--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:59:45 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2151/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.38 -705.96
2 -702.41 -705.33
--------------------------------------
TOTAL -702.39 -705.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.911656 0.096813 0.348168 1.525815 0.873717 695.06 723.03 1.001
r(A<->C){all} 0.197807 0.023986 0.000038 0.495866 0.162081 46.20 67.24 1.001
r(A<->G){all} 0.179999 0.023572 0.000180 0.490866 0.137931 55.52 96.85 1.023
r(A<->T){all} 0.164434 0.020429 0.000029 0.465313 0.120254 78.71 88.50 1.002
r(C<->G){all} 0.162080 0.020647 0.000244 0.462343 0.121937 121.67 138.65 1.004
r(C<->T){all} 0.156126 0.017614 0.000153 0.426231 0.118188 84.96 138.05 1.006
r(G<->T){all} 0.139554 0.012414 0.000003 0.362579 0.113890 65.54 75.52 0.999
pi(A){all} 0.198172 0.000312 0.168082 0.235737 0.198160 628.44 688.61 1.000
pi(C){all} 0.342478 0.000437 0.302997 0.385630 0.341734 517.75 607.47 0.999
pi(G){all} 0.297867 0.000398 0.258522 0.335923 0.297571 585.54 668.27 1.002
pi(T){all} 0.161483 0.000253 0.131312 0.192975 0.161113 594.03 648.38 1.000
alpha{1,2} 0.419948 0.244740 0.000125 1.382229 0.259446 564.35 584.41 1.004
alpha{3} 0.481986 0.254383 0.000232 1.441250 0.329692 539.31 566.24 1.001
pinvar{all} 0.997036 0.000012 0.990388 0.999996 0.998161 513.92 579.56 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -692.257167
Model 2: PositiveSelection -692.257109
Model 0: one-ratio -692.257109
Model 3: discrete -692.257109
Model 7: beta -692.257206
Model 8: beta&w>1 -692.257109
Model 0 vs 1 1.1599999993450183E-4
Model 2 vs 1 1.1599999993450183E-4
Model 8 vs 7 1.9399999996494444E-4
>C1
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
>C2
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
>C3
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
>C4
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
>C5
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
>C6
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=174
C1 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
C2 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
C3 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
C4 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
C5 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
C6 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
**************************************************
C1 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
C2 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
C3 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
C4 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
C5 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
C6 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
**************************************************
C1 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
C2 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
C3 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
C4 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
C5 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
C6 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
**************************************************
C1 APPQPPADNFPPTPGDVPSPLARP
C2 APPQPPADNFPPTPGDVPSPLARP
C3 APPQPPADNFPPTPGDVPSPLARP
C4 APPQPPADNFPPTPGDVPSPLARP
C5 APPQPPADNFPPTPGDVPSPLARP
C6 APPQPPADNFPPTPGDVPSPLARP
************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 174 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 174 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5220]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5220]--->[5220]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.473 Mb, Max= 30.712 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
C2 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
C3 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
C4 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
C5 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
C6 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
**************************************************
C1 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
C2 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
C3 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
C4 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
C5 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
C6 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
**************************************************
C1 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
C2 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
C3 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
C4 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
C5 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
C6 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
**************************************************
C1 APPQPPADNFPPTPGDVPSPLARP
C2 APPQPPADNFPPTPGDVPSPLARP
C3 APPQPPADNFPPTPGDVPSPLARP
C4 APPQPPADNFPPTPGDVPSPLARP
C5 APPQPPADNFPPTPGDVPSPLARP
C6 APPQPPADNFPPTPGDVPSPLARP
************************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
C2 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
C3 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
C4 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
C5 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
C6 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
**************************************************
C1 AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
C2 AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
C3 AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
C4 AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
C5 AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
C6 AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
**************************************************
C1 AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
C2 AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
C3 AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
C4 AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
C5 AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
C6 AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
**************************************************
C1 TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
C2 TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
C3 TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
C4 TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
C5 TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
C6 TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
**************************************************
C1 GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
C2 GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
C3 GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
C4 GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
C5 GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
C6 GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
**************************************************
C1 CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
C2 CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
C3 CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
C4 CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
C5 CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
C6 CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
**************************************************
C1 GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
C2 GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
C3 GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
C4 GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
C5 GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
C6 GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
**************************************************
C1 ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
C2 ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
C3 ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
C4 ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
C5 ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
C6 ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
**************************************************
C1 GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
C2 GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
C3 GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
C4 GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
C5 GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
C6 GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
**************************************************
C1 GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
C2 GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
C3 GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
C4 GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
C5 GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
C6 GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
**************************************************
C1 ACCCTCACCCCTGGCGCGACCT
C2 ACCCTCACCCCTGGCGCGACCT
C3 ACCCTCACCCCTGGCGCGACCT
C4 ACCCTCACCCCTGGCGCGACCT
C5 ACCCTCACCCCTGGCGCGACCT
C6 ACCCTCACCCCTGGCGCGACCT
**********************
>C1
ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
ACCCTCACCCCTGGCGCGACCT
>C2
ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
ACCCTCACCCCTGGCGCGACCT
>C3
ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
ACCCTCACCCCTGGCGCGACCT
>C4
ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
ACCCTCACCCCTGGCGCGACCT
>C5
ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
ACCCTCACCCCTGGCGCGACCT
>C6
ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA
AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC
AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG
TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT
GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC
CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC
GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT
ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT
GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC
GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT
ACCCTCACCCCTGGCGCGACCT
>C1
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
>C2
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
>C3
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
>C4
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
>C5
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
>C6
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
APPQPPADNFPPTPGDVPSPLARP
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 522 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856337
Setting output file names to "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 798471085
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5153100948
Seed = 1557134526
Swapseed = 1579856337
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1168.261028 -- -24.965149
Chain 2 -- -1168.261028 -- -24.965149
Chain 3 -- -1168.261028 -- -24.965149
Chain 4 -- -1168.261028 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1168.260850 -- -24.965149
Chain 2 -- -1168.261028 -- -24.965149
Chain 3 -- -1168.260962 -- -24.965149
