) [-252.276] (-251.465) -- 0:00:07
365000 -- [-250.025] (-259.844) (-250.691) (-254.027) * [-248.842] (-249.842) (-250.303) (-248.814) -- 0:00:07
Average standard deviation of split frequencies: 0.011306
365500 -- (-251.429) [-250.249] (-252.897) (-251.922) * (-249.202) (-249.285) (-251.693) [-251.522] -- 0:00:07
366000 -- (-249.888) (-252.167) [-249.088] (-249.662) * [-252.318] (-249.859) (-251.295) (-251.869) -- 0:00:07
366500 -- (-251.372) [-253.263] (-252.975) (-248.544) * (-252.281) [-249.044] (-253.714) (-250.138) -- 0:00:07
367000 -- (-250.646) [-251.712] (-249.202) (-249.800) * (-250.049) (-250.423) (-249.035) [-249.609] -- 0:00:07
367500 -- (-249.716) (-251.381) (-250.620) [-254.548] * (-250.515) [-250.521] (-251.172) (-252.097) -- 0:00:07
368000 -- (-248.386) (-251.172) (-252.721) [-256.300] * (-248.471) (-250.953) [-249.916] (-248.218) -- 0:00:07
368500 -- [-249.425] (-249.337) (-250.530) (-252.564) * (-248.499) (-251.013) [-249.848] (-249.573) -- 0:00:07
369000 -- (-251.136) (-249.323) (-248.764) [-249.474] * (-249.490) (-248.661) [-251.629] (-250.839) -- 0:00:07
369500 -- [-251.832] (-252.946) (-249.745) (-252.086) * [-250.278] (-248.341) (-250.656) (-251.216) -- 0:00:07
370000 -- (-250.925) (-249.434) [-248.382] (-251.485) * (-248.979) [-249.203] (-249.872) (-251.001) -- 0:00:07
Average standard deviation of split frequencies: 0.011941
370500 -- (-250.258) (-250.707) [-250.561] (-249.913) * (-248.142) [-250.296] (-249.008) (-248.454) -- 0:00:07
371000 -- (-251.480) (-249.939) [-250.105] (-250.908) * [-250.608] (-253.499) (-254.029) (-249.308) -- 0:00:07
371500 -- (-251.705) (-251.816) (-250.148) [-250.057] * [-249.016] (-249.518) (-248.565) (-254.289) -- 0:00:07
372000 -- [-252.476] (-251.550) (-249.879) (-250.409) * (-248.387) (-250.211) [-248.963] (-251.655) -- 0:00:07
372500 -- (-248.842) (-249.113) [-250.809] (-251.237) * [-250.815] (-248.058) (-252.074) (-252.158) -- 0:00:07
373000 -- (-251.272) (-252.247) [-251.643] (-250.194) * (-251.691) [-248.633] (-250.450) (-248.914) -- 0:00:07
373500 -- (-258.082) (-253.754) (-250.002) [-249.753] * (-250.972) (-251.327) [-250.422] (-249.438) -- 0:00:07
374000 -- (-252.480) [-249.939] (-249.884) (-250.856) * (-249.076) [-249.467] (-250.344) (-254.249) -- 0:00:07
374500 -- [-251.863] (-249.164) (-249.664) (-250.734) * (-249.016) (-251.383) [-249.401] (-252.503) -- 0:00:07
375000 -- (-252.747) (-250.335) (-249.905) [-249.099] * (-250.665) (-253.532) [-249.551] (-253.318) -- 0:00:07
Average standard deviation of split frequencies: 0.012832
375500 -- (-249.510) (-249.741) (-250.354) [-249.954] * (-253.172) [-249.950] (-254.724) (-248.500) -- 0:00:07
376000 -- (-251.798) (-248.663) [-249.265] (-251.959) * (-252.954) (-251.876) [-249.595] (-252.295) -- 0:00:07
376500 -- [-253.414] (-249.138) (-249.348) (-250.143) * (-252.269) (-249.963) [-251.833] (-253.992) -- 0:00:07
377000 -- (-253.311) [-248.511] (-251.361) (-251.887) * (-254.142) [-249.125] (-248.628) (-249.165) -- 0:00:07
377500 -- (-251.212) [-252.366] (-248.445) (-249.439) * (-251.215) [-249.963] (-249.213) (-248.996) -- 0:00:07
378000 -- (-249.136) (-255.420) [-250.426] (-253.631) * (-253.545) (-251.775) (-251.364) [-249.593] -- 0:00:07
378500 -- (-252.720) (-248.157) [-248.337] (-250.977) * (-249.963) (-252.210) [-249.987] (-250.643) -- 0:00:07
379000 -- [-249.561] (-251.606) (-250.441) (-253.863) * [-250.448] (-254.613) (-251.058) (-251.977) -- 0:00:07
379500 -- (-251.352) [-249.426] (-248.981) (-248.843) * (-251.979) (-249.024) [-250.663] (-251.223) -- 0:00:06
380000 -- (-248.992) [-250.576] (-250.652) (-250.106) * [-253.138] (-250.855) (-257.719) (-249.684) -- 0:00:06
Average standard deviation of split frequencies: 0.013185
380500 -- (-249.019) (-249.392) (-248.233) [-248.616] * [-250.356] (-249.083) (-252.118) (-250.539) -- 0:00:06
381000 -- (-250.138) (-249.940) [-249.979] (-249.529) * (-251.092) (-249.130) (-249.017) [-253.959] -- 0:00:06
381500 -- (-252.149) [-250.731] (-253.187) (-250.656) * (-249.534) (-252.947) (-250.970) [-252.386] -- 0:00:06
382000 -- (-249.677) (-251.452) (-252.854) [-254.049] * [-253.276] (-252.800) (-249.842) (-249.546) -- 0:00:06
382500 -- (-251.899) (-252.496) [-251.763] (-251.672) * (-249.027) (-251.404) [-252.947] (-249.417) -- 0:00:06
383000 -- (-249.323) (-251.593) [-250.264] (-249.951) * [-249.608] (-248.433) (-253.860) (-252.233) -- 0:00:06
383500 -- (-249.738) (-249.692) [-249.274] (-250.852) * (-249.799) (-250.000) (-254.919) [-250.223] -- 0:00:06
384000 -- (-256.265) (-250.096) [-249.474] (-249.615) * [-249.750] (-250.749) (-251.558) (-250.721) -- 0:00:06
384500 -- [-254.149] (-249.025) (-254.584) (-249.465) * [-248.849] (-249.999) (-252.155) (-249.930) -- 0:00:06
385000 -- (-251.998) [-250.938] (-252.485) (-249.958) * [-249.022] (-249.605) (-249.562) (-250.907) -- 0:00:06
Average standard deviation of split frequencies: 0.013177
385500 -- (-250.949) [-248.404] (-249.968) (-250.205) * (-248.950) [-250.065] (-248.577) (-251.263) -- 0:00:06
386000 -- (-249.603) (-248.661) (-250.013) [-250.072] * (-250.991) [-249.885] (-249.628) (-250.778) -- 0:00:06
386500 -- (-251.631) (-257.692) (-252.415) [-250.261] * (-250.162) (-249.754) (-249.281) [-251.758] -- 0:00:06
387000 -- (-250.095) (-252.104) (-252.047) [-248.358] * (-250.142) [-250.346] (-249.864) (-254.593) -- 0:00:06
387500 -- (-249.276) [-250.809] (-249.065) (-249.791) * (-252.052) (-249.412) [-251.158] (-253.839) -- 0:00:06
388000 -- [-249.444] (-250.637) (-249.655) (-251.283) * (-250.115) (-252.008) [-249.264] (-250.289) -- 0:00:06
388500 -- [-248.325] (-253.140) (-249.817) (-252.856) * [-249.986] (-251.919) (-249.423) (-250.285) -- 0:00:06
389000 -- (-248.490) [-250.911] (-249.514) (-249.114) * (-253.010) (-252.316) [-252.864] (-252.628) -- 0:00:06
389500 -- (-251.465) (-248.945) [-253.899] (-249.081) * (-253.300) (-250.767) (-251.818) [-250.995] -- 0:00:06
390000 -- [-251.044] (-249.071) (-251.470) (-250.027) * (-253.028) [-249.135] (-248.121) (-248.583) -- 0:00:06
Average standard deviation of split frequencies: 0.013407
390500 -- [-251.389] (-249.339) (-249.453) (-252.083) * (-249.396) (-253.455) (-251.161) [-253.153] -- 0:00:06
391000 -- (-251.036) (-249.243) [-251.644] (-251.972) * [-252.924] (-253.811) (-250.452) (-248.050) -- 0:00:06
391500 -- [-251.451] (-250.522) (-251.599) (-250.653) * (-253.850) (-252.203) (-250.228) [-249.410] -- 0:00:06
392000 -- [-251.212] (-250.157) (-252.780) (-253.080) * (-251.528) (-252.794) [-249.158] (-252.918) -- 0:00:06
392500 -- (-248.915) (-252.476) [-248.801] (-255.237) * (-251.947) [-251.712] (-249.522) (-252.051) -- 0:00:06
393000 -- (-250.059) [-249.382] (-251.124) (-249.797) * (-253.917) (-249.802) [-249.094] (-257.770) -- 0:00:06
393500 -- (-248.894) [-250.427] (-250.164) (-251.016) * (-251.332) [-250.288] (-250.885) (-250.790) -- 0:00:06
394000 -- [-251.724] (-250.629) (-252.382) (-249.945) * [-249.529] (-251.109) (-255.952) (-248.771) -- 0:00:06