Chain 4 -- -1168.260962 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-1168.261] (-1168.261) (-1168.261) (-1168.261) * [-1168.261] (-1168.261) (-1168.261) (-1168.261)
500 -- [-713.657] (-713.263) (-730.426) (-715.480) * (-714.014) [-713.726] (-716.382) (-725.561) -- 0:00:00
1000 -- (-712.035) (-707.918) [-707.519] (-707.460) * (-717.632) [-706.365] (-711.570) (-709.439) -- 0:00:00
1500 -- (-720.835) (-716.768) (-713.990) [-712.047] * (-713.598) (-711.487) [-712.895] (-708.086) -- 0:00:00
2000 -- (-709.332) (-710.151) [-717.563] (-712.531) * [-707.968] (-714.783) (-715.482) (-711.438) -- 0:00:00
2500 -- (-717.618) (-713.982) (-709.810) [-721.808] * [-711.365] (-723.038) (-715.434) (-709.996) -- 0:00:00
3000 -- (-708.945) (-719.668) (-712.366) [-708.993] * [-717.572] (-714.518) (-706.135) (-709.165) -- 0:00:00
3500 -- (-719.948) (-715.386) (-711.008) [-707.964] * (-715.008) (-715.433) (-712.329) [-712.207] -- 0:00:00
4000 -- (-712.905) (-712.818) (-706.337) [-710.691] * (-710.391) (-714.648) [-710.333] (-715.731) -- 0:00:00
4500 -- (-722.628) (-714.019) [-720.509] (-714.278) * (-713.913) (-712.752) [-714.275] (-715.707) -- 0:00:00
5000 -- [-713.468] (-704.651) (-710.516) (-712.963) * (-714.606) (-713.932) (-710.332) [-710.249] -- 0:00:00
Average standard deviation of split frequencies: 0.095647
5500 -- (-712.370) (-714.340) (-715.050) [-709.258] * (-708.112) [-708.398] (-709.039) (-714.475) -- 0:00:00
6000 -- (-718.350) [-712.217] (-713.884) (-711.104) * (-714.898) (-712.254) [-712.511] (-714.429) -- 0:00:00
6500 -- (-709.630) (-713.411) (-712.813) [-711.469] * [-713.148] (-714.714) (-718.663) (-707.275) -- 0:00:00
7000 -- (-711.235) [-715.148] (-715.316) (-711.058) * (-711.613) (-711.759) [-711.738] (-715.584) -- 0:00:00
7500 -- (-712.782) (-713.158) [-717.732] (-705.026) * (-719.798) [-717.553] (-709.157) (-710.077) -- 0:00:00
8000 -- [-706.028] (-712.068) (-708.972) (-704.562) * [-708.836] (-717.688) (-711.472) (-709.341) -- 0:00:00
8500 -- (-708.231) [-711.696] (-711.028) (-708.938) * (-708.531) (-711.658) (-708.011) [-708.838] -- 0:00:00
9000 -- (-717.466) (-710.490) [-722.466] (-707.051) * (-714.652) (-714.142) (-706.524) [-714.166] -- 0:00:00
9500 -- (-708.002) (-710.113) (-711.058) [-704.725] * [-709.519] (-725.101) (-710.815) (-716.087) -- 0:00:51
10000 -- (-709.388) [-710.352] (-712.575) (-702.667) * [-711.243] (-703.576) (-710.102) (-711.709) -- 0:00:49
Average standard deviation of split frequencies: 0.075130
10500 -- (-717.418) (-713.076) [-711.174] (-703.856) * [-710.023] (-705.391) (-713.000) (-709.685) -- 0:00:46
11000 -- [-707.945] (-722.244) (-714.558) (-702.546) * (-717.340) [-706.749] (-719.884) (-709.408) -- 0:00:44
11500 -- (-714.125) [-710.286] (-713.858) (-703.348) * (-702.471) [-707.821] (-713.335) (-710.137) -- 0:00:42
12000 -- (-715.991) (-715.958) [-709.756] (-705.134) * (-702.820) (-704.525) [-713.793] (-707.865) -- 0:00:40
12500 -- [-713.792] (-712.520) (-713.348) (-705.711) * (-702.735) (-703.150) (-713.962) [-709.755] -- 0:00:39
13000 -- (-718.981) (-718.032) (-723.219) [-705.903] * (-703.185) (-702.181) [-713.013] (-716.177) -- 0:00:37
13500 -- (-717.636) [-711.906] (-711.969) (-705.229) * [-703.541] (-702.472) (-707.534) (-708.772) -- 0:00:36
14000 -- (-712.721) [-710.500] (-712.085) (-702.140) * (-703.153) (-702.864) [-720.280] (-714.928) -- 0:00:34
14500 -- [-712.445] (-709.988) (-712.859) (-702.387) * (-705.294) (-705.577) [-717.498] (-707.644) -- 0:00:33
15000 -- (-718.294) (-713.410) (-710.770) [-703.293] * (-701.955) (-702.904) (-708.686) [-709.934] -- 0:00:32
Average standard deviation of split frequencies: 0.052378
15500 -- (-711.272) (-708.964) [-711.054] (-704.076) * (-702.802) (-704.572) (-708.529) [-719.938] -- 0:00:31
16000 -- (-707.592) (-707.729) (-719.334) [-703.276] * (-701.873) (-704.785) [-705.966] (-708.471) -- 0:00:30
16500 -- (-710.480) [-715.041] (-708.512) (-703.305) * [-702.200] (-706.239) (-718.516) (-707.822) -- 0:00:29
17000 -- (-707.654) (-715.899) [-713.022] (-702.624) * (-705.613) (-702.645) (-715.078) [-711.544] -- 0:00:28
17500 -- [-715.231] (-712.078) (-713.404) (-704.465) * (-702.348) [-703.307] (-711.902) (-712.461) -- 0:00:27
18000 -- [-709.099] (-719.471) (-711.728) (-704.515) * (-701.720) (-703.038) (-709.716) [-712.801] -- 0:00:26
18500 -- [-714.588] (-713.920) (-707.807) (-702.487) * (-701.157) (-701.636) (-716.195) [-712.060] -- 0:00:26
19000 -- [-705.568] (-711.504) (-708.374) (-702.552) * (-702.122) [-700.973] (-718.030) (-711.680) -- 0:00:25
19500 -- (-722.075) [-714.791] (-706.988) (-702.910) * (-702.642) (-705.187) (-722.276) [-709.783] -- 0:00:24
20000 -- [-715.213] (-710.553) (-721.446) (-703.897) * (-703.673) (-702.336) [-718.493] (-720.596) -- 0:00:24
Average standard deviation of split frequencies: 0.069771
20500 -- [-710.633] (-708.523) (-710.347) (-705.264) * (-704.441) [-702.593] (-711.372) (-722.094) -- 0:00:23
21000 -- (-712.342) (-714.721) (-712.763) [-703.469] * (-705.579) [-703.120] (-712.506) (-713.921) -- 0:00:22
21500 -- (-713.028) [-719.782] (-710.127) (-705.484) * (-702.719) (-702.904) (-724.161) [-701.517] -- 0:00:22
22000 -- [-708.485] (-716.293) (-714.062) (-705.558) * (-704.458) (-703.349) [-712.129] (-701.562) -- 0:00:21
22500 -- [-704.188] (-713.989) (-708.481) (-702.727) * (-705.318) (-702.426) [-702.428] (-710.425) -- 0:00:21
23000 -- (-712.208) [-709.280] (-708.670) (-705.678) * [-706.839] (-704.093) (-701.715) (-704.723) -- 0:00:20
23500 -- [-714.866] (-709.792) (-715.010) (-702.554) * [-707.103] (-702.774) (-701.737) (-701.512) -- 0:00:20
24000 -- (-708.109) (-713.606) [-710.606] (-703.110) * (-704.886) [-702.518] (-703.777) (-702.052) -- 0:00:19
24500 -- (-712.898) [-709.997] (-711.257) (-701.642) * (-701.916) [-702.644] (-702.515) (-703.737) -- 0:00:19
25000 -- (-707.140) (-713.004) [-707.802] (-700.788) * (-702.824) (-703.954) [-704.582] (-703.946) -- 0:00:19
Average standard deviation of split frequencies: 0.051920
25500 -- [-708.388] (-713.576) (-710.081) (-701.113) * (-700.986) (-703.519) (-703.251) [-702.924] -- 0:00:18
26000 -- (-715.315) (-709.543) (-714.542) [-701.418] * (-701.988) (-701.540) [-703.732] (-702.062) -- 0:00:36
26500 -- (-715.256) (-715.942) [-708.366] (-701.706) * (-702.150) (-702.322) (-704.339) [-701.356] -- 0:00:35
27000 -- [-708.485] (-714.583) (-711.892) (-702.643) * (-704.333) (-702.158) (-703.483) [-704.760] -- 0:00:35
27500 -- (-710.974) (-720.735) [-717.017] (-701.858) * [-703.114] (-704.379) (-703.008) (-703.468) -- 0:00:34
28000 -- (-704.277) (-723.688) [-714.285] (-703.250) * [-704.348] (-702.379) (-703.176) (-702.951) -- 0:00:33
28500 -- (-707.710) [-711.773] (-710.317) (-703.521) * [-702.419] (-703.689) (-704.361) (-702.042) -- 0:00:33
29000 -- (-706.085) (-702.898) (-718.771) [-703.005] * (-706.512) (-701.666) [-705.715] (-703.993) -- 0:00:32
29500 -- [-705.945] (-705.514) (-709.317) (-703.446) * (-702.847) (-705.304) [-702.991] (-703.382) -- 0:00:31
30000 -- (-702.953) [-702.943] (-710.432) (-703.457) * (-706.553) (-706.493) [-703.129] (-705.062) -- 0:00:31
Average standard deviation of split frequencies: 0.057828
30500 -- (-703.667) [-703.027] (-710.964) (-704.692) * (-704.949) (-703.670) [-705.268] (-705.465) -- 0:00:30
31000 -- [-701.238] (-704.275) (-715.772) (-704.267) * [-703.903] (-703.286) (-702.690) (-703.009) -- 0:00:30
31500 -- (-703.024) (-703.534) [-707.732] (-703.084) * (-701.826) (-700.810) [-701.973] (-701.512) -- 0:00:29
32000 -- (-702.486) (-702.992) [-709.230] (-701.881) * [-701.939] (-708.064) (-702.263) (-702.739) -- 0:00:29
32500 -- [-702.426] (-701.981) (-712.622) (-702.267) * (-703.398) (-708.394) (-703.685) [-701.619] -- 0:00:28
33000 -- [-703.483] (-701.322) (-717.487) (-704.662) * (-702.880) (-704.584) [-703.118] (-701.986) -- 0:00:28
33500 -- (-703.254) (-701.350) (-710.469) [-704.641] * (-705.735) (-701.087) (-701.680) [-703.699] -- 0:00:27
34000 -- (-705.217) [-702.298] (-712.912) (-708.118) * (-703.962) [-700.966] (-701.659) (-703.888) -- 0:00:27
34500 -- (-706.544) [-701.522] (-715.763) (-707.707) * (-704.475) [-702.766] (-702.730) (-701.856) -- 0:00:26
35000 -- (-707.561) [-703.769] (-716.690) (-701.725) * (-702.716) (-707.181) [-702.877] (-706.726) -- 0:00:26
Average standard deviation of split frequencies: 0.053757
35500 -- (-708.921) (-704.142) [-716.396] (-707.174) * (-704.100) (-701.948) (-702.333) [-705.783] -- 0:00:26
36000 -- (-706.001) [-701.261] (-716.988) (-705.860) * (-705.499) (-704.896) [-702.624] (-705.501) -- 0:00:25
36500 -- (-702.784) (-701.118) (-722.133) [-703.758] * (-704.031) [-703.864] (-704.564) (-707.273) -- 0:00:25
37000 -- (-702.814) (-702.022) [-709.774] (-702.094) * (-707.073) (-702.023) [-702.817] (-711.480) -- 0:00:25
37500 -- (-701.830) (-707.631) (-706.098) [-702.899] * (-703.257) [-706.066] (-703.520) (-701.803) -- 0:00:24
38000 -- (-702.600) (-703.438) [-709.458] (-702.518) * [-703.152] (-707.763) (-702.521) (-702.627) -- 0:00:24
38500 -- (-701.692) (-704.839) [-713.506] (-703.614) * (-702.152) [-701.632] (-702.603) (-705.623) -- 0:00:23
39000 -- [-701.400] (-703.649) (-713.221) (-702.528) * [-702.493] (-701.212) (-705.829) (-703.027) -- 0:00:23
39500 -- (-701.595) [-702.623] (-710.590) (-705.282) * (-701.235) (-703.477) (-702.506) [-700.750] -- 0:00:23
40000 -- [-701.662] (-702.945) (-717.622) (-702.941) * [-701.279] (-704.260) (-703.340) (-701.909) -- 0:00:23
Average standard deviation of split frequencies: 0.049418
40500 -- (-702.250) [-702.866] (-725.304) (-702.966) * (-701.420) [-702.648] (-701.550) (-702.106) -- 0:00:22
41000 -- (-705.290) [-704.533] (-709.845) (-709.761) * (-705.651) (-705.072) [-702.260] (-707.829) -- 0:00:22
41500 -- [-704.204] (-704.642) (-711.002) (-702.656) * (-702.685) (-705.420) [-702.854] (-702.541) -- 0:00:22
42000 -- [-703.904] (-700.979) (-722.317) (-703.344) * (-708.102) [-707.509] (-703.053) (-702.900) -- 0:00:21
42500 -- (-708.175) (-705.058) [-704.843] (-704.716) * [-702.349] (-706.275) (-702.459) (-704.607) -- 0:00:32
43000 -- [-704.265] (-710.700) (-702.840) (-706.174) * [-702.540] (-704.106) (-705.445) (-705.492) -- 0:00:31
43500 -- (-708.794) (-702.081) (-702.765) [-708.440] * (-702.097) (-706.120) (-702.933) [-703.182] -- 0:00:31
44000 -- (-702.064) (-702.326) [-702.428] (-706.565) * (-704.932) [-703.256] (-701.604) (-702.083) -- 0:00:31
44500 -- (-705.848) (-702.051) [-703.282] (-702.409) * (-702.320) (-704.661) (-702.094) [-702.363] -- 0:00:30
45000 -- (-707.146) [-701.339] (-703.717) (-704.979) * (-706.456) [-704.648] (-702.781) (-706.997) -- 0:00:30
Average standard deviation of split frequencies: 0.032901
45500 -- (-705.379) (-703.364) [-703.727] (-705.245) * [-710.632] (-701.808) (-703.097) (-703.085) -- 0:00:29
46000 -- (-704.201) (-701.815) (-706.125) [-705.803] * (-710.072) (-704.384) [-703.896] (-703.179) -- 0:00:29
46500 -- (-704.217) (-705.064) [-703.221] (-704.388) * [-705.888] (-702.082) (-705.810) (-702.893) -- 0:00:29
47000 -- (-703.314) [-704.662] (-703.879) (-707.331) * [-704.376] (-706.494) (-705.422) (-704.902) -- 0:00:28
47500 -- (-705.255) (-705.667) [-704.121] (-703.624) * (-704.155) (-705.434) (-703.827) [-702.348] -- 0:00:28
48000 -- (-705.596) (-709.949) (-701.496) [-702.698] * (-705.900) (-704.501) (-702.811) [-703.186] -- 0:00:28
48500 -- (-703.639) (-706.827) [-707.628] (-704.925) * (-703.208) (-703.773) [-703.320] (-703.950) -- 0:00:27
49000 -- (-707.220) (-703.006) [-702.813] (-703.057) * [-702.434] (-706.281) (-706.253) (-702.234) -- 0:00:27