394500 -- (-248.139) [-251.091] (-249.894) (-250.322) * (-250.991) [-248.430] (-253.510) (-250.688) -- 0:00:06
395000 -- [-250.348] (-251.411) (-250.978) (-249.228) * (-249.589) [-249.738] (-250.440) (-253.401) -- 0:00:06
Average standard deviation of split frequencies: 0.012565
395500 -- (-254.010) [-251.363] (-250.972) (-252.422) * (-249.503) [-248.630] (-249.707) (-252.244) -- 0:00:06
396000 -- [-251.910] (-248.964) (-250.452) (-249.969) * [-249.787] (-251.570) (-250.080) (-255.146) -- 0:00:06
396500 -- (-249.252) [-249.485] (-251.712) (-251.837) * (-249.726) (-249.981) [-248.653] (-253.656) -- 0:00:06
397000 -- (-253.021) (-249.988) (-252.365) [-250.414] * (-249.250) (-251.766) (-249.726) [-251.472] -- 0:00:05
397500 -- [-251.296] (-252.310) (-251.273) (-250.043) * (-252.435) [-249.887] (-250.141) (-255.151) -- 0:00:05
398000 -- (-251.041) (-250.847) (-251.118) [-252.621] * (-257.812) (-250.918) [-252.355] (-253.641) -- 0:00:05
398500 -- (-249.516) [-249.429] (-250.085) (-249.396) * (-252.698) [-249.704] (-252.863) (-255.508) -- 0:00:05
399000 -- (-249.224) [-249.564] (-249.594) (-249.624) * [-249.205] (-249.673) (-252.775) (-249.702) -- 0:00:05
399500 -- [-249.969] (-249.985) (-249.791) (-252.808) * (-249.233) (-252.681) (-250.308) [-249.058] -- 0:00:05
400000 -- [-249.386] (-249.392) (-248.435) (-253.414) * (-248.585) (-252.876) [-249.428] (-251.316) -- 0:00:05
Average standard deviation of split frequencies: 0.012181
400500 -- [-250.281] (-249.351) (-253.209) (-252.112) * (-250.212) (-252.081) [-249.030] (-248.887) -- 0:00:05
401000 -- (-250.782) (-255.274) (-251.706) [-251.902] * (-254.432) (-251.575) (-248.349) [-248.820] -- 0:00:05
401500 -- (-252.405) (-253.442) (-249.675) [-249.153] * (-249.901) (-250.041) [-249.098] (-249.988) -- 0:00:05
402000 -- (-252.629) [-250.569] (-252.115) (-248.491) * (-250.874) (-249.512) [-250.193] (-249.653) -- 0:00:05
402500 -- (-249.031) [-250.285] (-256.446) (-249.615) * (-251.262) [-254.902] (-250.821) (-253.067) -- 0:00:05
403000 -- [-251.065] (-251.362) (-251.117) (-250.224) * (-253.321) (-252.741) (-249.478) [-252.168] -- 0:00:05
403500 -- (-250.885) (-249.464) (-248.946) [-252.369] * (-249.600) (-249.294) [-248.869] (-250.250) -- 0:00:05
404000 -- (-250.207) (-250.771) [-250.452] (-249.689) * (-251.234) (-250.420) (-258.280) [-249.756] -- 0:00:05
404500 -- (-250.164) (-255.788) (-250.038) [-249.434] * [-251.762] (-253.437) (-251.046) (-251.737) -- 0:00:05
405000 -- (-248.970) (-251.263) [-249.048] (-250.176) * (-250.556) (-252.158) [-250.372] (-250.464) -- 0:00:05
Average standard deviation of split frequencies: 0.012294
405500 -- [-248.116] (-249.660) (-250.104) (-250.174) * (-250.962) (-252.605) [-250.750] (-248.509) -- 0:00:05
406000 -- (-249.563) [-252.324] (-248.288) (-251.174) * (-253.318) [-252.970] (-252.858) (-252.618) -- 0:00:05
406500 -- (-251.586) [-250.129] (-250.106) (-251.579) * [-249.076] (-250.570) (-252.981) (-253.024) -- 0:00:05
407000 -- (-250.811) (-249.116) (-248.514) [-250.707] * (-251.018) (-250.334) [-248.787] (-253.882) -- 0:00:05
407500 -- (-250.108) (-252.165) [-248.770] (-251.451) * (-252.845) [-248.327] (-249.708) (-254.684) -- 0:00:05
408000 -- [-250.852] (-260.610) (-248.927) (-250.076) * (-249.993) [-249.479] (-250.777) (-250.332) -- 0:00:05
408500 -- (-252.277) (-257.632) (-249.249) [-249.259] * (-251.739) (-249.745) [-248.378] (-249.356) -- 0:00:05
409000 -- (-251.244) (-255.522) [-249.901] (-253.371) * [-250.802] (-250.939) (-248.343) (-248.478) -- 0:00:05
409500 -- (-249.583) [-253.785] (-255.784) (-250.638) * [-251.930] (-250.851) (-249.154) (-250.515) -- 0:00:05
410000 -- [-252.126] (-252.349) (-249.960) (-248.790) * [-249.904] (-249.598) (-251.533) (-248.600) -- 0:00:05
Average standard deviation of split frequencies: 0.012222
410500 -- [-254.019] (-248.681) (-251.527) (-249.075) * (-249.828) (-249.420) [-249.808] (-251.427) -- 0:00:05
411000 -- (-255.420) (-248.942) [-249.391] (-248.876) * (-250.075) (-249.742) (-251.323) [-250.273] -- 0:00:05
411500 -- [-251.495] (-249.204) (-248.627) (-249.195) * (-249.546) [-251.393] (-251.652) (-252.807) -- 0:00:05
412000 -- (-255.573) (-254.904) (-250.940) [-250.008] * [-251.566] (-249.515) (-249.369) (-251.236) -- 0:00:05
412500 -- (-249.407) [-250.479] (-249.978) (-252.725) * (-249.570) [-251.545] (-249.373) (-255.429) -- 0:00:05
413000 -- (-250.808) [-251.530] (-249.151) (-250.537) * (-249.910) (-253.009) (-250.989) [-249.494] -- 0:00:05
413500 -- (-251.713) [-248.408] (-249.396) (-254.481) * (-248.753) (-248.336) [-257.061] (-250.250) -- 0:00:05
414000 -- [-250.090] (-250.433) (-250.449) (-248.978) * (-248.621) [-252.582] (-252.817) (-249.996) -- 0:00:04
414500 -- [-250.728] (-252.291) (-252.146) (-249.387) * [-254.431] (-251.726) (-255.235) (-248.730) -- 0:00:04
415000 -- (-249.974) (-249.765) (-249.581) [-250.363] * (-249.103) (-249.747) [-251.718] (-248.827) -- 0:00:04
Average standard deviation of split frequencies: 0.012132
415500 -- [-249.229] (-249.828) (-251.149) (-251.605) * (-250.064) (-252.589) [-251.465] (-250.548) -- 0:00:04
416000 -- (-251.649) (-249.552) (-250.361) [-250.263] * (-254.213) [-249.587] (-250.961) (-256.504) -- 0:00:04
416500 -- (-251.859) (-252.404) (-251.412) [-251.995] * (-253.762) (-249.657) (-248.615) [-251.964] -- 0:00:04
417000 -- [-249.806] (-252.718) (-255.247) (-250.877) * (-249.265) (-250.668) [-249.585] (-248.552) -- 0:00:04
417500 -- (-251.585) [-249.374] (-253.054) (-254.841) * (-252.801) [-250.661] (-249.551) (-252.783) -- 0:00:04
418000 -- (-253.243) (-252.846) (-248.993) [-249.221] * (-254.451) (-255.062) [-251.203] (-249.447) -- 0:00:04
418500 -- (-253.878) (-256.904) [-248.810] (-249.828) * (-250.587) (-250.345) (-250.058) [-249.291] -- 0:00:04
419000 -- (-251.734) (-251.445) (-248.666) [-252.558] * (-250.594) (-252.907) (-252.191) [-251.123] -- 0:00:04
419500 -- (-254.563) [-249.136] (-250.612) (-251.592) * (-252.141) [-260.080] (-253.245) (-252.760) -- 0:00:04
420000 -- (-257.171) [-248.798] (-249.804) (-249.532) * (-249.168) [-252.012] (-255.980) (-249.788) -- 0:00:04
Average standard deviation of split frequencies: 0.011470
420500 -- (-249.863) (-249.973) (-249.037) [-248.514] * [-251.631] (-248.786) (-251.939) (-251.193) -- 0:00:04
421000 -- (-249.341) (-253.848) [-250.785] (-257.013) * (-251.633) [-248.592] (-252.923) (-250.334) -- 0:00:04
421500 -- (-249.943) (-249.657) [-248.662] (-250.353) * (-249.708) (-249.125) [-251.497] (-253.801) -- 0:00:04
422000 -- [-252.285] (-249.643) (-248.151) (-249.751) * (-252.787) (-253.691) [-249.996] (-252.564) -- 0:00:04
422500 -- (-255.684) [-249.210] (-250.990) (-252.611) * (-254.216) (-253.059) [-248.898] (-251.102) -- 0:00:04
423000 -- (-252.029) [-251.100] (-251.387) (-250.878) * [-252.463] (-253.820) (-248.690) (-251.627) -- 0:00:04
423500 -- (-251.823) (-250.003) (-249.581) [-251.275] * [-253.593] (-251.258) (-249.737) (-255.461) -- 0:00:04
424000 -- (-256.012) [-249.412] (-253.811) (-253.037) * (-255.774) [-250.323] (-249.621) (-257.215) -- 0:00:04
424500 -- (-254.732) (-252.289) (-251.850) [-251.001] * (-257.997) (-251.330) [-249.475] (-251.675) -- 0:00:04
425000 -- [-252.231] (-250.305) (-250.776) (-251.407) * (-258.983) (-248.959) [-249.018] (-250.809) -- 0:00:04
Average standard deviation of split frequencies: 0.011456
425500 -- (-249.677) [-251.171] (-250.437) (-251.708) * [-250.160] (-251.438) (-250.139) (-250.209) -- 0:00:04
426000 -- (-248.551) (-250.011) (-252.060) [-253.113] * (-252.763) [-249.372] (-249.311) (-249.428) -- 0:00:04
426500 -- (-253.331) (-249.304) [-260.081] (-249.565) * (-253.616) (-251.285) (-251.721) [-249.385] -- 0:00:04
427000 -- [-249.305] (-249.761) (-255.197) (-250.197) * (-256.056) [-252.525] (-251.593) (-249.726) -- 0:00:04
427500 -- (-248.815) [-250.707] (-253.148) (-248.931) * (-252.519) [-250.947] (-252.835) (-249.534) -- 0:00:04
428000 -- (-250.658) [-252.084] (-252.173) (-252.108) * (-250.399) (-250.998) (-250.903) [-250.472] -- 0:00:04
428500 -- (-250.814) (-250.835) (-251.424) [-249.003] * (-250.197) (-249.427) [-248.761] (-252.547) -- 0:00:04
429000 -- (-253.997) [-252.104] (-251.706) (-250.647) * [-251.183] (-249.647) (-248.951) (-249.231) -- 0:00:04
429500 -- (-249.449) (-250.032) [-251.472] (-248.722) * (-248.967) (-248.829) (-250.588) [-249.909] -- 0:00:04
430000 -- (-248.594) (-256.602) (-249.304) [-249.879] * (-249.841) (-250.540) (-250.158) [-250.516] -- 0:00:04
Average standard deviation of split frequencies: 0.011783
430500 -- (-249.244) (-250.251) (-253.460) [-250.030] * (-250.378) (-248.819) [-249.796] (-249.386) -- 0:00:04
431000 -- (-248.656) (-251.305) [-250.306] (-250.158) * (-249.958) [-250.452] (-252.191) (-250.370) -- 0:00:04
431500 -- (-249.954) (-248.213) (-250.110) [-250.816] * [-249.208] (-257.259) (-252.576) (-250.824) -- 0:00:03
432000 -- [-249.589] (-249.674) (-248.653) (-249.830) * [-255.639] (-249.768) (-253.033) (-248.756) -- 0:00:03
432500 -- [-249.005] (-252.454) (-255.563) (-252.948) * (-251.654) (-249.177) [-249.441] (-251.092) -- 0:00:03
433000 -- (-249.826) [-249.502] (-252.032) (-255.943) * (-249.316) (-253.677) [-250.863] (-250.965) -- 0:00:03
433500 -- (-254.430) [-250.705] (-252.029) (-252.830) * (-248.599) [-254.303] (-249.786) (-253.266) -- 0:00:03
434000 -- (-252.400) (-248.880) (-249.937) [-250.604] * (-249.191) (-250.300) [-250.248] (-251.055) -- 0:00:03
434500 -- (-250.504) [-249.741] (-249.515) (-254.129) * [-248.978] (-252.105) (-249.025) (-253.183) -- 0:00:03
435000 -- (-251.870) (-248.308) (-249.684) [-253.021] * [-250.647] (-249.853) (-250.420) (-253.289) -- 0:00:03
Average standard deviation of split frequencies: 0.011957
435500 -- [-252.058] (-251.024) (-254.337) (-251.496) * (-250.244) (-249.850) (-252.257) [-249.267] -- 0:00:03
436000 -- (-248.544) [-250.495] (-251.188) (-249.160) * (-252.618) (-251.692) [-251.324] (-250.084) -- 0:00:03
436500 -- (-248.319) (-249.580) (-250.499) [-248.216] * [-251.235] (-248.964) (-248.503) (-251.804) -- 0:00:03
437000 -- (-248.824) (-248.627) [-252.360] (-258.997) * (-249.393) (-251.808) (-248.801) [-252.454] -- 0:00:03
437500 -- (-253.792) [-251.008] (-250.548) (-259.925) * (-249.333) (-251.364) [-251.489] (-250.889) -- 0:00:03
438000 -- (-249.992) (-252.758) (-248.440) [-249.608] * (-252.155) (-255.863) [-252.021] (-249.601) -- 0:00:03
438500 -- (-252.242) (-253.097) (-248.509) [-248.653] * (-250.404) [-251.680] (-250.581) (-249.803) -- 0:00:03
439000 -- (-248.910) (-251.401) (-251.247) [-251.476] * (-251.030) (-249.591) (-253.887) [-251.263] -- 0:00:03
439500 -- (-249.005) (-250.340) (-254.362) [-250.355] * (-253.133) (-253.952) [-251.648] (-248.603) -- 0:00:03
440000 -- (-252.508) [-252.554] (-252.767) (-248.350) * (-248.697) (-252.840) [-252.384] (-248.734) -- 0:00:03
Average standard deviation of split frequencies: 0.011767
440500 -- [-252.262] (-252.589) (-253.776) (-249.647) * (-250.516) [-248.639] (-255.253) (-251.257) -- 0:00:03
441000 -- (-253.413) [-248.975] (-254.010) (-248.471) * (-250.248) (-249.618) [-248.765] (-253.242) -- 0:00:03
441500 -- (-251.034) [-250.528] (-249.366) (-249.845) * (-252.711) [-249.956] (-248.863) (-250.173) -- 0:00:03
442000 -- [-250.162] (-248.200) (-250.240) (-251.355) * (-248.612) (-251.520) (-250.874) [-251.760] -- 0:00:03
442500 -- (-249.706) (-251.310) (-250.044) [-251.504] * (-250.990) (-250.426) [-251.737] (-257.902) -- 0:00:03
443000 -- (-251.263) [-251.475] (-250.129) (-249.580) * [-248.628] (-251.494) (-250.328) (-251.901) -- 0:00:03
443500 -- (-249.499) (-253.496) (-251.199) [-250.449] * (-251.027) (-253.315) [-249.541] (-250.515) -- 0:00:03
444000 -- (-248.259) (-252.746) [-249.525] (-254.197) * (-253.528) (-253.479) (-251.119) [-248.546] -- 0:00:03
444500 -- (-251.267) [-254.744] (-248.759) (-249.238) * [-249.440] (-250.235) (-250.616) (-250.344) -- 0:00:03
445000 -- (-250.222) (-253.077) [-248.705] (-249.879) * (-251.006) (-254.713) (-249.586) [-251.250] -- 0:00:03
Average standard deviation of split frequencies: 0.011937
445500 -- (-250.106) [-250.536] (-249.253) (-252.338) * (-250.897) (-254.281) (-250.492) [-248.952] -- 0:00:03
446000 -- (-248.538) (-255.129) [-249.393] (-252.032) * (-248.598) [-250.192] (-249.069) (-250.885) -- 0:00:03
446500 -- (-254.160) (-249.522) [-250.015] (-252.320) * (-250.750) (-251.425) (-251.113) [-248.196] -- 0:00:03
447000 -- (-249.373) (-255.332) [-250.176] (-252.109) * (-255.603) [-254.130] (-251.320) (-249.440) -- 0:00:03
447500 -- (-251.142) [-251.756] (-252.917) (-249.777) * (-251.184) [-252.156] (-250.462) (-248.138) -- 0:00:03
448000 -- [-250.633] (-249.545) (-252.368) (-248.736) * (-249.444) (-250.296) (-249.642) [-251.214] -- 0:00:03
448500 -- (-252.779) (-249.664) [-251.337] (-249.147) * (-251.009) (-250.192) (-249.379) [-252.128] -- 0:00:02
449000 -- [-248.748] (-252.708) (-249.219) (-249.863) * (-250.720) (-252.513) (-250.440) [-249.785] -- 0:00:02
449500 -- (-249.100) [-248.488] (-252.156) (-249.161) * [-253.261] (-250.359) (-250.146) (-248.698) -- 0:00:02
450000 -- (-249.083) (-248.384) (-252.196) [-249.929] * (-252.577) (-248.882) [-251.632] (-248.769) -- 0:00:02
Average standard deviation of split frequencies: 0.011014
450500 -- [-251.965] (-249.252) (-248.898) (-251.055) * (-251.011) [-251.553] (-252.194) (-248.706) -- 0:00:02
451000 -- [-251.161] (-252.016) (-250.126) (-251.633) * [-250.348] (-250.867) (-249.541) (-249.351) -- 0:00:02
451500 -- [-252.914] (-251.496) (-249.538) (-251.674) * (-250.249) [-250.879] (-252.031) (-249.201) -- 0:00:02
452000 -- (-253.967) [-249.838] (-249.497) (-248.756) * (-251.997) [-249.192] (-251.311) (-249.466) -- 0:00:02
452500 -- (-251.063) [-249.982] (-250.461) (-248.710) * (-253.704) (-251.580) [-248.413] (-252.942) -- 0:00:02
453000 -- [-249.293] (-249.839) (-252.460) (-250.063) * (-250.443) [-251.140] (-251.391) (-251.354) -- 0:00:02
453500 -- (-248.764) [-249.808] (-256.867) (-249.999) * (-250.013) [-249.760] (-254.187) (-250.161) -- 0:00:02
454000 -- [-249.036] (-249.543) (-250.556) (-249.854) * (-250.298) (-249.770) (-249.827) [-252.820] -- 0:00:02