49500 -- (-704.766) (-702.383) [-702.444] (-704.004) * (-707.207) (-700.945) (-706.391) [-703.534] -- 0:00:27
50000 -- (-704.753) [-702.217] (-707.235) (-703.688) * (-701.792) (-702.123) [-702.565] (-701.546) -- 0:00:27
Average standard deviation of split frequencies: 0.033960
50500 -- [-705.331] (-703.889) (-701.964) (-706.625) * (-701.659) (-704.044) (-702.625) [-705.944] -- 0:00:26
51000 -- (-708.391) [-703.743] (-701.716) (-706.752) * (-701.220) (-701.206) (-703.855) [-702.049] -- 0:00:26
51500 -- [-703.623] (-702.050) (-702.616) (-707.145) * (-703.985) [-702.307] (-702.777) (-702.911) -- 0:00:26
52000 -- (-702.913) [-703.132] (-702.296) (-706.968) * (-700.979) (-702.576) [-701.547] (-702.797) -- 0:00:25
52500 -- [-702.367] (-701.181) (-707.269) (-705.096) * (-701.646) (-703.255) [-701.056] (-702.766) -- 0:00:25
53000 -- [-701.064] (-702.570) (-701.747) (-702.282) * [-702.501] (-702.771) (-701.447) (-703.806) -- 0:00:25
53500 -- (-701.912) (-703.051) [-703.177] (-702.911) * (-701.911) (-701.759) [-702.283] (-702.724) -- 0:00:25
54000 -- (-702.075) (-703.023) [-703.093] (-703.516) * [-702.064] (-702.925) (-702.404) (-702.598) -- 0:00:24
54500 -- (-702.126) (-703.549) [-709.182] (-702.661) * (-703.393) (-701.407) (-706.951) [-702.805] -- 0:00:24
55000 -- [-701.655] (-703.766) (-703.848) (-707.369) * (-704.516) [-701.281] (-701.144) (-701.563) -- 0:00:24
Average standard deviation of split frequencies: 0.033229
55500 -- (-706.942) (-701.388) (-706.853) [-702.474] * (-701.395) (-703.782) (-703.281) [-702.174] -- 0:00:24
56000 -- (-702.176) (-703.186) [-703.293] (-705.413) * (-703.514) [-702.015] (-701.854) (-703.016) -- 0:00:23
56500 -- [-701.716] (-707.676) (-704.229) (-703.257) * (-701.695) (-703.914) [-703.575] (-702.850) -- 0:00:23
57000 -- (-703.352) [-705.733] (-705.297) (-704.257) * (-703.352) (-703.293) [-703.789] (-701.824) -- 0:00:23
57500 -- (-702.611) (-704.428) (-701.779) [-706.014] * (-704.288) [-700.875] (-705.291) (-703.136) -- 0:00:30
58000 -- [-702.077] (-703.829) (-704.512) (-704.934) * [-703.162] (-701.572) (-703.559) (-701.066) -- 0:00:30
58500 -- (-706.325) (-706.734) [-701.847] (-701.521) * [-701.873] (-700.937) (-704.216) (-701.278) -- 0:00:30
59000 -- [-702.589] (-704.651) (-704.357) (-705.422) * (-705.662) (-701.821) [-705.368] (-704.451) -- 0:00:29
59500 -- (-702.924) [-706.636] (-701.890) (-705.488) * (-704.534) (-702.512) [-707.891] (-701.179) -- 0:00:29
60000 -- (-701.290) [-701.524] (-703.082) (-705.761) * [-702.622] (-703.974) (-703.089) (-703.044) -- 0:00:29
Average standard deviation of split frequencies: 0.032717
60500 -- (-701.469) (-700.887) [-703.189] (-703.090) * [-702.346] (-705.145) (-702.422) (-701.997) -- 0:00:29
61000 -- (-706.776) (-704.520) [-705.564] (-702.456) * [-703.153] (-702.611) (-706.162) (-702.483) -- 0:00:28
61500 -- (-703.282) [-701.613] (-706.188) (-704.217) * [-704.190] (-704.338) (-703.613) (-703.403) -- 0:00:28
62000 -- (-707.411) [-701.985] (-701.385) (-702.850) * (-701.535) (-703.585) [-702.987] (-701.628) -- 0:00:28
62500 -- (-702.573) [-703.176] (-701.628) (-702.230) * (-702.522) (-701.694) [-702.803] (-704.652) -- 0:00:28
63000 -- (-702.552) [-702.744] (-701.978) (-701.083) * (-705.966) (-705.758) [-702.270] (-701.988) -- 0:00:27
63500 -- (-703.796) (-701.088) (-704.869) [-701.413] * (-703.037) (-704.199) [-702.350] (-705.914) -- 0:00:27
64000 -- [-701.306] (-702.374) (-706.980) (-702.607) * (-705.791) [-704.331] (-709.098) (-706.979) -- 0:00:27
64500 -- [-703.118] (-701.021) (-703.990) (-704.122) * (-706.787) (-703.217) [-703.265] (-703.999) -- 0:00:27
65000 -- (-702.323) (-703.471) [-703.016] (-702.947) * (-706.508) [-703.269] (-700.819) (-706.312) -- 0:00:26
Average standard deviation of split frequencies: 0.032651
65500 -- (-702.127) [-703.271] (-704.077) (-702.076) * [-701.871] (-702.543) (-701.172) (-708.880) -- 0:00:26
66000 -- (-703.982) (-701.848) [-706.165] (-701.413) * (-703.885) [-702.096] (-702.245) (-706.250) -- 0:00:26
66500 -- [-702.494] (-705.495) (-705.749) (-703.328) * [-703.733] (-706.402) (-703.797) (-701.826) -- 0:00:26
67000 -- (-704.742) (-703.660) (-703.017) [-702.584] * [-703.069] (-704.866) (-702.925) (-703.342) -- 0:00:25
67500 -- (-703.800) (-701.053) (-702.287) [-701.839] * [-705.536] (-702.825) (-703.199) (-702.035) -- 0:00:25
68000 -- [-702.933] (-702.070) (-703.674) (-702.698) * (-706.662) [-702.769] (-702.701) (-706.215) -- 0:00:25
68500 -- (-702.070) (-704.507) (-703.042) [-702.251] * (-701.820) (-703.514) [-704.552] (-703.442) -- 0:00:25
69000 -- (-701.860) [-703.419] (-703.291) (-702.687) * (-703.003) (-702.812) (-703.475) [-703.577] -- 0:00:24
69500 -- [-702.103] (-705.403) (-703.797) (-704.754) * (-702.082) (-704.196) [-703.769] (-702.105) -- 0:00:24
70000 -- (-708.393) (-704.990) [-702.549] (-702.843) * [-705.564] (-703.541) (-704.804) (-701.790) -- 0:00:24
Average standard deviation of split frequencies: 0.028645
70500 -- (-705.298) [-702.252] (-704.092) (-701.961) * (-702.470) (-703.155) [-702.884] (-701.903) -- 0:00:24
71000 -- (-705.602) (-708.393) (-705.580) [-702.439] * (-702.222) (-702.553) (-702.081) [-702.466] -- 0:00:24
71500 -- (-702.887) (-706.546) [-702.612] (-703.036) * (-704.147) (-702.270) [-702.560] (-707.893) -- 0:00:23
72000 -- (-704.390) [-701.375] (-707.420) (-702.763) * (-704.379) [-702.644] (-702.863) (-701.949) -- 0:00:23
72500 -- (-702.637) [-703.245] (-706.567) (-702.895) * [-703.267] (-702.272) (-702.132) (-703.220) -- 0:00:29
73000 -- (-703.485) (-703.634) (-704.370) [-701.500] * (-703.667) [-703.926] (-701.836) (-702.112) -- 0:00:29
73500 -- (-703.551) [-702.376] (-706.867) (-708.302) * (-701.474) [-705.310] (-701.639) (-703.056) -- 0:00:29
74000 -- [-702.352] (-704.867) (-707.616) (-703.886) * (-702.612) [-703.604] (-702.083) (-706.428) -- 0:00:28
74500 -- (-705.134) [-703.433] (-703.041) (-708.355) * (-704.333) (-702.024) (-701.625) [-707.027] -- 0:00:28
75000 -- (-704.138) (-703.562) [-703.223] (-705.734) * [-703.721] (-707.822) (-700.866) (-702.110) -- 0:00:28
Average standard deviation of split frequencies: 0.031378
75500 -- [-704.216] (-705.091) (-703.828) (-703.666) * (-702.425) (-706.154) [-702.025] (-703.515) -- 0:00:28
76000 -- (-702.892) (-705.278) [-701.864] (-704.584) * (-704.233) (-705.672) (-702.559) [-700.937] -- 0:00:27
76500 -- [-703.075] (-703.177) (-702.021) (-704.472) * (-703.358) (-704.660) (-701.019) [-702.566] -- 0:00:27
77000 -- (-704.094) [-702.919] (-701.765) (-701.896) * (-704.764) [-706.400] (-703.059) (-705.200) -- 0:00:27
77500 -- (-702.785) (-706.202) [-706.347] (-703.702) * (-708.402) (-702.343) (-702.069) [-703.045] -- 0:00:27
78000 -- (-704.365) (-705.486) [-703.044] (-702.711) * [-704.878] (-701.676) (-700.742) (-704.387) -- 0:00:27
78500 -- [-702.224] (-707.626) (-702.057) (-704.134) * [-705.387] (-702.856) (-707.076) (-703.025) -- 0:00:26
79000 -- (-702.387) (-703.092) (-702.086) [-702.710] * (-704.532) (-703.407) [-703.351] (-704.693) -- 0:00:26
79500 -- (-706.993) [-702.185] (-703.061) (-702.746) * [-704.046] (-703.176) (-701.939) (-703.477) -- 0:00:26
80000 -- (-702.650) [-702.730] (-705.809) (-706.675) * (-707.573) (-702.623) (-703.354) [-702.302] -- 0:00:26
Average standard deviation of split frequencies: 0.029907
80500 -- (-702.574) (-703.515) [-704.258] (-704.095) * (-706.644) (-702.231) (-703.302) [-702.435] -- 0:00:26
81000 -- (-702.761) (-701.915) (-702.363) [-704.066] * (-702.736) (-702.697) (-703.406) [-702.261] -- 0:00:25
81500 -- [-702.576] (-703.238) (-702.135) (-704.820) * (-702.880) [-701.180] (-701.508) (-702.108) -- 0:00:25
82000 -- [-704.289] (-702.243) (-702.936) (-709.735) * [-701.966] (-701.180) (-701.287) (-704.219) -- 0:00:25
82500 -- (-704.278) (-702.435) (-703.962) [-701.532] * (-702.301) [-704.272] (-705.226) (-701.904) -- 0:00:25
83000 -- (-701.928) (-702.350) [-701.719] (-707.597) * (-702.583) (-701.821) (-702.144) [-702.543] -- 0:00:25
83500 -- [-702.186] (-700.923) (-702.352) (-703.462) * (-708.164) (-703.412) (-702.629) [-701.400] -- 0:00:24
84000 -- (-701.553) [-700.920] (-703.522) (-703.626) * (-701.766) (-704.449) (-703.360) [-701.731] -- 0:00:24
84500 -- (-700.887) [-703.363] (-705.305) (-704.508) * (-702.046) (-707.002) (-704.325) [-702.629] -- 0:00:24
85000 -- (-701.039) (-702.254) (-702.736) [-702.974] * (-702.331) (-703.311) (-702.509) [-704.793] -- 0:00:24
Average standard deviation of split frequencies: 0.029539
85500 -- [-706.338] (-702.297) (-703.591) (-703.182) * (-704.268) [-703.380] (-704.105) (-711.078) -- 0:00:24
86000 -- (-701.403) [-702.821] (-705.645) (-706.190) * (-706.435) (-706.139) (-705.494) [-701.807] -- 0:00:24
86500 -- (-707.612) (-701.943) (-700.839) [-704.311] * [-702.440] (-707.228) (-703.423) (-702.500) -- 0:00:23
87000 -- (-707.846) [-702.294] (-705.085) (-704.665) * (-703.162) [-703.055] (-705.253) (-704.641) -- 0:00:23
87500 -- [-703.247] (-701.776) (-706.263) (-703.779) * (-700.960) (-701.344) [-703.642] (-703.358) -- 0:00:23
88000 -- (-705.643) (-702.875) (-711.629) [-704.912] * (-703.131) [-702.693] (-702.642) (-702.399) -- 0:00:23
88500 -- (-702.624) (-702.227) (-708.868) [-703.282] * (-703.830) [-701.273] (-701.897) (-702.178) -- 0:00:23
89000 -- (-704.761) (-702.114) [-702.830] (-701.879) * (-703.978) [-703.982] (-706.964) (-703.275) -- 0:00:27
89500 -- (-703.292) (-703.775) [-702.800] (-703.088) * (-703.993) [-701.669] (-704.801) (-700.980) -- 0:00:27
90000 -- (-705.112) [-703.425] (-701.348) (-703.541) * (-704.459) (-701.765) [-701.620] (-701.256) -- 0:00:27
Average standard deviation of split frequencies: 0.028885
90500 -- (-705.140) [-702.431] (-702.009) (-704.827) * [-702.807] (-702.430) (-705.225) (-702.470) -- 0:00:27
91000 -- [-705.794] (-702.693) (-702.651) (-702.297) * [-701.449] (-704.572) (-705.962) (-708.060) -- 0:00:26
91500 -- [-705.175] (-703.201) (-702.288) (-701.507) * (-703.532) (-708.193) (-703.190) [-703.848] -- 0:00:26
92000 -- [-703.604] (-703.786) (-704.445) (-702.403) * (-701.682) (-704.909) [-701.390] (-703.129) -- 0:00:26
92500 -- (-702.750) (-702.498) (-703.886) [-702.333] * (-702.297) [-702.915] (-702.460) (-707.614) -- 0:00:26
93000 -- (-702.868) (-705.716) [-702.118] (-702.322) * (-702.677) [-703.274] (-703.210) (-703.231) -- 0:00:26
93500 -- [-702.485] (-706.164) (-702.101) (-703.129) * (-707.552) (-707.127) [-702.589] (-702.430) -- 0:00:26
94000 -- (-705.737) (-705.525) (-702.016) [-702.159] * (-701.762) (-704.808) [-703.008] (-703.812) -- 0:00:25
94500 -- [-703.388] (-703.119) (-702.313) (-701.295) * [-701.598] (-704.890) (-704.129) (-702.146) -- 0:00:25
95000 -- (-701.630) [-702.366] (-702.454) (-701.699) * (-703.392) [-703.823] (-701.873) (-710.883) -- 0:00:25
Average standard deviation of split frequencies: 0.024552
95500 -- [-703.750] (-704.828) (-703.954) (-701.973) * [-702.503] (-700.992) (-701.679) (-704.923) -- 0:00:25
96000 -- (-701.785) (-707.673) (-703.950) [-702.692] * (-703.396) [-702.521] (-701.274) (-703.898) -- 0:00:25
96500 -- (-708.464) (-704.055) (-704.688) [-702.328] * (-703.222) (-703.884) (-701.360) [-703.740] -- 0:00:25
97000 -- (-702.576) [-702.486] (-701.161) (-702.893) * (-703.470) (-706.228) [-703.041] (-705.371) -- 0:00:24
97500 -- (-702.584) (-702.145) [-705.909] (-706.212) * (-702.006) (-708.985) (-705.077) [-702.960] -- 0:00:24