454500 -- (-248.225) [-251.449] (-248.956) (-252.574) * (-253.038) (-248.960) [-249.559] (-251.595) -- 0:00:02
455000 -- (-250.572) (-255.696) (-249.698) [-251.691] * (-249.986) (-248.978) [-250.009] (-250.185) -- 0:00:02
Average standard deviation of split frequencies: 0.010790
455500 -- (-248.630) (-251.484) (-253.947) [-249.237] * (-249.300) [-248.562] (-251.883) (-255.903) -- 0:00:02
456000 -- [-249.239] (-251.030) (-255.717) (-249.467) * (-249.743) (-251.175) [-249.374] (-248.194) -- 0:00:02
456500 -- (-248.831) [-249.222] (-250.087) (-250.476) * (-252.516) (-252.092) [-252.943] (-249.351) -- 0:00:02
457000 -- [-250.413] (-251.879) (-249.998) (-251.459) * (-248.307) (-249.359) (-253.409) [-251.011] -- 0:00:02
457500 -- [-249.924] (-249.292) (-254.413) (-254.274) * (-249.353) (-249.509) (-251.900) [-251.633] -- 0:00:02
458000 -- (-250.187) [-251.190] (-252.228) (-250.191) * (-249.054) [-251.142] (-249.943) (-252.942) -- 0:00:02
458500 -- (-252.029) [-249.928] (-251.990) (-253.257) * (-248.293) [-250.064] (-248.981) (-250.129) -- 0:00:02
459000 -- [-249.897] (-250.875) (-253.217) (-249.616) * (-250.314) (-250.042) (-250.572) [-248.560] -- 0:00:02
459500 -- (-250.871) (-253.630) (-250.330) [-253.184] * (-252.109) (-250.140) (-249.139) [-255.073] -- 0:00:02
460000 -- (-251.543) (-248.788) (-250.519) [-250.676] * (-250.144) (-249.423) [-249.890] (-249.190) -- 0:00:02
Average standard deviation of split frequencies: 0.010353
460500 -- (-251.088) [-249.648] (-250.017) (-250.183) * (-249.859) [-248.790] (-253.549) (-248.805) -- 0:00:02
461000 -- (-252.351) (-248.797) [-253.481] (-251.286) * [-250.213] (-251.690) (-251.128) (-249.726) -- 0:00:02
461500 -- (-250.814) (-250.179) (-250.619) [-248.902] * (-250.137) (-251.722) [-248.980] (-251.638) -- 0:00:02
462000 -- (-249.423) (-252.086) [-251.115] (-250.340) * (-252.135) (-248.203) (-250.213) [-250.322] -- 0:00:02
462500 -- (-251.448) (-249.205) (-248.261) [-249.487] * (-252.672) [-254.025] (-253.901) (-253.389) -- 0:00:02
463000 -- (-250.269) (-251.221) (-253.358) [-252.429] * (-252.541) (-250.957) (-250.229) [-249.256] -- 0:00:02
463500 -- (-248.801) (-249.284) [-248.412] (-254.549) * (-250.423) [-253.272] (-252.263) (-251.031) -- 0:00:02
464000 -- (-250.373) [-250.226] (-248.454) (-254.857) * (-249.953) (-249.969) [-249.565] (-248.440) -- 0:00:02
464500 -- (-249.044) (-250.876) (-250.241) [-253.979] * (-248.371) (-249.128) (-248.461) [-249.611] -- 0:00:02
465000 -- [-249.031] (-249.932) (-250.716) (-250.010) * [-249.593] (-249.210) (-251.912) (-249.675) -- 0:00:02
Average standard deviation of split frequencies: 0.010116
465500 -- (-250.114) [-248.603] (-249.414) (-248.946) * (-253.219) [-248.513] (-249.957) (-252.376) -- 0:00:02
466000 -- (-249.164) (-248.673) (-249.203) [-248.748] * [-250.019] (-250.190) (-250.350) (-251.890) -- 0:00:01
466500 -- (-250.368) (-251.670) (-250.328) [-249.044] * (-249.400) (-253.620) (-250.594) [-251.285] -- 0:00:01
467000 -- (-248.744) [-253.156] (-248.691) (-251.612) * (-251.386) (-253.353) (-249.463) [-248.894] -- 0:00:01
467500 -- (-249.232) [-248.859] (-250.669) (-248.937) * (-251.328) [-251.724] (-250.045) (-248.621) -- 0:00:01
468000 -- (-250.859) (-251.358) [-251.094] (-250.720) * [-249.383] (-251.095) (-251.213) (-252.394) -- 0:00:01
468500 -- (-253.733) [-250.696] (-251.689) (-252.430) * (-253.071) [-250.975] (-249.379) (-251.431) -- 0:00:01
469000 -- [-251.487] (-249.372) (-252.916) (-250.059) * [-250.880] (-249.085) (-249.362) (-257.619) -- 0:00:01
469500 -- [-249.242] (-249.194) (-250.534) (-254.364) * (-255.897) (-249.802) (-254.337) [-250.661] -- 0:00:01
470000 -- [-250.013] (-248.921) (-251.027) (-252.045) * (-253.641) (-250.354) (-250.742) [-249.523] -- 0:00:01
Average standard deviation of split frequencies: 0.010078
470500 -- (-250.769) (-249.740) [-249.229] (-252.694) * (-249.030) (-249.210) (-251.104) [-248.081] -- 0:00:01
471000 -- (-254.068) (-250.119) [-249.483] (-252.325) * (-251.004) (-249.320) [-248.641] (-249.676) -- 0:00:01
471500 -- (-249.643) [-253.667] (-253.916) (-255.859) * (-250.352) [-248.795] (-253.980) (-248.810) -- 0:00:01
472000 -- (-254.211) [-251.857] (-252.487) (-249.803) * [-249.995] (-255.109) (-260.823) (-248.498) -- 0:00:01
472500 -- (-251.669) [-250.486] (-254.812) (-250.120) * (-248.668) (-249.738) (-249.696) [-248.977] -- 0:00:01
473000 -- (-253.489) (-249.616) (-255.479) [-249.461] * [-249.264] (-248.699) (-250.927) (-254.148) -- 0:00:01
473500 -- (-250.304) [-250.519] (-249.714) (-251.771) * (-254.288) (-250.837) (-251.849) [-249.728] -- 0:00:01
474000 -- (-252.190) (-248.534) (-252.286) [-249.193] * (-250.189) (-252.381) (-250.572) [-250.459] -- 0:00:01
474500 -- (-253.648) (-252.080) (-248.583) [-249.410] * (-248.968) (-249.106) (-250.460) [-249.682] -- 0:00:01
475000 -- (-258.496) (-251.113) (-249.974) [-250.894] * (-249.163) [-249.360] (-252.280) (-251.373) -- 0:00:01
Average standard deviation of split frequencies: 0.009656
475500 -- (-253.087) [-248.737] (-257.181) (-251.334) * (-249.503) [-249.471] (-248.669) (-252.687) -- 0:00:01
476000 -- (-252.996) [-248.914] (-252.093) (-250.777) * [-249.275] (-249.963) (-249.210) (-251.280) -- 0:00:01
476500 -- (-252.110) (-248.808) (-249.795) [-248.053] * (-248.794) [-250.900] (-250.341) (-249.186) -- 0:00:01
477000 -- (-250.524) (-251.561) (-249.289) [-248.195] * (-249.939) [-254.575] (-251.823) (-257.382) -- 0:00:01
477500 -- (-254.395) (-251.327) (-253.922) [-250.818] * (-248.851) [-251.865] (-250.865) (-249.989) -- 0:00:01
478000 -- (-253.057) (-251.347) [-251.169] (-249.465) * (-249.119) [-249.573] (-251.387) (-253.606) -- 0:00:01
478500 -- (-254.286) (-251.740) (-249.804) [-249.472] * (-249.104) (-248.746) [-250.628] (-250.013) -- 0:00:01
479000 -- (-249.591) (-251.465) [-249.542] (-250.350) * (-250.058) (-249.032) (-249.132) [-248.673] -- 0:00:01
479500 -- (-251.413) (-252.597) (-248.768) [-249.433] * (-251.598) [-249.968] (-249.293) (-249.295) -- 0:00:01
480000 -- [-249.335] (-249.685) (-249.197) (-249.079) * [-251.149] (-249.650) (-252.601) (-251.433) -- 0:00:01
Average standard deviation of split frequencies: 0.009378
480500 -- (-252.436) (-251.242) [-250.627] (-249.875) * (-252.368) (-248.333) (-250.586) [-249.677] -- 0:00:01
481000 -- (-251.076) (-251.349) [-250.119] (-249.630) * [-248.938] (-249.455) (-254.169) (-252.055) -- 0:00:01
481500 -- (-255.811) [-250.182] (-251.842) (-249.678) * [-249.964] (-250.170) (-248.555) (-252.439) -- 0:00:01
482000 -- (-249.183) (-250.644) (-249.459) [-251.072] * (-250.192) (-250.115) (-248.955) [-252.342] -- 0:00:01
482500 -- (-249.648) (-250.387) [-252.150] (-254.101) * (-250.136) (-250.480) [-248.871] (-255.015) -- 0:00:01
483000 -- (-250.482) (-256.111) (-255.153) [-249.297] * [-249.753] (-250.892) (-249.936) (-254.675) -- 0:00:00
483500 -- [-250.360] (-251.192) (-249.852) (-252.604) * (-250.245) [-251.549] (-249.112) (-248.283) -- 0:00:00