98000 -- (-702.593) (-701.342) [-701.176] (-706.222) * (-703.134) (-701.388) (-705.967) [-701.353] -- 0:00:24
98500 -- (-701.326) (-703.856) (-702.037) [-702.726] * (-707.143) [-702.960] (-705.990) (-704.187) -- 0:00:24
99000 -- (-703.934) (-703.017) [-702.352] (-703.413) * [-706.206] (-706.040) (-707.435) (-702.642) -- 0:00:24
99500 -- (-703.146) [-702.013] (-702.670) (-703.384) * (-705.962) (-702.508) [-703.957] (-702.815) -- 0:00:24
100000 -- (-707.009) (-704.281) [-704.746] (-704.323) * (-703.406) [-703.148] (-702.608) (-702.548) -- 0:00:24
Average standard deviation of split frequencies: 0.023414
100500 -- (-702.679) (-704.205) (-702.435) [-701.478] * (-704.352) (-702.432) [-703.500] (-702.683) -- 0:00:23
101000 -- [-703.975] (-701.143) (-702.908) (-706.096) * (-702.058) (-703.861) (-702.760) [-701.393] -- 0:00:23
101500 -- (-704.881) (-701.488) (-703.013) [-703.653] * (-702.131) (-701.218) (-702.557) [-701.868] -- 0:00:23
102000 -- (-703.631) [-704.379] (-703.343) (-702.112) * (-704.177) (-702.398) (-702.617) [-701.759] -- 0:00:23
102500 -- (-702.205) [-702.438] (-702.891) (-706.247) * [-701.128] (-702.136) (-703.864) (-703.718) -- 0:00:23
103000 -- (-702.628) (-702.792) [-709.388] (-703.689) * [-702.365] (-702.233) (-703.237) (-703.575) -- 0:00:23
103500 -- (-704.870) (-702.399) (-704.229) [-703.179] * (-702.784) (-704.300) [-701.556] (-701.681) -- 0:00:22
104000 -- (-701.580) [-702.465] (-702.777) (-702.258) * (-704.542) [-704.826] (-705.752) (-701.773) -- 0:00:22
104500 -- (-701.356) (-703.880) (-701.814) [-702.527] * (-701.987) (-705.318) (-702.044) [-704.639] -- 0:00:22
105000 -- (-707.467) (-702.805) (-705.022) [-703.151] * [-701.550] (-703.671) (-711.074) (-703.325) -- 0:00:22
Average standard deviation of split frequencies: 0.022470
105500 -- (-703.151) [-703.030] (-703.208) (-702.608) * (-701.713) (-706.173) (-704.451) [-703.576] -- 0:00:26
106000 -- (-703.126) (-702.195) (-702.042) [-703.046] * (-702.659) [-702.736] (-701.373) (-701.883) -- 0:00:26
106500 -- (-703.140) (-701.670) (-703.004) [-701.733] * (-704.932) (-701.684) [-701.175] (-703.215) -- 0:00:25
107000 -- [-703.494] (-706.302) (-700.750) (-704.694) * (-706.945) (-702.233) [-701.690] (-701.765) -- 0:00:25
107500 -- (-707.608) [-704.853] (-701.460) (-702.750) * (-703.394) [-702.231] (-702.754) (-704.152) -- 0:00:25
108000 -- [-701.890] (-701.655) (-700.774) (-703.703) * [-701.074] (-703.057) (-704.201) (-701.896) -- 0:00:25
108500 -- (-704.701) [-702.226] (-709.158) (-705.361) * [-703.120] (-702.029) (-703.270) (-702.599) -- 0:00:25
109000 -- (-703.443) (-702.929) (-704.483) [-704.207] * (-709.300) (-703.881) [-705.022] (-702.117) -- 0:00:25
109500 -- (-701.927) (-703.679) [-702.200] (-703.303) * (-712.481) [-703.350] (-702.012) (-703.673) -- 0:00:24
110000 -- (-702.115) (-704.025) [-700.872] (-701.565) * (-706.026) (-704.996) (-704.981) [-704.043] -- 0:00:24
Average standard deviation of split frequencies: 0.021535
110500 -- (-706.125) (-703.416) [-701.394] (-702.418) * (-703.366) [-704.988] (-703.929) (-702.538) -- 0:00:24
111000 -- [-703.545] (-706.025) (-701.231) (-702.159) * (-701.775) (-703.959) [-704.166] (-706.366) -- 0:00:24
111500 -- (-704.051) (-705.633) (-703.608) [-705.346] * (-707.691) [-702.732] (-703.929) (-703.750) -- 0:00:24
112000 -- (-702.196) (-703.185) (-710.679) [-701.882] * (-706.745) (-707.302) [-704.905] (-700.966) -- 0:00:24
112500 -- (-702.348) (-705.214) [-703.594] (-703.095) * (-701.512) [-703.257] (-711.427) (-702.100) -- 0:00:24
113000 -- (-702.962) (-704.153) [-710.438] (-702.234) * (-702.243) (-702.525) (-703.672) [-703.792] -- 0:00:23
113500 -- (-703.196) (-704.777) [-702.056] (-701.231) * (-702.214) (-703.828) (-701.638) [-702.292] -- 0:00:23
114000 -- [-702.588] (-703.888) (-701.539) (-701.883) * (-705.693) (-703.925) (-701.393) [-702.557] -- 0:00:23
114500 -- (-702.069) (-703.882) (-701.975) [-706.582] * [-704.132] (-704.629) (-702.894) (-701.750) -- 0:00:23
115000 -- [-701.948] (-702.838) (-704.515) (-703.114) * (-702.093) (-701.786) [-702.309] (-705.815) -- 0:00:23
Average standard deviation of split frequencies: 0.020093
115500 -- [-702.785] (-702.327) (-702.655) (-701.695) * (-703.917) (-703.254) (-703.555) [-702.779] -- 0:00:23
116000 -- (-701.391) [-702.500] (-704.703) (-703.859) * (-705.451) [-702.167] (-706.322) (-703.909) -- 0:00:23
116500 -- (-701.807) [-701.260] (-702.030) (-702.037) * (-704.015) (-703.089) [-708.306] (-700.898) -- 0:00:23
117000 -- [-703.314] (-704.598) (-701.892) (-701.983) * (-703.329) (-702.325) (-709.775) [-706.050] -- 0:00:22
117500 -- (-704.674) (-703.347) [-701.651] (-701.815) * (-703.483) [-702.108] (-704.869) (-706.519) -- 0:00:22
118000 -- (-702.714) [-703.166] (-703.820) (-702.295) * (-702.013) (-703.349) [-702.201] (-703.168) -- 0:00:22
118500 -- (-706.502) (-706.287) [-702.355] (-703.058) * [-702.966] (-706.696) (-702.073) (-703.233) -- 0:00:22
119000 -- [-705.078] (-707.066) (-702.246) (-702.655) * (-708.729) (-705.052) [-706.153] (-705.345) -- 0:00:22
119500 -- (-703.684) [-708.235] (-704.272) (-707.489) * [-702.803] (-705.887) (-702.161) (-702.521) -- 0:00:22
120000 -- [-701.958] (-703.459) (-704.062) (-704.257) * (-703.684) [-702.932] (-701.612) (-703.302) -- 0:00:22
Average standard deviation of split frequencies: 0.019304
120500 -- (-704.296) (-704.524) [-702.513] (-704.893) * (-701.703) (-702.057) (-707.134) [-705.743] -- 0:00:22
121000 -- (-702.475) [-702.578] (-702.582) (-704.051) * (-704.693) (-701.915) [-701.453] (-702.840) -- 0:00:21
121500 -- [-700.751] (-704.622) (-707.183) (-703.791) * (-702.682) (-702.597) [-701.524] (-701.339) -- 0:00:21
122000 -- [-701.153] (-702.957) (-707.650) (-707.468) * (-705.483) (-705.610) [-701.704] (-707.157) -- 0:00:24
122500 -- (-703.753) [-706.413] (-704.604) (-702.720) * (-706.057) (-701.780) [-703.130] (-702.886) -- 0:00:24
123000 -- (-702.963) [-703.233] (-704.088) (-701.830) * (-704.074) (-702.056) [-704.342] (-705.777) -- 0:00:24
123500 -- (-703.602) [-701.967] (-701.574) (-703.181) * (-706.428) (-701.812) (-701.505) [-704.024] -- 0:00:24
124000 -- (-703.142) (-702.289) [-705.724] (-703.213) * (-702.782) (-705.214) (-701.367) [-702.039] -- 0:00:24
124500 -- (-701.491) (-701.368) [-702.867] (-704.740) * [-703.086] (-705.176) (-706.196) (-702.555) -- 0:00:24
125000 -- [-701.799] (-701.249) (-701.817) (-702.545) * (-701.746) (-702.214) [-702.109] (-704.576) -- 0:00:24
Average standard deviation of split frequencies: 0.018313
125500 -- (-701.254) (-704.102) (-702.189) [-702.165] * (-702.079) (-702.012) [-708.703] (-706.837) -- 0:00:23
126000 -- [-701.647] (-702.673) (-705.281) (-702.913) * [-702.870] (-703.916) (-702.779) (-703.155) -- 0:00:23
126500 -- (-702.543) [-703.260] (-703.676) (-703.566) * (-711.697) [-703.267] (-701.600) (-706.037) -- 0:00:23
127000 -- (-713.095) (-706.232) [-703.720] (-707.074) * [-703.335] (-702.406) (-702.290) (-703.958) -- 0:00:23
127500 -- (-701.729) (-701.095) (-703.579) [-705.470] * (-703.837) [-702.014] (-703.012) (-702.396) -- 0:00:23
128000 -- (-704.742) (-704.944) (-703.124) [-705.901] * (-705.090) (-703.776) [-701.771] (-701.163) -- 0:00:23
128500 -- (-704.006) (-702.233) (-704.529) [-708.591] * (-702.751) [-705.438] (-704.361) (-703.603) -- 0:00:23
129000 -- (-702.996) (-703.457) [-700.954] (-705.185) * (-704.093) [-706.686] (-702.168) (-704.785) -- 0:00:23
129500 -- (-703.631) [-706.254] (-701.075) (-705.217) * (-702.848) [-705.018] (-701.800) (-706.484) -- 0:00:22
130000 -- (-700.863) [-703.215] (-701.818) (-705.022) * (-705.065) (-704.710) (-702.749) [-702.188] -- 0:00:22
Average standard deviation of split frequencies: 0.015834
130500 -- (-700.996) (-707.465) (-701.668) [-702.272] * (-702.539) (-706.125) (-702.940) [-707.210] -- 0:00:22
131000 -- [-701.469] (-705.512) (-705.158) (-701.455) * (-702.393) [-703.657] (-701.440) (-704.642) -- 0:00:22
131500 -- (-702.309) (-706.169) [-703.271] (-709.641) * (-703.906) [-704.334] (-702.127) (-706.318) -- 0:00:22
132000 -- (-702.086) (-701.808) [-702.154] (-704.389) * [-702.885] (-702.487) (-703.068) (-704.035) -- 0:00:22
132500 -- (-702.723) (-701.484) [-701.548] (-704.809) * [-702.961] (-702.055) (-701.876) (-703.257) -- 0:00:22
133000 -- (-704.015) [-703.121] (-701.721) (-703.173) * [-702.623] (-703.113) (-703.143) (-703.509) -- 0:00:22
133500 -- [-702.666] (-707.671) (-702.377) (-702.617) * (-702.021) [-701.589] (-704.058) (-703.435) -- 0:00:21
134000 -- (-702.265) (-702.686) [-701.837] (-704.267) * (-705.509) [-702.667] (-703.354) (-704.128) -- 0:00:21
134500 -- (-701.847) [-702.434] (-701.729) (-704.297) * (-703.598) (-704.431) (-703.601) [-702.596] -- 0:00:21
135000 -- (-702.455) (-701.228) (-707.860) [-703.243] * (-702.898) (-701.789) [-703.064] (-705.266) -- 0:00:21
Average standard deviation of split frequencies: 0.017149
135500 -- (-703.009) (-703.327) [-703.916] (-701.589) * [-704.529] (-702.698) (-702.105) (-705.991) -- 0:00:21
136000 -- [-705.824] (-701.909) (-705.236) (-702.289) * (-703.565) [-702.924] (-703.766) (-706.010) -- 0:00:21
136500 -- (-704.075) [-701.505] (-702.654) (-704.927) * (-703.903) (-703.012) (-703.187) [-703.756] -- 0:00:21
137000 -- (-704.075) (-701.631) (-700.922) [-702.894] * (-704.931) (-704.118) (-708.559) [-703.648] -- 0:00:21
137500 -- (-704.648) [-702.182] (-703.969) (-702.156) * (-701.172) (-701.127) (-706.216) [-703.225] -- 0:00:23
138000 -- [-702.727] (-703.037) (-702.172) (-701.236) * (-701.166) [-704.548] (-702.737) (-701.164) -- 0:00:23
138500 -- [-701.775] (-702.202) (-703.472) (-703.109) * (-703.269) (-701.792) [-708.228] (-702.449) -- 0:00:23
139000 -- (-701.318) [-701.812] (-702.989) (-705.247) * (-702.354) [-706.660] (-701.863) (-703.114) -- 0:00:23
139500 -- (-703.212) (-700.959) [-702.384] (-702.307) * (-702.862) (-705.507) (-702.578) [-702.353] -- 0:00:23
140000 -- (-703.931) (-702.366) [-702.018] (-703.942) * (-703.856) (-703.264) (-703.802) [-701.740] -- 0:00:23
Average standard deviation of split frequencies: 0.016756
140500 -- (-703.755) (-702.886) [-701.287] (-704.716) * (-703.110) (-702.922) [-704.010] (-703.521) -- 0:00:23
141000 -- (-705.523) [-703.253] (-701.089) (-703.323) * [-703.964] (-709.591) (-702.449) (-705.261) -- 0:00:22
141500 -- (-706.348) (-702.549) (-702.038) [-702.524] * (-704.303) [-702.354] (-701.936) (-705.397) -- 0:00:22
142000 -- [-704.679] (-702.608) (-701.194) (-702.723) * [-704.327] (-704.645) (-703.353) (-701.988) -- 0:00:22
142500 -- (-704.505) (-701.316) [-701.464] (-702.366) * (-705.014) [-701.797] (-703.465) (-702.141) -- 0:00:22
143000 -- (-703.388) (-703.144) [-702.542] (-704.552) * (-701.721) [-702.799] (-703.053) (-702.400) -- 0:00:22
143500 -- (-704.039) [-703.368] (-702.962) (-702.745) * [-702.766] (-702.766) (-703.711) (-701.701) -- 0:00:22
144000 -- (-703.955) (-702.041) (-704.014) [-702.560] * (-703.668) (-701.597) [-702.259] (-702.466) -- 0:00:22
144500 -- [-708.964] (-702.895) (-702.496) (-702.048) * (-703.040) (-701.093) (-702.318) [-702.076] -- 0:00:22
145000 -- (-707.678) (-703.723) (-702.689) [-704.319] * [-700.944] (-701.944) (-703.550) (-701.127) -- 0:00:22
Average standard deviation of split frequencies: 0.017334
145500 -- (-705.494) [-703.600] (-701.812) (-702.682) * (-701.706) (-701.077) (-705.477) [-703.274] -- 0:00:21
146000 -- (-703.851) (-702.760) [-703.630] (-701.955) * (-702.671) (-701.390) (-704.244) [-703.361] -- 0:00:21
146500 -- (-706.796) (-701.504) (-702.383) [-705.028] * [-703.776] (-701.472) (-708.181) (-704.119) -- 0:00:21
147000 -- (-703.826) (-700.962) [-703.171] (-702.929) * [-703.739] (-702.844) (-700.919) (-703.969) -- 0:00:21
147500 -- (-703.309) (-700.962) [-703.070] (-702.282) * (-704.049) (-702.714) (-701.028) [-701.882] -- 0:00:21
148000 -- (-704.222) (-702.205) (-702.693) [-701.257] * (-701.914) (-702.916) (-704.328) [-706.918] -- 0:00:21
148500 -- (-702.438) [-702.493] (-701.450) (-702.350) * (-704.075) (-703.129) (-709.040) [-703.053] -- 0:00:21
149000 -- [-703.996] (-701.488) (-702.854) (-701.676) * (-706.344) (-705.207) [-702.433] (-702.736) -- 0:00:21
149500 -- (-703.036) [-701.518] (-703.962) (-703.353) * (-703.361) (-702.743) (-702.886) [-703.483] -- 0:00:21
150000 -- (-701.763) [-701.077] (-706.065) (-702.714) * (-701.585) (-702.810) (-706.614) [-701.522] -- 0:00:21
Average standard deviation of split frequencies: 0.017556
150500 -- [-701.264] (-702.630) (-706.112) (-702.452) * (-703.361) [-702.635] (-704.585) (-703.798) -- 0:00:20
151000 -- (-701.365) (-705.628) (-701.250) [-703.831] * (-702.002) (-704.246) [-702.721] (-712.669) -- 0:00:20
151500 -- (-703.928) (-704.755) (-701.727) [-704.906] * (-704.957) [-701.180] (-705.835) (-707.930) -- 0:00:20
152000 -- (-703.260) (-701.699) (-701.140) [-702.656] * (-705.779) [-703.590] (-702.461) (-702.814) -- 0:00:20
152500 -- (-701.661) [-702.373] (-705.135) (-702.848) * [-703.444] (-702.663) (-700.994) (-706.273) -- 0:00:20
153000 -- [-702.667] (-705.146) (-701.937) (-703.937) * (-703.109) (-703.382) (-701.474) [-704.356] -- 0:00:20
153500 -- (-702.457) [-706.133] (-705.028) (-704.923) * (-701.660) (-704.168) [-702.640] (-703.756) -- 0:00:22
154000 -- [-703.377] (-703.217) (-703.494) (-701.398) * [-702.477] (-704.113) (-702.699) (-701.619) -- 0:00:22
154500 -- [-701.675] (-701.420) (-703.574) (-702.886) * [-701.802] (-702.616) (-704.340) (-702.320) -- 0:00:22
155000 -- [-701.193] (-704.017) (-707.218) (-703.565) * (-703.318) [-703.014] (-701.598) (-701.911) -- 0:00:22
Average standard deviation of split frequencies: 0.015820
155500 -- (-701.119) (-702.669) (-702.586) [-703.333] * (-704.636) (-703.401) (-704.029) [-703.399] -- 0:00:22
156000 -- [-701.978] (-707.063) (-704.561) (-706.305) * [-702.463] (-703.648) (-704.857) (-708.479) -- 0:00:22
156500 -- [-702.041] (-702.785) (-704.834) (-704.614) * [-704.743] (-702.263) (-701.862) (-704.763) -- 0:00:21
157000 -- [-703.232] (-705.229) (-705.883) (-705.431) * (-702.542) [-702.445] (-702.196) (-702.087) -- 0:00:21
157500 -- [-701.986] (-705.366) (-709.207) (-703.267) * (-701.041) [-702.158] (-701.950) (-703.683) -- 0:00:21
158000 -- [-700.904] (-702.405) (-705.192) (-701.786) * [-701.122] (-704.929) (-702.832) (-702.659) -- 0:00:21
158500 -- (-701.540) (-705.833) (-703.379) [-703.250] * (-701.508) (-704.664) [-703.599] (-702.367) -- 0:00:21
159000 -- (-701.151) [-704.857] (-701.392) (-702.904) * (-701.076) (-704.311) [-703.419] (-703.436) -- 0:00:21
159500 -- (-701.101) (-706.225) (-701.310) [-701.552] * [-702.028] (-702.698) (-702.876) (-702.863) -- 0:00:21
160000 -- (-701.372) (-702.429) [-701.217] (-703.647) * (-700.845) [-702.695] (-705.962) (-704.203) -- 0:00:21
Average standard deviation of split frequencies: 0.015906
160500 -- (-701.917) (-703.528) [-701.129] (-702.179) * (-702.501) [-702.929] (-702.755) (-701.142) -- 0:00:21
161000 -- (-701.990) (-703.978) [-701.176] (-701.088) * (-702.214) (-706.906) [-702.717] (-702.080) -- 0:00:21
161500 -- (-702.714) [-701.962] (-702.342) (-704.063) * [-703.265] (-705.429) (-704.382) (-702.698) -- 0:00:20
162000 -- [-704.684] (-701.926) (-702.659) (-703.925) * (-704.135) (-704.387) [-701.990] (-705.240) -- 0:00:20
162500 -- (-703.098) [-701.337] (-703.991) (-702.561) * [-703.395] (-701.861) (-703.053) (-702.952) -- 0:00:20
163000 -- [-705.057] (-702.516) (-701.022) (-702.354) * (-702.728) (-702.188) [-701.376] (-706.242) -- 0:00:20
163500 -- [-705.014] (-701.523) (-701.439) (-704.333) * (-704.264) [-703.433] (-701.718) (-709.423) -- 0:00:20
164000 -- [-704.896] (-703.184) (-704.421) (-706.137) * (-704.396) (-702.994) [-701.857] (-703.109) -- 0:00:20
164500 -- [-706.872] (-704.453) (-702.136) (-703.193) * (-706.362) (-703.772) (-702.742) [-702.371] -- 0:00:20
165000 -- (-710.296) (-708.810) [-707.200] (-703.766) * (-704.711) [-706.836] (-704.191) (-704.164) -- 0:00:20
Average standard deviation of split frequencies: 0.014199
165500 -- (-702.776) (-703.022) [-703.237] (-702.477) * (-704.195) (-703.645) [-703.832] (-705.871) -- 0:00:20
166000 -- (-704.757) (-703.879) [-703.030] (-701.759) * [-702.275] (-702.847) (-702.743) (-703.391) -- 0:00:20
166500 -- (-701.459) (-701.032) (-706.418) [-703.323] * (-701.412) (-701.917) [-701.872] (-702.181) -- 0:00:20
167000 -- (-701.839) (-701.301) (-702.464) [-702.001] * (-703.743) [-701.680] (-701.603) (-701.822) -- 0:00:19
167500 -- (-704.307) (-701.070) (-705.625) [-703.510] * (-704.587) (-701.735) [-702.296] (-706.875) -- 0:00:19
168000 -- [-702.337] (-701.894) (-702.993) (-702.058) * (-702.360) (-709.375) [-701.564] (-703.115) -- 0:00:19
168500 -- [-702.061] (-706.333) (-702.163) (-704.362) * (-703.824) (-702.231) [-701.078] (-705.734) -- 0:00:19
169000 -- (-702.137) (-702.527) (-704.185) [-701.831] * (-701.801) (-703.903) [-701.577] (-707.217) -- 0:00:19
169500 -- (-701.424) (-703.492) (-703.494) [-701.628] * (-701.861) [-705.630] (-704.656) (-703.584) -- 0:00:21
170000 -- (-701.665) (-704.133) (-712.714) [-703.612] * (-701.298) [-703.544] (-705.067) (-704.593) -- 0:00:21
Average standard deviation of split frequencies: 0.014118
170500 -- (-704.697) (-706.577) (-703.289) [-701.764] * (-702.797) (-701.249) (-701.439) [-705.010] -- 0:00:21
171000 -- (-703.547) (-703.859) (-703.904) [-702.400] * (-702.582) (-701.501) [-703.554] (-702.379) -- 0:00:21
171500 -- (-702.844) (-703.602) [-704.568] (-703.165) * [-702.715] (-702.246) (-704.210) (-704.237) -- 0:00:21
172000 -- (-701.934) (-706.539) (-705.978) [-702.442] * (-704.299) [-703.381] (-703.879) (-708.529) -- 0:00:20
172500 -- [-704.209] (-702.510) (-703.959) (-702.653) * (-701.750) [-701.822] (-701.813) (-708.746) -- 0:00:20
173000 -- [-702.260] (-701.709) (-703.627) (-702.193) * (-701.884) [-702.878] (-701.734) (-704.036) -- 0:00:20
173500 -- [-702.365] (-700.907) (-702.328) (-703.262) * (-702.331) (-701.974) [-701.625] (-704.124) -- 0:00:20
174000 -- (-703.480) (-705.741) [-702.378] (-702.460) * [-707.986] (-703.600) (-702.278) (-707.166) -- 0:00:20
174500 -- [-702.705] (-701.458) (-704.020) (-702.405) * (-702.555) (-704.760) (-701.949) [-701.977] -- 0:00:20
175000 -- (-703.647) [-701.192] (-702.917) (-706.568) * (-702.201) (-702.780) (-703.399) [-704.482] -- 0:00:20
Average standard deviation of split frequencies: 0.014022
175500 -- [-703.552] (-701.430) (-702.152) (-703.661) * (-701.552) (-702.349) (-704.140) [-705.414] -- 0:00:20
176000 -- (-704.093) (-701.806) (-703.279) [-705.323] * (-704.322) (-701.837) (-703.996) [-702.139] -- 0:00:20
176500 -- (-701.716) (-704.274) [-704.190] (-709.990) * (-704.728) (-702.364) (-706.481) [-703.893] -- 0:00:20
177000 -- (-701.006) [-700.772] (-704.200) (-704.350) * (-702.405) (-702.298) (-706.921) [-702.169] -- 0:00:20
177500 -- [-701.249] (-700.826) (-701.856) (-701.674) * (-703.914) (-703.356) (-703.262) [-703.323] -- 0:00:19
178000 -- (-700.948) (-702.117) (-703.716) [-702.702] * (-704.740) (-703.354) (-702.303) [-701.661] -- 0:00:19
178500 -- (-703.449) [-700.764] (-703.175) (-702.676) * (-702.677) [-704.837] (-704.933) (-702.381) -- 0:00:19
179000 -- (-702.614) (-705.284) (-701.986) [-703.424] * (-701.063) (-705.486) (-707.386) [-702.208] -- 0:00:19
179500 -- (-702.367) (-704.364) [-702.641] (-703.972) * (-701.227) (-702.025) [-701.827] (-702.623) -- 0:00:19
180000 -- (-705.649) [-703.265] (-702.398) (-706.231) * (-706.571) (-704.617) (-702.466) [-703.554] -- 0:00:19
Average standard deviation of split frequencies: 0.013660
180500 -- (-700.783) [-701.423] (-703.837) (-703.191) * (-711.348) (-706.896) (-705.781) [-702.293] -- 0:00:19
181000 -- (-701.656) (-701.350) (-704.484) [-702.258] * [-704.336] (-703.075) (-706.207) (-704.231) -- 0:00:19
181500 -- [-700.700] (-704.813) (-705.330) (-702.803) * (-703.864) [-704.466] (-706.830) (-704.781) -- 0:00:19
182000 -- [-701.553] (-702.373) (-703.542) (-703.671) * [-701.922] (-702.182) (-705.311) (-705.445) -- 0:00:19
182500 -- [-702.618] (-700.992) (-702.632) (-703.215) * (-703.284) (-702.592) [-705.877] (-704.345) -- 0:00:19
183000 -- (-702.060) (-701.747) [-702.821] (-706.470) * (-701.958) (-701.645) (-704.217) [-703.352] -- 0:00:19
183500 -- (-700.997) [-703.801] (-701.182) (-702.582) * (-701.318) [-703.323] (-704.223) (-702.863) -- 0:00:18
184000 -- [-702.315] (-702.004) (-702.614) (-701.773) * (-710.559) (-703.618) (-702.130) [-702.257] -- 0:00:18
184500 -- (-706.008) (-703.800) (-703.564) [-703.835] * (-703.835) (-701.997) [-702.983] (-703.093) -- 0:00:18
185000 -- [-704.628] (-704.231) (-702.550) (-702.757) * (-703.637) (-704.252) (-701.806) [-702.314] -- 0:00:20
Average standard deviation of split frequencies: 0.013658
185500 -- (-703.606) [-703.618] (-702.437) (-704.959) * (-703.235) [-704.522] (-706.682) (-704.649) -- 0:00:20
186000 -- (-705.291) [-701.604] (-706.240) (-702.311) * (-705.388) (-703.164) [-704.437] (-702.522) -- 0:00:20
186500 -- (-705.577) [-701.907] (-701.687) (-703.699) * [-705.617] (-703.100) (-704.565) (-701.222) -- 0:00:20
187000 -- (-706.727) (-702.513) [-705.348] (-701.102) * (-702.905) [-704.524] (-704.061) (-702.765) -- 0:00:20
187500 -- (-709.213) [-700.917] (-703.837) (-704.746) * (-707.556) (-703.550) (-703.603) [-703.414] -- 0:00:20
188000 -- (-703.353) (-705.503) [-702.389] (-702.977) * (-702.403) (-703.610) (-701.051) [-704.008] -- 0:00:19
188500 -- (-705.218) [-704.242] (-706.832) (-703.804) * [-702.873] (-706.097) (-701.975) (-703.702) -- 0:00:19
189000 -- (-703.649) (-702.391) (-703.926) [-706.451] * (-708.536) [-702.676] (-701.907) (-701.564) -- 0:00:19
189500 -- [-703.615] (-705.724) (-705.354) (-701.944) * [-702.833] (-708.277) (-704.384) (-704.290) -- 0:00:19
190000 -- (-704.388) [-703.747] (-704.615) (-703.055) * [-704.611] (-702.155) (-706.298) (-703.096) -- 0:00:19
Average standard deviation of split frequencies: 0.013323
190500 -- (-702.783) [-703.632] (-702.238) (-704.742) * [-703.015] (-704.849) (-701.264) (-705.775) -- 0:00:19
191000 -- [-705.749] (-704.924) (-701.653) (-701.822) * (-705.002) [-709.584] (-704.158) (-712.000) -- 0:00:19
191500 -- (-701.831) (-706.815) [-701.681] (-701.806) * (-704.518) (-701.564) (-704.074) [-703.406] -- 0:00:19
192000 -- (-703.463) [-706.048] (-701.535) (-702.133) * [-701.132] (-703.568) (-704.628) (-706.132) -- 0:00:19
192500 -- (-707.207) (-701.973) [-701.515] (-702.789) * (-704.261) (-702.138) (-703.429) [-703.159] -- 0:00:19
193000 -- (-707.277) [-704.054] (-703.247) (-705.757) * (-706.171) (-700.805) (-702.361) [-702.399] -- 0:00:19
193500 -- (-707.174) (-703.097) (-705.984) [-705.055] * (-702.230) [-702.732] (-702.567) (-704.387) -- 0:00:19
194000 -- (-701.481) (-700.960) [-705.657] (-707.012) * (-701.422) (-712.541) [-700.755] (-702.714) -- 0:00:18
194500 -- [-706.944] (-700.702) (-705.993) (-701.701) * (-701.283) [-707.169] (-704.057) (-706.338) -- 0:00:18
195000 -- [-702.179] (-702.797) (-703.982) (-705.241) * [-702.520] (-704.050) (-702.369) (-703.394) -- 0:00:18