484000 -- (-250.887) [-249.055] (-254.170) (-251.992) * (-249.908) (-248.327) (-256.443) [-249.147] -- 0:00:00
484500 -- (-251.831) (-259.950) [-249.833] (-249.399) * (-249.254) (-249.130) (-250.389) [-248.499] -- 0:00:00
485000 -- (-250.268) (-250.098) (-248.659) [-251.084] * [-248.613] (-252.058) (-250.949) (-248.830) -- 0:00:00
Average standard deviation of split frequencies: 0.009639
485500 -- [-249.401] (-253.417) (-252.879) (-251.327) * (-250.214) [-249.117] (-249.906) (-248.720) -- 0:00:00
486000 -- (-249.023) (-252.427) [-249.392] (-253.130) * [-249.131] (-251.424) (-250.325) (-249.658) -- 0:00:00
486500 -- (-252.813) (-253.410) [-249.268] (-248.193) * (-248.905) (-252.191) [-250.045] (-249.687) -- 0:00:00
487000 -- (-248.781) (-255.330) (-248.602) [-249.061] * (-251.628) [-251.227] (-250.400) (-251.537) -- 0:00:00
487500 -- (-249.781) (-248.684) (-249.618) [-248.335] * [-249.222] (-253.051) (-250.597) (-250.458) -- 0:00:00
488000 -- (-251.000) [-251.321] (-250.782) (-249.343) * (-250.433) (-250.368) (-252.700) [-251.211] -- 0:00:00
488500 -- (-249.437) (-249.002) (-249.332) [-248.920] * [-252.559] (-252.054) (-249.510) (-250.736) -- 0:00:00
489000 -- (-250.512) (-253.067) (-251.091) [-249.359] * [-254.259] (-253.707) (-249.704) (-252.742) -- 0:00:00
489500 -- (-252.416) (-249.655) (-249.080) [-249.754] * [-253.648] (-254.507) (-249.723) (-253.725) -- 0:00:00
490000 -- (-250.983) (-249.156) [-249.535] (-249.395) * [-250.763] (-248.757) (-249.206) (-258.697) -- 0:00:00
Average standard deviation of split frequencies: 0.010028
490500 -- (-251.000) [-251.883] (-249.754) (-248.617) * [-251.673] (-249.102) (-250.018) (-249.598) -- 0:00:00
491000 -- (-249.970) [-251.738] (-250.709) (-250.850) * (-250.267) (-250.680) (-250.854) [-249.552] -- 0:00:00
491500 -- (-248.096) (-249.576) (-249.913) [-251.545] * (-248.979) (-248.949) (-250.032) [-251.694] -- 0:00:00
492000 -- (-251.140) (-248.482) [-249.252] (-248.471) * [-249.277] (-248.688) (-250.089) (-248.737) -- 0:00:00
492500 -- (-250.434) (-248.785) [-248.486] (-248.685) * [-249.270] (-252.955) (-249.952) (-249.913) -- 0:00:00
493000 -- [-250.744] (-249.486) (-252.402) (-249.668) * (-249.204) (-252.658) [-252.059] (-250.105) -- 0:00:00
493500 -- (-252.323) (-251.071) (-252.590) [-249.532] * (-250.466) (-251.373) (-249.745) [-249.235] -- 0:00:00
494000 -- (-250.682) [-251.160] (-249.547) (-249.492) * [-250.659] (-249.713) (-250.168) (-250.348) -- 0:00:00
494500 -- [-249.360] (-252.117) (-249.305) (-248.814) * (-253.800) (-249.593) [-249.687] (-249.683) -- 0:00:00
495000 -- (-255.912) [-250.402] (-249.729) (-250.027) * (-249.864) (-250.974) [-251.161] (-250.723) -- 0:00:00
Average standard deviation of split frequencies: 0.009742
495500 -- (-252.744) (-250.252) [-248.661] (-251.106) * (-251.628) (-255.603) (-249.914) [-249.440] -- 0:00:00
496000 -- (-254.047) (-253.090) (-255.421) [-249.916] * [-250.860] (-250.801) (-249.018) (-251.691) -- 0:00:00
496500 -- (-254.845) [-251.089] (-252.039) (-250.740) * (-249.863) (-252.975) (-248.890) [-252.729] -- 0:00:00
497000 -- (-250.795) [-249.998] (-249.263) (-250.931) * (-250.078) (-252.713) [-255.491] (-250.875) -- 0:00:00
497500 -- (-252.165) [-248.597] (-251.264) (-251.869) * (-251.478) (-249.091) (-251.722) [-248.868] -- 0:00:00
498000 -- [-253.490] (-249.697) (-252.719) (-251.890) * (-253.561) (-249.679) [-254.490] (-251.232) -- 0:00:00
498500 -- (-250.070) [-249.012] (-251.719) (-253.701) * [-250.507] (-249.380) (-250.479) (-252.424) -- 0:00:00
499000 -- (-249.878) [-249.349] (-250.175) (-252.688) * (-252.150) (-248.943) [-250.649] (-251.528) -- 0:00:00
499500 -- (-249.269) (-250.780) (-253.435) [-249.103] * (-253.717) [-249.433] (-249.090) (-250.039) -- 0:00:00
500000 -- (-250.889) [-251.492] (-249.584) (-249.435) * (-253.420) [-250.052] (-250.550) (-250.141) -- 0:00:00
Average standard deviation of split frequencies: 0.009353
Analysis completed in 29 seconds
Analysis used 28.90 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -247.97
Likelihood of best state for "cold" chain of run 2 was -247.97
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
78.2 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
55.1 % ( 47 %) Dirichlet(Pi{all})
54.9 % ( 49 %) Slider(Pi{all})
88.1 % ( 80 %) Multiplier(Alpha{1,2})
87.7 % ( 80 %) Multiplier(Alpha{3})
29.5 % ( 34 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.6 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
30.7 % ( 24 %) Multiplier(V{all})
97.3 % ( 99 %) Nodeslider(V{all})
35.5 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
78.5 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
54.4 % ( 52 %) Dirichlet(Pi{all})
54.2 % ( 54 %) Slider(Pi{all})
88.6 % ( 82 %) Multiplier(Alpha{1,2})
88.2 % ( 86 %) Multiplier(Alpha{3})
30.7 % ( 30 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.5 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
30.7 % ( 31 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
35.6 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 82992 0.83 0.67
3 | 83205 83276 0.83
4 | 83711 83936 82880
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83081 0.82 0.66
3 | 83298 83535 0.83
4 | 83439 83564 83083
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -249.37
| 2 1 |
| 1 2 21 |
|2 1 * 2 2 |
| 2 1 2 1 21 21 11 |
| 22112 1 2 1 2 2 1|
| 2 1 21 2 21 211 1 21* 2 1 1 12 112 |
| 2 1 221 22 2 2 1 2 1 1 2 |
| 1 2 1 22 1 12 21 1 12** 2 1 1 |
| 1 1 2 1 2 2 1 1 1 22 2 |
| 2 2 |
| 1 1 22 1 2 22|
|1 1 1 |
| 1 |
| 221 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -251.87
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -249.72 -254.54
2 -249.73 -253.71
--------------------------------------
TOTAL -249.73 -254.21
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884017 0.089050 0.361114 1.443666 0.851218 620.49 630.56 1.000
r(A<->C){all} 0.168179 0.018578 0.000001 0.434374 0.139757 121.82 145.85 1.000
r(A<->G){all} 0.157606 0.017011 0.000116 0.417112 0.121464 80.20 82.53 1.001
r(A<->T){all} 0.190473 0.024251 0.000116 0.499902 0.155081 40.30 101.15 1.000
r(C<->G){all} 0.149048 0.014835 0.000059 0.394684 0.119820 61.78 64.81 1.000
r(C<->T){all} 0.165097 0.022816 0.000009 0.480003 0.116315 61.63 89.58 1.004
r(G<->T){all} 0.169597 0.019885 0.000033 0.436970 0.133533 79.87 91.83 1.000
pi(A){all} 0.181769 0.000779 0.126299 0.235468 0.180556 562.34 656.67 1.000
pi(C){all} 0.256331 0.000976 0.191918 0.314328 0.255516 580.18 587.19 1.000
pi(G){all} 0.347398 0.001174 0.284031 0.410877 0.347297 550.72 635.79 1.000
pi(T){all} 0.214502 0.000892 0.152641 0.268272 0.213748 592.67 596.14 0.999
alpha{1,2} 0.400656 0.234640 0.000204 1.331825 0.228808 377.69 523.66 1.001
alpha{3} 0.422064 0.224224 0.000476 1.350289 0.266943 428.23 589.61 1.001
pinvar{all} 0.990197 0.000136 0.968662 0.999992 0.993853 471.86 611.43 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ..*..*
9 -- .***.*
10 -- .**.**
11 -- ..****
12 -- ...*.*
13 -- .*..*.
14 -- ..*.*.
15 -- ...**.
16 -- .*.***
17 -- .*...*
18 -- .****.
19 -- ..**..