Average standard deviation of split frequencies: 0.012026
195500 -- [-701.738] (-706.666) (-705.108) (-704.369) * (-707.298) [-702.288] (-706.027) (-702.884) -- 0:00:18
196000 -- [-702.527] (-702.994) (-700.972) (-703.645) * (-705.217) [-703.457] (-705.309) (-702.772) -- 0:00:18
196500 -- (-703.862) (-703.365) [-703.831] (-703.390) * (-704.023) (-702.986) [-702.234] (-704.299) -- 0:00:18
197000 -- (-704.394) [-703.438] (-701.569) (-707.131) * (-703.331) (-708.024) (-703.977) [-703.676] -- 0:00:18
197500 -- [-703.117] (-702.993) (-702.406) (-701.988) * (-707.436) (-703.007) (-704.168) [-702.507] -- 0:00:18
198000 -- (-703.813) (-703.394) [-701.987] (-705.208) * (-707.824) [-703.181] (-703.696) (-702.185) -- 0:00:18
198500 -- (-703.641) (-709.987) [-702.309] (-702.639) * (-706.622) [-702.627] (-703.441) (-701.629) -- 0:00:18
199000 -- (-702.476) (-707.903) [-702.169] (-702.779) * (-704.880) [-702.475] (-702.276) (-701.772) -- 0:00:18
199500 -- [-701.996] (-702.394) (-701.116) (-703.838) * (-707.164) (-705.032) (-702.359) [-701.878] -- 0:00:18
200000 -- (-702.394) (-702.661) (-702.393) [-701.250] * [-703.731] (-702.315) (-705.192) (-704.113) -- 0:00:18
Average standard deviation of split frequencies: 0.012575
200500 -- (-703.795) [-707.731] (-701.381) (-701.226) * (-703.551) [-703.405] (-703.112) (-702.553) -- 0:00:19
201000 -- (-703.746) (-704.439) (-702.768) [-703.057] * (-703.373) (-701.426) (-704.847) [-701.517] -- 0:00:19
201500 -- (-703.869) (-703.413) (-709.417) [-704.639] * (-702.063) (-704.360) [-703.579] (-705.376) -- 0:00:19
202000 -- (-702.988) (-703.012) (-703.339) [-702.760] * (-704.233) (-702.151) [-703.479] (-704.859) -- 0:00:19
202500 -- [-705.596] (-704.800) (-703.365) (-705.809) * (-701.683) (-703.010) (-705.074) [-701.442] -- 0:00:19
203000 -- [-704.303] (-707.273) (-702.708) (-702.283) * (-704.185) [-704.099] (-703.629) (-701.871) -- 0:00:19
203500 -- (-704.226) (-702.716) [-703.385] (-702.202) * (-703.041) (-702.842) [-702.934] (-701.170) -- 0:00:18
204000 -- [-703.881] (-703.037) (-704.598) (-702.891) * [-705.497] (-710.863) (-703.779) (-707.179) -- 0:00:18
204500 -- (-705.912) (-701.539) (-703.574) [-706.100] * (-704.495) (-704.399) [-703.229] (-707.155) -- 0:00:18
205000 -- [-703.344] (-702.814) (-702.377) (-706.155) * (-703.685) (-702.219) [-700.879] (-704.289) -- 0:00:18
Average standard deviation of split frequencies: 0.012967
205500 -- (-702.424) (-702.420) [-701.495] (-705.868) * (-701.638) [-701.049] (-704.405) (-701.355) -- 0:00:18
206000 -- (-702.517) (-701.106) (-703.220) [-702.796] * (-706.016) (-703.266) [-702.424] (-701.826) -- 0:00:18
206500 -- (-701.896) (-702.945) [-704.169] (-707.725) * [-704.639] (-702.534) (-702.520) (-701.761) -- 0:00:18
207000 -- (-702.977) (-701.686) [-705.341] (-704.237) * (-704.193) [-701.283] (-701.559) (-706.378) -- 0:00:18
207500 -- (-703.983) [-702.236] (-701.769) (-702.096) * (-707.411) [-702.914] (-706.722) (-701.500) -- 0:00:18
208000 -- (-707.199) [-701.597] (-705.880) (-708.145) * (-703.831) [-701.953] (-700.928) (-702.927) -- 0:00:18
208500 -- (-707.175) (-702.834) (-703.435) [-703.387] * [-702.014] (-701.239) (-702.136) (-701.241) -- 0:00:18
209000 -- [-703.748] (-705.921) (-702.701) (-703.508) * (-702.217) [-703.088] (-706.334) (-702.175) -- 0:00:18
209500 -- (-703.180) [-702.536] (-703.061) (-706.148) * (-701.585) (-703.941) [-701.772] (-702.510) -- 0:00:18
210000 -- [-703.620] (-701.855) (-703.272) (-703.211) * (-703.968) (-704.356) (-704.426) [-704.629] -- 0:00:17
Average standard deviation of split frequencies: 0.011715
210500 -- (-703.881) (-701.526) (-702.169) [-702.423] * (-701.810) [-702.241] (-702.428) (-702.725) -- 0:00:17
211000 -- (-702.027) (-702.434) [-702.086] (-703.083) * (-704.581) [-703.297] (-703.462) (-701.446) -- 0:00:17
211500 -- (-704.166) (-702.889) (-701.329) [-704.494] * (-704.101) (-701.317) [-702.842] (-705.765) -- 0:00:17
212000 -- (-703.611) (-704.025) [-702.366] (-703.350) * (-702.368) (-703.525) [-703.488] (-703.497) -- 0:00:17
212500 -- (-705.347) (-706.791) (-702.818) [-703.585] * (-701.652) [-702.247] (-702.872) (-703.238) -- 0:00:17
213000 -- (-702.055) (-703.764) [-703.032] (-704.107) * (-702.615) (-702.403) (-704.739) [-702.991] -- 0:00:17
213500 -- (-705.412) (-702.880) [-703.591] (-702.628) * (-702.435) (-703.969) [-703.855] (-700.986) -- 0:00:17
214000 -- (-703.011) (-703.163) [-705.510] (-705.575) * (-702.029) [-704.423] (-704.122) (-702.168) -- 0:00:17
214500 -- (-701.353) (-701.305) [-705.434] (-709.210) * (-702.883) [-702.341] (-702.472) (-703.369) -- 0:00:17
215000 -- (-701.523) (-702.470) (-701.366) [-704.019] * [-701.205] (-702.419) (-703.334) (-704.679) -- 0:00:17
Average standard deviation of split frequencies: 0.012413
215500 -- [-702.818] (-704.245) (-702.287) (-702.325) * [-702.905] (-702.051) (-703.867) (-704.974) -- 0:00:17
216000 -- (-701.750) (-705.706) (-704.480) [-702.515] * (-702.758) (-701.863) (-705.064) [-703.481] -- 0:00:17
216500 -- [-701.532] (-709.871) (-703.113) (-708.352) * [-701.866] (-703.005) (-705.287) (-703.433) -- 0:00:18
217000 -- (-701.351) (-703.585) [-703.523] (-705.886) * [-702.598] (-703.344) (-702.847) (-706.930) -- 0:00:18
217500 -- [-703.313] (-703.323) (-701.530) (-708.705) * (-702.055) [-703.446] (-702.969) (-704.731) -- 0:00:18
218000 -- (-704.789) (-701.519) [-701.768] (-703.718) * (-701.747) (-703.684) [-706.580] (-703.069) -- 0:00:18
218500 -- [-705.491] (-702.930) (-703.999) (-702.044) * (-702.913) [-703.958] (-702.584) (-701.666) -- 0:00:18
219000 -- (-704.474) (-705.013) [-702.481] (-702.459) * (-703.133) (-704.445) [-701.112] (-703.603) -- 0:00:17
219500 -- [-704.009] (-702.580) (-704.718) (-703.734) * (-703.093) (-701.903) [-701.950] (-705.785) -- 0:00:17
220000 -- [-703.135] (-702.213) (-703.869) (-701.915) * (-703.571) [-702.868] (-704.060) (-703.224) -- 0:00:17
Average standard deviation of split frequencies: 0.012017
220500 -- (-703.093) [-706.253] (-703.218) (-701.759) * (-704.141) [-703.613] (-703.157) (-702.257) -- 0:00:17
221000 -- [-707.203] (-702.969) (-702.381) (-702.290) * (-703.392) (-705.046) [-701.289] (-702.985) -- 0:00:17
221500 -- (-702.822) (-703.667) (-703.595) [-701.993] * (-702.830) (-704.203) [-701.505] (-703.570) -- 0:00:17
222000 -- [-703.866] (-701.956) (-702.116) (-702.839) * (-702.646) (-702.989) (-703.032) [-703.293] -- 0:00:17
222500 -- (-702.275) (-701.675) (-703.720) [-702.514] * [-702.542] (-701.267) (-703.116) (-703.309) -- 0:00:17
223000 -- [-702.582] (-701.317) (-703.694) (-702.289) * [-704.480] (-703.536) (-705.019) (-705.366) -- 0:00:17
223500 -- (-703.316) (-705.330) (-703.153) [-702.283] * (-705.896) [-702.342] (-702.373) (-703.830) -- 0:00:17
224000 -- (-701.784) [-704.872] (-702.122) (-701.926) * (-707.799) (-701.338) [-701.881] (-702.769) -- 0:00:17
224500 -- (-704.319) [-703.453] (-708.774) (-703.805) * (-713.548) (-702.367) [-703.185] (-704.251) -- 0:00:17
225000 -- (-703.801) (-703.946) [-705.950] (-704.653) * (-704.163) (-702.890) (-703.885) [-701.436] -- 0:00:17
Average standard deviation of split frequencies: 0.013297
225500 -- (-702.952) (-703.178) (-703.716) [-703.304] * (-704.292) (-702.810) (-703.002) [-703.860] -- 0:00:17
226000 -- (-703.429) [-703.255] (-705.033) (-701.641) * (-704.637) (-708.893) [-702.847] (-705.117) -- 0:00:16
226500 -- (-703.755) [-702.424] (-704.834) (-703.968) * (-703.296) (-704.434) (-705.248) [-702.576] -- 0:00:16
227000 -- (-702.800) (-701.878) [-701.818] (-701.631) * (-702.424) (-702.942) (-705.841) [-705.331] -- 0:00:16
227500 -- [-702.741] (-701.885) (-703.261) (-702.308) * (-705.360) [-704.040] (-704.994) (-701.609) -- 0:00:16
228000 -- (-701.977) (-702.421) (-701.109) [-706.830] * [-703.120] (-701.768) (-703.879) (-703.895) -- 0:00:16
228500 -- (-702.414) (-702.151) [-701.279] (-703.818) * (-705.862) [-705.577] (-705.352) (-702.955) -- 0:00:16
229000 -- (-703.556) (-702.135) [-701.821] (-702.951) * (-705.248) (-701.411) (-701.797) [-701.374] -- 0:00:16
229500 -- (-704.259) (-703.130) [-702.255] (-701.478) * (-708.693) (-702.925) (-702.828) [-701.383] -- 0:00:16
230000 -- (-704.492) (-703.001) [-702.822] (-706.019) * (-704.471) (-705.054) [-703.575] (-702.700) -- 0:00:16
Average standard deviation of split frequencies: 0.012863
230500 -- (-703.522) (-700.714) (-701.418) [-702.994] * (-705.641) [-705.478] (-702.651) (-707.293) -- 0:00:16
231000 -- (-704.140) [-702.554] (-701.467) (-703.711) * [-704.130] (-701.738) (-704.104) (-702.291) -- 0:00:16
231500 -- (-700.776) (-704.670) (-701.384) [-702.999] * (-706.221) [-702.906] (-701.305) (-701.762) -- 0:00:16
232000 -- (-703.237) [-705.627] (-705.478) (-702.519) * [-701.083] (-703.020) (-704.096) (-702.229) -- 0:00:16
232500 -- (-710.653) (-702.317) (-703.827) [-703.335] * (-702.937) (-702.390) [-704.549] (-703.851) -- 0:00:17
233000 -- (-703.762) (-706.311) [-705.009] (-704.502) * (-704.914) (-703.639) [-702.151] (-703.586) -- 0:00:17
233500 -- (-703.663) (-701.861) [-703.595] (-703.809) * (-704.184) [-702.545] (-702.193) (-702.045) -- 0:00:17
234000 -- (-703.537) (-703.829) [-702.630] (-702.357) * [-704.222] (-702.121) (-700.863) (-704.907) -- 0:00:17
234500 -- (-702.217) [-704.560] (-702.756) (-702.941) * (-703.163) [-702.093] (-703.549) (-706.729) -- 0:00:16
235000 -- [-702.092] (-705.868) (-703.548) (-705.414) * (-702.391) (-705.947) (-702.902) [-704.021] -- 0:00:16
Average standard deviation of split frequencies: 0.014426
235500 -- (-706.086) [-702.094] (-702.468) (-702.414) * (-704.271) (-703.268) [-705.457] (-701.159) -- 0:00:16
236000 -- (-702.557) (-701.453) [-701.500] (-702.791) * [-704.521] (-702.122) (-704.329) (-701.382) -- 0:00:16
236500 -- [-701.415] (-703.788) (-702.760) (-705.508) * [-701.544] (-704.530) (-705.804) (-703.271) -- 0:00:16
237000 -- [-701.879] (-702.143) (-703.127) (-706.609) * (-705.079) (-703.248) (-706.864) [-703.667] -- 0:00:16
237500 -- (-703.437) (-707.456) [-701.659] (-709.629) * (-705.592) [-701.158] (-706.258) (-703.005) -- 0:00:16
238000 -- (-702.612) [-701.314] (-701.050) (-710.306) * (-703.428) [-701.070] (-703.950) (-704.923) -- 0:00:16
238500 -- (-703.572) [-704.256] (-701.364) (-701.516) * (-706.013) (-702.207) [-702.316] (-701.388) -- 0:00:16
239000 -- (-704.082) (-703.957) [-702.136] (-701.517) * (-702.838) (-702.075) [-701.733] (-702.222) -- 0:00:16
239500 -- (-705.582) (-701.874) [-702.522] (-702.223) * (-703.896) (-706.362) (-701.191) [-707.122] -- 0:00:16
240000 -- (-707.870) (-701.320) [-703.376] (-703.653) * [-703.036] (-703.961) (-700.935) (-707.184) -- 0:00:16
Average standard deviation of split frequencies: 0.012514
240500 -- (-702.513) (-701.241) [-703.542] (-707.194) * [-702.219] (-703.368) (-700.818) (-702.907) -- 0:00:16
241000 -- (-704.740) (-705.535) (-703.125) [-702.246] * (-702.231) [-701.942] (-701.020) (-704.689) -- 0:00:16
241500 -- (-704.105) (-704.194) [-700.814] (-703.399) * (-703.115) [-702.452] (-702.552) (-704.662) -- 0:00:16
242000 -- (-705.438) (-702.190) (-701.522) [-701.787] * [-702.821] (-701.673) (-703.575) (-706.425) -- 0:00:15
242500 -- [-706.268] (-701.463) (-703.649) (-702.857) * (-702.784) (-704.346) [-701.920] (-701.819) -- 0:00:15
243000 -- (-707.108) (-701.181) (-701.070) [-704.713] * [-706.335] (-702.459) (-706.423) (-701.084) -- 0:00:15
243500 -- [-702.772] (-702.259) (-702.338) (-703.339) * (-702.573) [-701.988] (-706.527) (-703.648) -- 0:00:15
244000 -- [-704.145] (-703.124) (-702.972) (-704.116) * [-706.930] (-704.700) (-704.556) (-706.619) -- 0:00:15
244500 -- [-704.517] (-705.709) (-701.646) (-701.583) * (-702.155) [-704.013] (-704.463) (-706.185) -- 0:00:15
245000 -- (-708.230) (-703.450) [-701.227] (-701.841) * (-703.533) [-703.567] (-702.682) (-707.726) -- 0:00:15
Average standard deviation of split frequencies: 0.010327
245500 -- (-703.922) (-705.794) [-703.150] (-701.986) * [-701.884] (-702.738) (-701.925) (-703.054) -- 0:00:15
246000 -- (-706.905) (-707.278) (-703.791) [-700.847] * [-702.901] (-702.140) (-702.906) (-702.969) -- 0:00:15
246500 -- (-703.018) [-702.179] (-705.432) (-701.521) * (-701.294) (-703.344) (-703.736) [-704.384] -- 0:00:15
247000 -- [-701.188] (-704.666) (-702.795) (-703.967) * (-704.532) (-703.981) [-703.278] (-705.024) -- 0:00:15
247500 -- (-701.611) (-701.116) [-703.663] (-705.351) * [-703.352] (-702.569) (-701.858) (-703.969) -- 0:00:15
248000 -- (-702.463) [-703.058] (-704.065) (-703.904) * (-703.936) (-706.468) (-704.107) [-702.172] -- 0:00:15
248500 -- (-702.416) (-702.220) (-701.752) [-703.175] * (-705.109) (-704.340) (-705.044) [-701.562] -- 0:00:15
249000 -- (-702.397) (-702.755) (-700.768) [-701.896] * (-705.189) (-701.604) (-708.403) [-702.586] -- 0:00:16
249500 -- (-702.373) (-702.175) [-701.064] (-701.945) * (-702.549) (-703.236) (-704.943) [-701.078] -- 0:00:16
250000 -- (-703.834) (-701.582) [-703.864] (-701.946) * [-703.320] (-704.914) (-703.165) (-701.040) -- 0:00:16
Average standard deviation of split frequencies: 0.011173
250500 -- (-702.683) (-704.826) (-702.882) [-701.903] * (-703.942) (-701.996) [-701.849] (-701.026) -- 0:00:15
251000 -- (-702.469) [-703.458] (-702.493) (-701.889) * [-704.869] (-702.764) (-701.633) (-702.644) -- 0:00:15
251500 -- (-700.911) (-705.667) (-702.531) [-702.690] * (-703.283) (-702.715) (-701.750) [-702.322] -- 0:00:15
252000 -- [-703.797] (-703.706) (-703.262) (-702.039) * [-704.386] (-702.189) (-703.551) (-707.473) -- 0:00:15
252500 -- [-704.554] (-702.167) (-703.876) (-703.335) * [-701.883] (-701.650) (-702.257) (-703.487) -- 0:00:15
253000 -- (-702.364) [-702.548] (-702.897) (-706.753) * [-701.113] (-703.088) (-704.336) (-702.824) -- 0:00:15
253500 -- (-703.486) (-703.619) (-700.784) [-701.735] * [-701.713] (-704.046) (-712.112) (-702.376) -- 0:00:15
254000 -- (-704.381) [-705.522] (-701.107) (-703.554) * (-707.475) (-703.437) (-705.508) [-703.150] -- 0:00:15
254500 -- (-702.906) [-706.824] (-705.015) (-702.500) * [-702.173] (-703.735) (-703.671) (-706.668) -- 0:00:15
255000 -- (-707.648) [-702.600] (-702.293) (-703.485) * (-701.262) (-702.133) [-703.110] (-701.980) -- 0:00:15
Average standard deviation of split frequencies: 0.011590
255500 -- (-704.995) (-702.147) [-703.422] (-701.306) * (-702.490) (-703.188) [-704.900] (-702.255) -- 0:00:15
256000 -- (-703.446) [-705.923] (-704.363) (-701.276) * [-704.576] (-704.120) (-701.218) (-708.331) -- 0:00:15
256500 -- (-703.334) [-703.931] (-704.402) (-701.600) * (-702.780) (-705.560) (-702.993) [-703.684] -- 0:00:15
257000 -- (-702.347) (-708.444) [-702.031] (-701.753) * (-702.690) (-702.444) (-702.162) [-702.809] -- 0:00:15
257500 -- [-705.806] (-708.026) (-703.800) (-703.331) * (-702.483) (-703.103) [-702.089] (-704.021) -- 0:00:15
258000 -- (-707.643) [-702.638] (-702.578) (-703.810) * [-703.454] (-703.990) (-701.949) (-701.090) -- 0:00:15
258500 -- [-707.001] (-702.322) (-705.569) (-703.288) * [-702.923] (-702.045) (-703.126) (-706.091) -- 0:00:14
259000 -- (-706.742) (-707.662) [-701.758] (-703.153) * (-701.721) [-702.598] (-702.656) (-704.980) -- 0:00:14
259500 -- (-703.955) (-703.561) (-705.566) [-704.183] * (-701.800) [-702.642] (-708.319) (-704.360) -- 0:00:14
260000 -- [-701.554] (-701.913) (-705.061) (-711.791) * (-702.062) (-709.116) (-704.038) [-702.371] -- 0:00:14
Average standard deviation of split frequencies: 0.011702
260500 -- (-703.137) [-702.294] (-702.682) (-705.204) * (-703.032) (-707.904) [-702.122] (-704.285) -- 0:00:14
261000 -- (-702.315) (-705.316) [-702.525] (-702.112) * (-701.298) (-701.662) [-704.394] (-707.427) -- 0:00:14
261500 -- [-702.381] (-702.641) (-701.804) (-703.606) * (-701.051) [-708.994] (-702.618) (-706.569) -- 0:00:14
262000 -- (-702.331) (-702.750) [-703.702] (-701.853) * (-702.573) (-703.935) (-703.168) [-702.320] -- 0:00:14
262500 -- (-705.234) (-703.652) (-701.716) [-703.335] * (-702.220) (-705.846) [-702.817] (-702.998) -- 0:00:14
263000 -- [-704.096] (-701.384) (-703.256) (-703.214) * (-707.246) (-708.801) (-702.114) [-704.461] -- 0:00:14
263500 -- [-703.190] (-705.772) (-702.599) (-702.867) * (-706.480) (-706.458) [-701.439] (-702.194) -- 0:00:14
264000 -- (-705.755) [-705.589] (-701.820) (-704.254) * (-703.815) (-702.204) [-702.676] (-702.117) -- 0:00:14
264500 -- (-703.026) [-702.083] (-703.016) (-705.382) * (-702.960) (-706.900) [-701.565] (-704.604) -- 0:00:14
265000 -- (-702.131) (-703.127) [-704.056] (-703.635) * (-701.428) (-703.950) [-702.196] (-702.292) -- 0:00:15
Average standard deviation of split frequencies: 0.012208
265500 -- (-704.063) [-702.149] (-704.483) (-701.704) * [-702.354] (-710.262) (-705.094) (-703.938) -- 0:00:15
266000 -- (-703.397) (-702.440) [-707.048] (-702.762) * [-703.152] (-703.253) (-708.299) (-702.873) -- 0:00:14
266500 -- (-701.288) (-702.913) [-702.661] (-701.706) * [-702.205] (-708.480) (-705.042) (-702.153) -- 0:00:14
267000 -- [-701.541] (-704.033) (-703.014) (-704.770) * (-709.271) (-707.294) (-702.705) [-701.016] -- 0:00:14
267500 -- (-703.839) (-701.569) (-705.721) [-705.469] * (-708.033) (-707.896) (-702.196) [-704.132] -- 0:00:14
268000 -- [-702.151] (-705.756) (-706.923) (-702.694) * (-702.429) (-705.803) (-701.466) [-702.410] -- 0:00:14
268500 -- (-701.788) (-702.040) [-703.260] (-707.026) * [-701.764] (-704.832) (-706.341) (-707.495) -- 0:00:14
269000 -- (-703.745) (-704.281) [-703.618] (-710.466) * [-702.427] (-701.773) (-706.410) (-703.914) -- 0:00:14
269500 -- [-704.769] (-701.587) (-705.492) (-703.599) * [-701.235] (-704.301) (-702.625) (-708.346) -- 0:00:14
270000 -- (-704.710) (-702.722) [-701.665] (-703.312) * (-701.380) (-702.030) [-702.062] (-704.097) -- 0:00:14
Average standard deviation of split frequencies: 0.010725
270500 -- (-703.887) (-707.291) [-703.215] (-702.900) * (-703.952) (-705.399) [-702.369] (-702.206) -- 0:00:14
271000 -- (-701.682) (-704.083) (-704.857) [-705.343] * [-704.264] (-704.052) (-704.364) (-701.106) -- 0:00:14
271500 -- (-701.960) (-703.378) [-705.930] (-705.221) * [-701.482] (-707.433) (-708.751) (-701.132) -- 0:00:14
272000 -- (-704.718) [-702.642] (-704.934) (-703.129) * (-708.004) (-707.611) [-703.282] (-701.948) -- 0:00:14
272500 -- (-706.035) (-704.184) [-705.617] (-703.601) * (-705.461) [-704.469] (-703.471) (-702.905) -- 0:00:14
273000 -- (-706.375) [-701.969] (-705.646) (-701.946) * [-701.355] (-703.263) (-705.343) (-702.441) -- 0:00:14
273500 -- (-702.434) [-703.431] (-701.340) (-702.913) * [-701.355] (-705.902) (-704.265) (-705.760) -- 0:00:14
274000 -- [-702.096] (-702.460) (-702.339) (-701.187) * (-705.301) (-702.091) (-705.885) [-703.371] -- 0:00:14
274500 -- (-704.701) [-702.297] (-708.880) (-701.276) * (-702.010) (-702.071) [-702.249] (-705.011) -- 0:00:13
275000 -- (-708.035) (-703.106) [-704.514] (-701.183) * [-705.439] (-703.804) (-704.026) (-705.608) -- 0:00:13
Average standard deviation of split frequencies: 0.012226
275500 -- [-703.489] (-703.230) (-704.123) (-703.035) * [-701.792] (-704.192) (-701.258) (-701.906) -- 0:00:13
276000 -- (-702.870) (-705.747) [-701.201] (-701.732) * (-703.679) (-706.868) [-703.928] (-706.479) -- 0:00:13
276500 -- (-703.355) (-703.655) [-701.941] (-702.095) * (-703.192) (-705.966) [-703.803] (-704.217) -- 0:00:13
277000 -- (-704.019) (-702.622) (-703.209) [-701.151] * (-701.342) (-701.735) [-705.859] (-706.506) -- 0:00:13
277500 -- [-701.947] (-702.399) (-701.395) (-701.661) * (-703.271) [-701.032] (-702.781) (-703.165) -- 0:00:13
278000 -- (-701.103) [-702.183] (-704.014) (-700.963) * (-701.985) (-702.338) (-703.350) [-702.642] -- 0:00:13
278500 -- [-700.893] (-702.118) (-703.976) (-702.678) * (-703.141) (-703.456) (-702.717) [-702.260] -- 0:00:13
279000 -- (-702.206) [-701.887] (-707.040) (-701.481) * (-703.408) [-703.933] (-705.073) (-706.121) -- 0:00:13
279500 -- [-701.205] (-703.264) (-702.180) (-705.146) * [-703.328] (-703.124) (-703.630) (-703.266) -- 0:00:13
280000 -- [-702.781] (-704.604) (-702.378) (-706.125) * [-703.801] (-702.160) (-704.651) (-702.508) -- 0:00:13
Average standard deviation of split frequencies: 0.012410
280500 -- (-705.913) (-704.133) [-705.050] (-709.286) * (-703.790) (-701.753) (-703.453) [-701.709] -- 0:00:13
281000 -- (-703.636) [-705.056] (-704.301) (-707.907) * (-703.926) (-701.542) (-701.637) [-701.111] -- 0:00:13
281500 -- (-702.266) (-704.307) (-704.258) [-703.566] * [-705.220] (-701.262) (-701.980) (-704.622) -- 0:00:13
282000 -- (-702.272) (-705.230) [-703.462] (-704.965) * (-704.917) (-703.264) [-702.572] (-704.325) -- 0:00:13
282500 -- (-704.947) [-703.411] (-702.551) (-701.341) * (-702.908) (-703.134) [-705.064] (-704.472) -- 0:00:13
283000 -- [-703.769] (-705.053) (-709.161) (-701.435) * (-706.574) (-705.434) [-702.830] (-702.987) -- 0:00:13
283500 -- (-701.770) (-703.445) [-705.269] (-702.202) * (-702.780) (-706.596) (-703.510) [-701.336] -- 0:00:13
284000 -- (-701.639) [-706.859] (-710.664) (-703.463) * (-703.918) [-701.524] (-705.510) (-702.064) -- 0:00:13
284500 -- (-701.818) [-702.416] (-703.583) (-701.739) * (-706.557) [-706.233] (-704.695) (-701.475) -- 0:00:13
285000 -- [-701.876] (-703.647) (-701.443) (-702.618) * (-705.024) [-701.314] (-702.922) (-704.301) -- 0:00:13
Average standard deviation of split frequencies: 0.012752
285500 -- (-701.581) (-703.800) [-700.986] (-702.772) * [-709.076] (-701.699) (-702.104) (-702.992) -- 0:00:13
286000 -- (-703.301) [-703.290] (-701.680) (-702.233) * (-701.583) (-705.966) (-701.194) [-703.703] -- 0:00:13
286500 -- (-704.479) (-702.328) (-705.275) [-701.861] * (-701.462) [-705.432] (-704.446) (-704.894) -- 0:00:13
287000 -- (-702.291) (-706.488) (-705.981) [-701.620] * (-704.837) (-704.710) (-701.736) [-706.974] -- 0:00:13
287500 -- (-704.044) [-702.194] (-703.692) (-702.793) * (-705.609) (-703.667) (-703.674) [-701.219] -- 0:00:13
288000 -- [-702.855] (-710.968) (-703.934) (-701.196) * (-703.858) (-703.162) (-707.801) [-701.349] -- 0:00:13
288500 -- [-702.347] (-703.985) (-702.801) (-701.645) * (-702.980) (-702.439) [-703.866] (-703.117) -- 0:00:13
289000 -- (-705.216) [-701.732] (-703.519) (-704.280) * (-706.787) [-703.920] (-702.755) (-703.272) -- 0:00:13
289500 -- (-702.726) [-701.721] (-702.544) (-703.317) * [-704.294] (-703.256) (-707.891) (-702.646) -- 0:00:13
290000 -- (-702.741) (-703.151) (-702.602) [-705.303] * (-706.462) (-704.246) [-703.419] (-707.523) -- 0:00:13
Average standard deviation of split frequencies: 0.012292
290500 -- (-702.771) (-702.394) (-704.469) [-707.565] * (-703.746) (-707.798) [-702.051] (-704.975) -- 0:00:12
291000 -- (-702.991) (-703.527) (-705.622) [-703.397] * (-701.319) (-702.314) [-701.556] (-706.637) -- 0:00:12
291500 -- (-702.631) [-703.295] (-708.120) (-703.188) * (-702.972) (-701.483) [-702.763] (-704.350) -- 0:00:12