20 -- ....**
21 -- .*.*..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 232 0.154461 0.011299 0.146471 0.162450 2
8 229 0.152463 0.023539 0.135819 0.169108 2
9 228 0.151798 0.007532 0.146471 0.157124 2
10 228 0.151798 0.003766 0.149134 0.154461 2
11 223 0.148469 0.004708 0.145140 0.151798 2
12 221 0.147137 0.019773 0.133156 0.161119 2
13 215 0.143142 0.004708 0.139814 0.146471 2
14 213 0.141811 0.000942 0.141145 0.142477 2
15 213 0.141811 0.010357 0.134487 0.149134 2
16 211 0.140479 0.014123 0.130493 0.150466 2
17 211 0.140479 0.002825 0.138482 0.142477 2
18 206 0.137150 0.005649 0.133156 0.141145 2
19 204 0.135819 0.003766 0.133156 0.138482 2
20 202 0.134487 0.020714 0.119840 0.149134 2
21 201 0.133822 0.006591 0.129161 0.138482 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.093677 0.007938 0.000028 0.279672 0.065300 1.001 2
length{all}[2] 0.099895 0.010918 0.000044 0.306287 0.063701 1.000 2
length{all}[3] 0.103087 0.010260 0.000024 0.303289 0.070831 0.999 2
length{all}[4] 0.098518 0.009766 0.000109 0.294833 0.068572 0.999 2
length{all}[5] 0.102527 0.010924 0.000001 0.316126 0.069248 1.000 2
length{all}[6] 0.096491 0.009417 0.000044 0.304928 0.065084 1.001 2
length{all}[7] 0.096949 0.007840 0.001124 0.278012 0.072598 1.004 2
length{all}[8] 0.097195 0.010053 0.000230 0.290577 0.057789 1.002 2
length{all}[9] 0.099339 0.009731 0.000153 0.290267 0.063936 0.996 2
length{all}[10] 0.096516 0.010970 0.000180 0.305236 0.064301 0.997 2
length{all}[11] 0.097017 0.009257 0.000449 0.280716 0.068089 0.997 2
length{all}[12] 0.100907 0.012235 0.000034 0.279408 0.067863 0.999 2
length{all}[13] 0.094508 0.006955 0.001026 0.261239 0.071781 0.995 2
length{all}[14] 0.098614 0.012208 0.000038 0.300860 0.064457 0.995 2
length{all}[15] 0.106052 0.011907 0.000100 0.292308 0.075147 0.995 2
length{all}[16] 0.108230 0.011032 0.000713 0.306866 0.078809 1.003 2
length{all}[17] 0.088974 0.006919 0.000551 0.247380 0.061382 1.004 2
length{all}[18] 0.090837 0.008920 0.000553 0.260027 0.063998 0.999 2
length{all}[19] 0.092934 0.008991 0.000000 0.301480 0.064011 0.997 2
length{all}[20] 0.099331 0.011735 0.001260 0.327919 0.065775 0.996 2
length{all}[21] 0.100813 0.008198 0.001092 0.276240 0.072575 1.003 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009353
Maximum standard deviation of split frequencies = 0.023539
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 42 trees
90 % credible set contains 89 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 183
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 32 patterns at 61 / 61 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 32 patterns at 61 / 61 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
31232 bytes for conP
2816 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065523 0.020381 0.028543 0.075585 0.102510 0.091814 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -255.603633
Iterating by ming2
Initial: fx= 255.603633
x= 0.06552 0.02038 0.02854 0.07559 0.10251 0.09181 0.30000 1.30000
1 h-m-p 0.0000 0.0003 146.6650 +++ 248.335917 m 0.0003 14 | 1/8
2 h-m-p 0.0015 0.0255 29.1051 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 134.2191 ++ 245.896854 m 0.0001 45 | 2/8
4 h-m-p 0.0007 0.0334 24.2181 -----------.. | 2/8
5 h-m-p 0.0000 0.0006 119.9707 +++ 236.969202 m 0.0006 77 | 3/8
6 h-m-p 0.0033 0.0517 19.3706 ------------.. | 3/8
7 h-m-p 0.0000 0.0002 104.5925 +++ 235.124073 m 0.0002 110 | 4/8
8 h-m-p 0.0010 0.0950 14.5955 -----------.. | 4/8
9 h-m-p 0.0000 0.0003 85.4518 +++ 233.129279 m 0.0003 142 | 5/8
10 h-m-p 0.0017 0.1415 9.8463 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 60.5660 +++ 232.467592 m 0.0002 174 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 232.467592 m 8.0000 185 | 6/8
13 h-m-p 0.2489 8.0000 0.0000 --Y 232.467592 0 0.0078 200 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 232.467592 m 8.0000 216 | 6/8
15 h-m-p 0.0160 8.0000 0.2588 +++++ 232.467591 m 8.0000 232 | 6/8
16 h-m-p 1.1140 5.7098 1.8582 ++ 232.467578 m 5.7098 245 | 7/8
17 h-m-p 0.1009 0.5044 25.6007 ++ 232.467359 m 0.5044 256 | 8/8
18 h-m-p 0.0160 8.0000 0.0000 Y 232.467359 0 0.0160 267 | 8/8
19 h-m-p 0.0160 8.0000 0.0000 Y 232.467359 0 0.0160 278
Out..
lnL = -232.467359
279 lfun, 279 eigenQcodon, 1674 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.093007 0.094275 0.068697 0.066386 0.055195 0.070456 0.000100 0.568310 0.195788
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.734521
np = 9
lnL0 = -256.699084
Iterating by ming2
Initial: fx= 256.699084
x= 0.09301 0.09427 0.06870 0.06639 0.05519 0.07046 0.00011 0.56831 0.19579
1 h-m-p 0.0000 0.0000 121.9076 ++ 256.615411 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0014 157.8410 ++++ 238.975046 m 0.0014 28 | 2/9
3 h-m-p 0.0000 0.0001 608.1883 ++ 235.990240 m 0.0001 40 | 3/9
4 h-m-p 0.0001 0.0006 30.6512 ++ 235.456954 m 0.0006 52 | 4/9
5 h-m-p 0.0000 0.0000 149.9820 ++ 235.285904 m 0.0000 64 | 5/9
6 h-m-p 0.0000 0.0000 1250.4750 ++ 234.699012 m 0.0000 76 | 6/9
7 h-m-p 0.0000 0.0001 700.6371 ++ 232.505810 m 0.0001 88 | 7/9
8 h-m-p 0.0000 0.0000 4424.3597 ++ 232.467495 m 0.0000 100 | 8/9
9 h-m-p 1.6000 8.0000 0.0001 ++ 232.467494 m 8.0000 112 | 8/9
10 h-m-p 0.0064 3.2057 0.2409 ------------.. | 8/9
11 h-m-p 0.0160 8.0000 0.0003 +++++ 232.467494 m 8.0000 151 | 8/9
12 h-m-p 0.0104 3.3538 0.2310 ------------Y 232.467494 0 0.0000 176 | 8/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 232.467493 m 8.0000 192 | 8/9
14 h-m-p 0.0068 3.3772 0.2296 -----------N 232.467493 0 0.0000 216 | 8/9
15 h-m-p 0.0160 8.0000 0.0002 +++++ 232.467493 m 8.0000 232 | 8/9
16 h-m-p 0.0068 3.3869 0.2293 ------------N 232.467493 0 0.0000 257 | 8/9
17 h-m-p 0.0002 0.0843 2.6516 +++++ 232.467359 m 0.0843 273 | 9/9
18 h-m-p 0.0160 8.0000 0.0000 C 232.467359 0 0.0160 285 | 9/9
19 h-m-p 0.0160 8.0000 0.0000 C 232.467359 0 0.0160 297
Out..
lnL = -232.467359
298 lfun, 894 eigenQcodon, 3576 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.012299 0.097540 0.024315 0.050495 0.031287 0.064438 0.000100 1.474835 0.190536 0.292987 2.253119
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.546178
np = 11
lnL0 = -247.626946
Iterating by ming2
Initial: fx= 247.626946
x= 0.01230 0.09754 0.02432 0.05049 0.03129 0.06444 0.00011 1.47484 0.19054 0.29299 2.25312
1 h-m-p 0.0000 0.0000 121.7962 ++ 247.455496 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0019 51.7453 ++++ 243.240397 m 0.0019 32 | 2/11
3 h-m-p 0.0001 0.0007 39.7076 ++ 240.635826 m 0.0007 46 | 3/11
4 h-m-p 0.0005 0.0026 19.3538 ++ 239.373124 m 0.0026 60 | 4/11
5 h-m-p 0.0001 0.0006 85.2679 ++ 236.837367 m 0.0006 74 | 5/11
6 h-m-p 0.0001 0.0003 248.1227 ++ 235.481668 m 0.0003 88 | 6/11
7 h-m-p 0.0001 0.0006 95.3853 ++ 234.089808 m 0.0006 102 | 7/11
8 h-m-p 0.0206 8.0000 1.8763 -------------.. | 7/11
9 h-m-p 0.0000 0.0005 55.0137 +++ 232.467544 m 0.0005 142 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 232.467544 m 8.0000 156 | 8/11
11 h-m-p 0.0160 8.0000 0.0597 ---------C 232.467544 0 0.0000 182 | 8/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 232.467543 m 8.0000 202 | 8/11
13 h-m-p 0.0005 0.2376 6.1355 +++++ 232.467526 m 0.2376 222 | 9/11
14 h-m-p 1.0580 8.0000 0.7501 +YC 232.467508 1 2.6856 238 | 9/11
15 h-m-p 1.6000 8.0000 0.0959 Y 232.467508 0 0.9796 254 | 9/11
16 h-m-p 1.6000 8.0000 0.0015 C 232.467508 0 2.0550 270 | 9/11
17 h-m-p 1.6000 8.0000 0.0001 ++ 232.467508 m 8.0000 286 | 9/11
18 h-m-p 0.0160 8.0000 0.0782 ++++Y 232.467508 0 2.5641 306 | 9/11
19 h-m-p 1.6000 8.0000 0.0036 ++ 232.467507 m 8.0000 322 | 9/11
20 h-m-p 0.0160 8.0000 2.9812 -------------.. | 9/11
21 h-m-p 0.0160 8.0000 0.0001 +++++ 232.467507 m 8.0000 366 | 9/11
22 h-m-p 0.0160 8.0000 0.5434 -----------N 232.467507 0 0.0000 393 | 9/11
23 h-m-p 0.0160 8.0000 0.0001 +++++ 232.467507 m 8.0000 412 | 9/11
24 h-m-p 0.0160 8.0000 3.0684 -------------.. | 9/11
25 h-m-p 0.0160 8.0000 0.0001 +++++ 232.467507 m 8.0000 456 | 9/11
26 h-m-p 0.0160 8.0000 1.2508 +++++ 232.467359 m 8.0000 475 | 9/11
27 h-m-p 1.6000 8.0000 0.0050 ++ 232.467359 m 8.0000 489 | 9/11
28 h-m-p 0.3344 8.0000 0.1200 +++ 232.467359 m 8.0000 506 | 9/11
29 h-m-p 1.5591 8.0000 0.6159 ++ 232.467359 m 8.0000 522 | 9/11
30 h-m-p 1.6000 8.0000 0.0477 ++ 232.467359 m 8.0000 538 | 9/11
31 h-m-p 0.1936 8.0000 1.9711 ------Y 232.467359 0 0.0000 560 | 9/11
32 h-m-p 1.0263 8.0000 0.0000 N 232.467359 0 1.0263 574 | 9/11
33 h-m-p 1.6000 8.0000 0.0000 N 232.467359 0 1.6000 590 | 9/11
34 h-m-p 0.6930 8.0000 0.0000 --Y 232.467359 0 0.0108 608
Out..
lnL = -232.467359
609 lfun, 2436 eigenQcodon, 10962 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -232.483363 S = -232.467680 -0.006009
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 32 patterns 0:04
did 20 / 32 patterns 0:04
did 30 / 32 patterns 0:04
did 32 / 32 patterns 0:04
Time used: 0:04
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.078986 0.032714 0.031138 0.093635 0.017181 0.074161 0.000100 0.561773 0.097282 0.000050 0.000123 0.000198
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 39.045734
np = 12
lnL0 = -248.296725
Iterating by ming2
Initial: fx= 248.296725
x= 0.07899 0.03271 0.03114 0.09364 0.01718 0.07416 0.00011 0.56177 0.09728 0.00005 0.00012 0.00020
1 h-m-p 0.0000 0.0000 115.6046 ++ 248.273481 m 0.0000 17 | 1/12
2 h-m-p 0.0000 0.0000 785.3509 ++ 248.264502 m 0.0000 32 | 2/12
3 h-m-p 0.0000 0.0000 2181.2632 ++ 248.193950 m 0.0000 47 | 3/12
4 h-m-p 0.0000 0.0000 72.6230 ++ 248.186186 m 0.0000 62 | 4/12
5 h-m-p 0.0000 0.0000 9742.5482 ++ 243.515434 m 0.0000 77 | 5/12
6 h-m-p 0.0253 8.0000 1.4544 -------------.. | 5/12
7 h-m-p 0.0000 0.0003 106.2382 +++ 240.291839 m 0.0003 119 | 6/12
8 h-m-p 0.0144 0.3223 1.8354 -------------.. | 6/12
9 h-m-p 0.0000 0.0000 95.8322 ++ 239.997902 m 0.0000 160 | 7/12
10 h-m-p 0.0160 8.0000 1.1744 -------------.. | 7/12
11 h-m-p 0.0000 0.0009 81.4217 ++++ 233.821926 m 0.0009 203 | 8/12
12 h-m-p 0.0618 8.0000 0.9620 --------------.. | 8/12
13 h-m-p 0.0000 0.0001 70.6192 ++ 233.292148 m 0.0001 249 | 9/12
14 h-m-p 0.0160 8.0000 0.6374 -------------.. | 9/12
15 h-m-p 0.0000 0.0003 49.7028 +++ 232.467359 m 0.0003 294 | 10/12
16 h-m-p 0.0160 8.0000 0.0000 N 232.467359 0 0.0160 309 | 10/12
17 h-m-p 0.0160 8.0000 0.0000 N 232.467359 0 0.0160 326
Out..
lnL = -232.467359
327 lfun, 1308 eigenQcodon, 5886 P(t)
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.015214 0.027039 0.072219 0.046377 0.022235 0.057590 0.000100 0.350095 1.925284
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 23.746720
np = 9
lnL0 = -245.122763
Iterating by ming2
Initial: fx= 245.122763
x= 0.01521 0.02704 0.07222 0.04638 0.02223 0.05759 0.00011 0.35010 1.92528
1 h-m-p 0.0000 0.0000 123.1113 ++ 245.046996 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0142 21.5000 +++++ 240.374685 m 0.0142 29 | 2/9
3 h-m-p 0.0001 0.0005 87.4218 ++ 238.516574 m 0.0005 41 | 3/9
4 h-m-p 0.0000 0.0000 297688.4685 ++ 232.531091 m 0.0000 53 | 4/9
5 h-m-p 0.0001 0.0003 6.4708 ---------.. | 4/9
6 h-m-p 0.0000 0.0000 101.9239 ++ 232.520860 m 0.0000 84 | 5/9
7 h-m-p 0.0160 8.0000 1.1231 -------------.. | 5/9
8 h-m-p 0.0000 0.0000 88.2636 ++ 232.505012 m 0.0000 119 | 6/9
9 h-m-p 0.0160 8.0000 0.9170 -------------.. | 6/9
10 h-m-p 0.0000 0.0000 72.0648 ++ 232.475209 m 0.0000 157 | 7/9
11 h-m-p 0.0160 8.0000 0.6491 -------------.. | 7/9
12 h-m-p 0.0000 0.0000 50.9744 ++ 232.467359 m 0.0000 194 | 8/9
13 h-m-p 0.8776 8.0000 0.0000 +C 232.467359 0 3.5103 207 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 N 232.467359 0 1.6000 220
Out..
lnL = -232.467359
221 lfun, 2431 eigenQcodon, 13260 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.052573 0.074665 0.040300 0.024184 0.094406 0.014275 0.000100 0.900000 0.236576 1.270674 2.163870
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.483113
np = 11
lnL0 = -246.684618
Iterating by ming2
Initial: fx= 246.684618
x= 0.05257 0.07466 0.04030 0.02418 0.09441 0.01428 0.00011 0.90000 0.23658 1.27067 2.16387
1 h-m-p 0.0000 0.0000 98.5577 ++ 246.635710 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0017 54.1725 ++++ 242.743923 m 0.0017 32 | 2/11
3 h-m-p 0.0001 0.0004 84.3214 ++ 240.546888 m 0.0004 46 | 3/11
4 h-m-p 0.0004 0.0021 68.8048 ++ 237.309528 m 0.0021 60 | 4/11
5 h-m-p 0.0010 0.0052 20.6252 ++ 235.992796 m 0.0052 74 | 5/11
6 h-m-p 0.0000 0.0000 119400.8901 ++ 234.868938 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0001 1182.5568 ++ 233.745582 m 0.0001 102 | 7/11
8 h-m-p 0.0045 0.0226 4.2436 ++ 232.467495 m 0.0226 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0002 ++ 232.467495 m 8.0000 130 | 8/11
10 h-m-p 0.0160 8.0000 0.6081 ------------Y 232.467495 0 0.0000 159 | 8/11
11 h-m-p 0.0160 8.0000 0.0003 +++++ 232.467495 m 8.0000 179 | 8/11
12 h-m-p 0.0059 2.9279 0.5214 -----------Y 232.467495 0 0.0000 207 | 8/11
13 h-m-p 0.0160 8.0000 0.0044 +++++ 232.467493 m 8.0000 227 | 8/11
14 h-m-p 0.0678 2.7652 0.5169 --------------.. | 8/11
15 h-m-p 0.0160 8.0000 0.0007 +++++ 232.467489 m 8.0000 276 | 8/11
16 h-m-p 0.0554 8.0000 0.1017 --------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0007 +++++ 232.467484 m 8.0000 325 | 8/11
18 h-m-p 0.0602 8.0000 0.0989 --------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0008 +++++ 232.467479 m 8.0000 374 | 8/11
20 h-m-p 0.0660 8.0000 0.0960 --------------.. | 8/11
21 h-m-p 0.0160 8.0000 0.0008 +++++ 232.467473 m 8.0000 423 | 8/11
22 h-m-p 0.0731 8.0000 0.0930 -------------Y 232.467473 0 0.0000 453 | 8/11
23 h-m-p 0.0160 8.0000 0.0076 +++++ 232.467395 m 8.0000 473 | 8/11
24 h-m-p 0.5519 8.0000 0.1097 ---------------Y 232.467395 0 0.0000 505 | 8/11
25 h-m-p 0.0151 7.5312 0.0030 +++++ 232.467359 m 7.5312 525 | 9/11
26 h-m-p 1.6000 8.0000 0.0000 -----C 232.467359 0 0.0004 547
Out..
lnL = -232.467359
548 lfun, 6576 eigenQcodon, 36168 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -232.488132 S = -232.467680 -0.008996
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 32 patterns 0:18
did 20 / 32 patterns 0:18
did 30 / 32 patterns 0:19
did 32 / 32 patterns 0:19
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=61
NC_011896_1_WP_010908712_1_2226_MLBR_RS10550 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
NC_002677_1_NP_302392_1_1264_ML2091 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV
**************************************************
NC_011896_1_WP_010908712_1_2226_MLBR_RS10550 RLLDGLWGYGL
NC_002677_1_NP_302392_1_1264_ML2091 RLLDGLWGYGL
NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300 RLLDGLWGYGL
NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150 RLLDGLWGYGL
NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425 RLLDGLWGYGL
NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750 RLLDGLWGYGL
***********
>NC_011896_1_WP_010908712_1_2226_MLBR_RS10550 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC AGACTGCTCGACGGGTTATGGGGATATGGCTTA >NC_002677_1_NP_302392_1_1264_ML2091 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC AGACTGCTCGACGGGTTATGGGGATATGGCTTA >NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC AGACTGCTCGACGGGTTATGGGGATATGGCTTA >NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC AGACTGCTCGACGGGTTATGGGGATATGGCTTA >NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC AGACTGCTCGACGGGTTATGGGGATATGGCTTA >NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750 ATGAACCGCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGA GCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCA GGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTC AGACTGCTCGACGGGTTATGGGGATATGGCTTA
>NC_011896_1_WP_010908712_1_2226_MLBR_RS10550 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV RLLDGLWGYGL >NC_002677_1_NP_302392_1_1264_ML2091 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV RLLDGLWGYGL >NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV RLLDGLWGYGL >NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV RLLDGLWGYGL >NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV RLLDGLWGYGL >NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750 MNRPDLVDIWTGDRCGEQGALALCLAGKARVDIRNFRVVDTVCTSDEFMV RLLDGLWGYGL
#NEXUS
[ID: 5351513260]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908712_1_2226_MLBR_RS10550
NC_002677_1_NP_302392_1_1264_ML2091
NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300
NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150
NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425
NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908712_1_2226_MLBR_RS10550,
2 NC_002677_1_NP_302392_1_1264_ML2091,
3 NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300,
4 NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150,
5 NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425,
6 NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06530017,2:0.06370134,3:0.07083126,4:0.06857212,5:0.06924844,6:0.06508364);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06530017,2:0.06370134,3:0.07083126,4:0.06857212,5:0.06924844,6:0.06508364);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -249.72 -254.54
2 -249.73 -253.71
--------------------------------------
TOTAL -249.73 -254.21
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2091/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884017 0.089050 0.361114 1.443666 0.851218 620.49 630.56 1.000
r(A<->C){all} 0.168179 0.018578 0.000001 0.434374 0.139757 121.82 145.85 1.000
r(A<->G){all} 0.157606 0.017011 0.000116 0.417112 0.121464 80.20 82.53 1.001
r(A<->T){all} 0.190473 0.024251 0.000116 0.499902 0.155081 40.30 101.15 1.000
r(C<->G){all} 0.149048 0.014835 0.000059 0.394684 0.119820 61.78 64.81 1.000
r(C<->T){all} 0.165097 0.022816 0.000009 0.480003 0.116315 61.63 89.58 1.004
r(G<->T){all} 0.169597 0.019885 0.000033 0.436970 0.133533 79.87 91.83 1.000
pi(A){all} 0.181769 0.000779 0.126299 0.235468 0.180556 562.34 656.67 1.000
pi(C){all} 0.256331 0.000976 0.191918 0.314328 0.255516 580.18 587.19 1.000
pi(G){all} 0.347398 0.001174 0.284031 0.410877 0.347297 550.72 635.79 1.000
pi(T){all} 0.214502 0.000892 0.152641 0.268272 0.213748 592.67 596.14 0.999
alpha{1,2} 0.400656 0.234640 0.000204 1.331825 0.228808 377.69 523.66 1.001
alpha{3} 0.422064 0.224224 0.000476 1.350289 0.266943 428.23 589.61 1.001
pinvar{all} 0.990197 0.000136 0.968662 0.999992 0.993853 471.86 611.43 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2091/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 61
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 3 3 3 3 3 3
Leu TTA 3 3 3 3 3 3 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 3 3 3 3 3 3 | CCG 0 0 0 0 0 0 | CAG 0 0 0 0 0 0 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 2 2 2 2 2 2 | ACG 0 0 0 0 0 0 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 0 0 0 0 0 0 | Asp GAT 2 2 2 2 2 2 | Gly GGT 0 0 0 0 0 0
GTC 3 3 3 3 3 3 | GCC 2 2 2 2 2 2 | GAC 5 5 5 5 5 5 | GGC 5 5 5 5 5 5
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 2 2 2 2 2 2 | GCG 2 2 2 2 2 2 | GAG 2 2 2 2 2 2 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908712_1_2226_MLBR_RS10550
position 1: T:0.19672 C:0.16393 A:0.21311 G:0.42623
position 2: T:0.32787 C:0.13115 A:0.22951 G:0.31148
position 3: T:0.11475 C:0.47541 A:0.09836 G:0.31148
Average T:0.21311 C:0.25683 A:0.18033 G:0.34973
#2: NC_002677_1_NP_302392_1_1264_ML2091
position 1: T:0.19672 C:0.16393 A:0.21311 G:0.42623
position 2: T:0.32787 C:0.13115 A:0.22951 G:0.31148
position 3: T:0.11475 C:0.47541 A:0.09836 G:0.31148
Average T:0.21311 C:0.25683 A:0.18033 G:0.34973
#3: NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300
position 1: T:0.19672 C:0.16393 A:0.21311 G:0.42623
position 2: T:0.32787 C:0.13115 A:0.22951 G:0.31148
position 3: T:0.11475 C:0.47541 A:0.09836 G:0.31148
Average T:0.21311 C:0.25683 A:0.18033 G:0.34973
#4: NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150
position 1: T:0.19672 C:0.16393 A:0.21311 G:0.42623
position 2: T:0.32787 C:0.13115 A:0.22951 G:0.31148
position 3: T:0.11475 C:0.47541 A:0.09836 G:0.31148
Average T:0.21311 C:0.25683 A:0.18033 G:0.34973
#5: NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425
position 1: T:0.19672 C:0.16393 A:0.21311 G:0.42623
position 2: T:0.32787 C:0.13115 A:0.22951 G:0.31148
position 3: T:0.11475 C:0.47541 A:0.09836 G:0.31148
Average T:0.21311 C:0.25683 A:0.18033 G:0.34973
#6: NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750
position 1: T:0.19672 C:0.16393 A:0.21311 G:0.42623
position 2: T:0.32787 C:0.13115 A:0.22951 G:0.31148
position 3: T:0.11475 C:0.47541 A:0.09836 G:0.31148
Average T:0.21311 C:0.25683 A:0.18033 G:0.34973
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 12 | TCC 0 | TAC 0 | TGC 18
Leu L TTA 18 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 0 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 6
CTC 6 | CCC 0 | CAC 0 | CGC 6
CTA 0 | CCA 0 | Gln Q CAA 6 | CGA 0
CTG 18 | CCG 0 | CAG 0 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 6
ATC 12 | ACC 18 | AAC 12 | AGC 0
ATA 0 | ACA 0 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 12 | ACG 0 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 0 | Asp D GAT 12 | Gly G GGT 0
GTC 18 | GCC 12 | GAC 30 | GGC 30
GTA 0 | GCA 0 | Glu E GAA 0 | GGA 6
GTG 12 | GCG 12 | GAG 12 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19672 C:0.16393 A:0.21311 G:0.42623
position 2: T:0.32787 C:0.13115 A:0.22951 G:0.31148
position 3: T:0.11475 C:0.47541 A:0.09836 G:0.31148
Average T:0.21311 C:0.25683 A:0.18033 G:0.34973
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -232.467359 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908712_1_2226_MLBR_RS10550: 0.000004, NC_002677_1_NP_302392_1_1264_ML2091: 0.000004, NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300: 0.000004, NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150: 0.000004, NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425: 0.000004, NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 148.4 34.6 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 148.4 34.6 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 148.4 34.6 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 148.4 34.6 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 148.4 34.6 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 148.4 34.6 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -232.467359 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908712_1_2226_MLBR_RS10550: 0.000004, NC_002677_1_NP_302392_1_1264_ML2091: 0.000004, NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300: 0.000004, NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150: 0.000004, NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425: 0.000004, NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -232.467359 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908712_1_2226_MLBR_RS10550: 0.000004, NC_002677_1_NP_302392_1_1264_ML2091: 0.000004, NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300: 0.000004, NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150: 0.000004, NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425: 0.000004, NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908712_1_2226_MLBR_RS10550)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -232.467359 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.285125 0.258992 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908712_1_2226_MLBR_RS10550: 0.000004, NC_002677_1_NP_302392_1_1264_ML2091: 0.000004, NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300: 0.000004, NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150: 0.000004, NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425: 0.000004, NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.28512 0.25899 0.45588
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -232.467359 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.934031
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908712_1_2226_MLBR_RS10550: 0.000004, NC_002677_1_NP_302392_1_1264_ML2091: 0.000004, NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300: 0.000004, NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150: 0.000004, NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425: 0.000004, NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.93403
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -232.467359 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.375885 2.305308
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908712_1_2226_MLBR_RS10550: 0.000004, NC_002677_1_NP_302392_1_1264_ML2091: 0.000004, NZ_LVXE01000049_1_WP_010908712_1_2011_A3216_RS11300: 0.000004, NZ_LYPH01000056_1_WP_010908712_1_2126_A8144_RS10150: 0.000004, NZ_CP029543_1_WP_010908712_1_2246_DIJ64_RS11425: 0.000004, NZ_AP014567_1_WP_010908712_1_2311_JK2ML_RS11750: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.37588
(p1 = 0.00001) w = 2.30531
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.30531
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 148.4 34.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908712_1_2226_MLBR_RS10550)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.099 0.099 0.099 0.100 0.100 0.101 0.101 0.101 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:19
Model 1: NearlyNeutral -232.467359 Model 2: PositiveSelection -232.467359 Model 0: one-ratio -232.467359 Model 3: discrete -232.467359 Model 7: beta -232.467359 Model 8: beta&w>1 -232.467359 Model 0 vs 1 0.0 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