292000 -- (-703.681) [-703.604] (-711.324) (-706.101) * (-702.402) (-702.769) [-702.833] (-705.718) -- 0:00:12
292500 -- (-704.363) [-701.913] (-702.737) (-701.535) * (-704.435) [-702.683] (-703.260) (-705.325) -- 0:00:12
293000 -- (-704.318) (-701.998) [-702.052] (-702.314) * [-702.168] (-702.591) (-708.373) (-702.313) -- 0:00:12
293500 -- (-705.112) (-701.405) [-701.256] (-702.635) * (-703.728) (-703.652) [-704.091] (-704.408) -- 0:00:12
294000 -- (-703.492) [-701.456] (-702.727) (-705.985) * [-701.511] (-703.028) (-705.240) (-702.839) -- 0:00:12
294500 -- (-704.121) (-701.285) (-702.754) [-703.917] * (-704.973) [-701.309] (-704.607) (-705.818) -- 0:00:12
295000 -- (-705.907) [-706.857] (-701.862) (-703.990) * (-703.257) (-702.691) [-705.770] (-705.105) -- 0:00:12
Average standard deviation of split frequencies: 0.011902
295500 -- (-705.866) (-702.429) [-704.877] (-704.178) * [-702.043] (-704.774) (-704.360) (-702.533) -- 0:00:12
296000 -- (-704.541) (-703.337) [-702.148] (-703.795) * [-704.324] (-704.247) (-705.424) (-704.386) -- 0:00:12
296500 -- [-703.159] (-706.626) (-701.572) (-703.844) * (-702.826) (-702.998) (-703.036) [-702.327] -- 0:00:12
297000 -- (-704.268) (-704.121) [-701.405] (-702.421) * [-702.640] (-705.844) (-701.026) (-701.439) -- 0:00:12
297500 -- (-706.319) (-702.586) [-701.661] (-702.649) * (-702.871) (-702.416) (-704.159) [-700.819] -- 0:00:12
298000 -- (-705.144) (-704.540) [-703.139] (-705.019) * (-701.568) (-702.275) [-706.164] (-701.063) -- 0:00:12
298500 -- (-704.287) [-703.976] (-706.004) (-707.757) * (-703.127) (-704.602) (-703.459) [-701.914] -- 0:00:12
299000 -- (-708.738) (-704.872) (-706.398) [-702.580] * (-704.654) (-703.120) [-701.506] (-701.708) -- 0:00:12
299500 -- (-705.496) [-701.432] (-703.259) (-703.124) * (-705.849) (-702.132) (-700.813) [-701.839] -- 0:00:12
300000 -- (-705.923) [-701.429] (-702.358) (-702.592) * (-707.885) [-702.313] (-701.655) (-701.978) -- 0:00:12
Average standard deviation of split frequencies: 0.011933
300500 -- (-702.612) [-702.581] (-701.917) (-705.166) * (-701.452) (-701.825) [-701.837] (-703.017) -- 0:00:12
301000 -- (-701.585) (-703.074) [-702.084] (-702.754) * (-702.678) [-703.440] (-704.423) (-704.920) -- 0:00:12
301500 -- (-705.390) (-701.335) [-702.719] (-702.799) * (-702.635) (-702.205) (-702.285) [-702.706] -- 0:00:12
302000 -- (-705.344) (-701.996) (-701.982) [-704.318] * (-701.722) (-704.568) (-702.432) [-701.615] -- 0:00:12
302500 -- [-705.552] (-704.397) (-703.081) (-706.313) * (-701.853) (-707.061) [-703.146] (-703.228) -- 0:00:12
303000 -- (-705.707) (-701.955) (-703.367) [-702.731] * (-701.679) (-707.486) [-705.949] (-703.216) -- 0:00:12
303500 -- (-704.966) (-703.733) (-702.583) [-703.132] * (-702.412) (-704.895) (-703.416) [-703.524] -- 0:00:12
304000 -- (-706.879) (-703.721) [-702.628] (-706.411) * [-703.356] (-704.280) (-703.952) (-704.975) -- 0:00:12
304500 -- [-704.063] (-701.529) (-703.459) (-703.785) * (-704.102) [-702.863] (-705.984) (-705.287) -- 0:00:12
305000 -- (-704.677) (-704.280) (-705.728) [-702.032] * (-709.714) (-704.028) [-704.475] (-701.433) -- 0:00:12
Average standard deviation of split frequencies: 0.011811
305500 -- [-705.975] (-701.841) (-702.363) (-703.189) * (-703.268) (-701.797) (-703.241) [-703.010] -- 0:00:12
306000 -- (-703.316) (-701.769) [-703.469] (-703.421) * (-707.807) (-702.136) (-704.199) [-705.476] -- 0:00:12
306500 -- [-701.675] (-701.666) (-702.228) (-704.377) * [-702.860] (-703.570) (-702.482) (-701.737) -- 0:00:11
307000 -- [-701.850] (-702.927) (-705.474) (-705.757) * (-706.151) [-702.181] (-707.345) (-701.937) -- 0:00:11
307500 -- (-701.503) [-705.412] (-704.408) (-703.791) * [-707.606] (-701.490) (-703.775) (-702.296) -- 0:00:11
308000 -- [-704.229] (-703.112) (-707.382) (-704.255) * (-706.780) (-703.203) (-701.798) [-702.099] -- 0:00:11
308500 -- (-702.887) [-702.633] (-705.462) (-703.566) * (-701.904) (-704.954) [-701.371] (-704.513) -- 0:00:11
309000 -- [-706.179] (-701.319) (-704.793) (-701.114) * (-701.425) (-703.120) (-701.855) [-702.671] -- 0:00:11
309500 -- (-705.502) (-702.351) (-705.055) [-705.395] * [-703.601] (-702.546) (-702.449) (-704.086) -- 0:00:11
310000 -- (-705.875) (-703.441) (-703.089) [-708.131] * (-704.879) (-702.601) [-702.394] (-703.284) -- 0:00:11
Average standard deviation of split frequencies: 0.012139
310500 -- [-702.502] (-706.358) (-702.276) (-706.620) * [-702.775] (-701.290) (-705.154) (-702.105) -- 0:00:11
311000 -- (-705.651) (-708.234) [-701.528] (-705.037) * (-703.741) [-703.752] (-704.544) (-703.219) -- 0:00:11
311500 -- [-702.272] (-705.253) (-701.515) (-703.048) * (-705.237) (-706.843) [-706.910] (-707.243) -- 0:00:11
312000 -- (-704.138) (-703.573) [-707.284] (-702.917) * [-702.451] (-704.809) (-705.068) (-702.605) -- 0:00:11
312500 -- [-702.614] (-703.257) (-709.067) (-701.866) * [-708.574] (-706.259) (-706.668) (-704.173) -- 0:00:11
313000 -- (-701.639) [-701.612] (-701.750) (-702.793) * (-702.172) (-701.432) [-705.767] (-702.727) -- 0:00:11
313500 -- (-706.077) [-702.307] (-704.505) (-702.997) * [-701.257] (-706.735) (-702.019) (-703.311) -- 0:00:11
314000 -- (-703.649) [-701.320] (-702.228) (-703.265) * (-702.495) [-706.424] (-702.859) (-700.877) -- 0:00:11
314500 -- (-701.731) (-703.142) [-709.511] (-705.499) * [-701.659] (-706.082) (-711.432) (-700.927) -- 0:00:11
315000 -- (-700.998) [-702.939] (-705.227) (-702.657) * (-704.426) (-703.983) [-705.717] (-703.385) -- 0:00:11
Average standard deviation of split frequencies: 0.011232
315500 -- (-701.456) [-702.563] (-711.983) (-703.316) * [-703.171] (-702.780) (-703.611) (-701.860) -- 0:00:11
316000 -- (-702.257) [-702.006] (-704.781) (-705.931) * (-704.269) (-701.776) [-708.945] (-703.439) -- 0:00:11
316500 -- (-706.920) [-703.701] (-702.691) (-704.695) * [-703.481] (-706.165) (-711.073) (-701.885) -- 0:00:11
317000 -- [-704.692] (-706.171) (-704.375) (-705.449) * [-702.998] (-704.957) (-703.429) (-702.123) -- 0:00:11
317500 -- (-704.816) (-704.618) [-706.026] (-703.594) * (-705.544) (-702.884) [-703.578] (-702.218) -- 0:00:11
318000 -- (-707.396) (-702.973) [-702.970] (-702.036) * [-704.829] (-702.884) (-704.198) (-701.827) -- 0:00:11
318500 -- [-705.075] (-702.609) (-706.431) (-705.215) * (-706.991) (-705.331) (-706.701) [-701.882] -- 0:00:11
319000 -- (-704.568) [-709.330] (-704.992) (-701.757) * [-702.205] (-701.348) (-702.365) (-701.898) -- 0:00:11
319500 -- (-705.762) (-704.329) [-703.563] (-703.866) * (-703.322) (-701.165) [-704.649] (-702.863) -- 0:00:11
320000 -- [-702.375] (-701.603) (-701.171) (-705.005) * (-704.410) [-703.303] (-703.220) (-702.256) -- 0:00:11
Average standard deviation of split frequencies: 0.010896
320500 -- (-702.410) [-701.739] (-701.257) (-704.849) * (-703.895) (-704.250) [-706.073] (-701.935) -- 0:00:11
321000 -- (-702.585) [-701.552] (-701.238) (-703.335) * (-702.194) (-703.486) (-702.104) [-700.994] -- 0:00:11
321500 -- (-704.386) (-703.104) [-704.228] (-706.078) * (-703.584) (-703.995) [-704.859] (-702.873) -- 0:00:11
322000 -- (-702.856) (-703.060) [-702.572] (-702.049) * (-703.139) (-708.860) (-705.803) [-702.475] -- 0:00:11
322500 -- (-705.192) (-703.381) (-707.387) [-704.497] * (-704.701) (-702.933) [-705.363] (-702.166) -- 0:00:11
323000 -- (-701.312) (-705.148) (-701.847) [-704.340] * (-704.999) (-703.107) [-705.033] (-707.760) -- 0:00:10
323500 -- [-702.739] (-701.784) (-702.580) (-703.256) * (-702.991) (-702.742) (-702.206) [-701.476] -- 0:00:10
324000 -- (-701.678) (-702.023) [-705.877] (-701.800) * (-705.496) [-703.235] (-702.213) (-703.527) -- 0:00:10
324500 -- [-703.107] (-703.093) (-704.521) (-702.332) * (-701.417) (-704.110) (-702.902) [-702.052] -- 0:00:10
325000 -- [-705.238] (-702.511) (-705.156) (-701.870) * (-702.529) (-704.647) (-702.676) [-706.862] -- 0:00:10
Average standard deviation of split frequencies: 0.012211
325500 -- (-705.268) (-703.524) (-704.693) [-701.887] * (-705.424) (-702.457) [-703.077] (-703.223) -- 0:00:10
326000 -- (-704.029) (-703.814) (-706.107) [-702.752] * (-704.480) [-703.577] (-706.863) (-703.489) -- 0:00:10
326500 -- [-703.450] (-702.170) (-708.727) (-705.505) * [-704.069] (-702.237) (-706.930) (-704.433) -- 0:00:10
327000 -- [-703.540] (-703.759) (-702.435) (-706.228) * (-702.016) (-701.654) (-708.195) [-704.216] -- 0:00:10
327500 -- [-703.386] (-703.873) (-704.571) (-703.112) * (-704.050) (-700.946) (-703.651) [-703.270] -- 0:00:10
328000 -- [-702.993] (-704.033) (-706.615) (-703.668) * (-703.875) [-706.421] (-702.078) (-710.848) -- 0:00:10
328500 -- [-704.771] (-701.068) (-703.888) (-703.978) * (-706.448) [-702.365] (-702.109) (-711.292) -- 0:00:10
329000 -- [-705.046] (-705.003) (-702.466) (-709.485) * [-703.554] (-703.610) (-702.964) (-712.297) -- 0:00:10
329500 -- (-701.133) (-703.228) [-701.858] (-703.969) * [-707.844] (-703.365) (-700.922) (-704.096) -- 0:00:10
330000 -- (-701.025) (-704.204) [-702.094] (-708.826) * (-702.488) (-704.461) [-701.706] (-702.193) -- 0:00:10
Average standard deviation of split frequencies: 0.011801
330500 -- (-706.351) (-702.614) (-701.168) [-702.856] * (-703.328) [-705.975] (-703.773) (-704.615) -- 0:00:10
331000 -- [-702.760] (-702.001) (-702.151) (-703.165) * [-702.766] (-703.810) (-704.479) (-702.433) -- 0:00:10
331500 -- (-701.589) (-701.982) (-702.002) [-704.011] * (-702.099) (-701.450) [-702.559] (-707.056) -- 0:00:10
332000 -- (-703.242) [-704.572] (-705.748) (-705.290) * (-703.753) (-701.319) [-705.083] (-702.522) -- 0:00:10
332500 -- (-707.318) [-703.178] (-702.601) (-703.859) * [-704.166] (-701.063) (-703.152) (-702.100) -- 0:00:10
333000 -- (-703.078) [-702.063] (-701.767) (-703.914) * [-705.626] (-701.537) (-704.059) (-701.821) -- 0:00:10
333500 -- (-705.897) (-706.744) (-704.624) [-701.708] * (-703.414) (-703.075) (-702.943) [-702.001] -- 0:00:10
334000 -- (-703.317) (-713.154) [-702.826] (-703.525) * (-701.882) [-703.642] (-702.361) (-702.268) -- 0:00:10
334500 -- (-702.510) (-705.980) [-703.017] (-702.489) * (-706.757) [-702.701] (-706.495) (-701.055) -- 0:00:10
335000 -- (-702.763) [-701.136] (-704.991) (-701.970) * [-703.216] (-705.727) (-702.950) (-702.535) -- 0:00:10
Average standard deviation of split frequencies: 0.010894
335500 -- (-703.389) (-701.842) [-705.791] (-701.078) * (-702.240) [-707.363] (-704.110) (-706.914) -- 0:00:10
336000 -- (-702.735) (-701.344) [-703.911] (-701.454) * (-702.719) (-704.330) [-703.553] (-706.019) -- 0:00:10
336500 -- [-703.921] (-701.508) (-703.173) (-702.058) * (-701.715) [-704.405] (-702.957) (-705.224) -- 0:00:10
337000 -- (-702.381) (-701.564) [-702.800] (-704.603) * (-704.299) (-705.231) (-703.735) [-701.857] -- 0:00:10
337500 -- (-701.464) (-703.778) (-702.989) [-704.562] * (-705.295) (-702.504) (-702.987) [-703.608] -- 0:00:10
338000 -- [-702.843] (-702.022) (-703.765) (-704.385) * (-705.558) (-701.408) (-704.921) [-702.860] -- 0:00:10
338500 -- (-701.916) [-701.216] (-703.457) (-702.995) * (-702.799) (-702.553) [-701.342] (-701.525) -- 0:00:10
339000 -- (-702.550) (-701.622) (-703.067) [-700.970] * [-703.070] (-702.831) (-703.384) (-701.926) -- 0:00:09
339500 -- [-703.162] (-703.523) (-703.309) (-700.945) * [-705.066] (-702.831) (-706.664) (-701.799) -- 0:00:09
340000 -- [-702.634] (-705.556) (-705.270) (-703.681) * (-704.277) (-703.780) [-703.080] (-702.483) -- 0:00:09
Average standard deviation of split frequencies: 0.011608
340500 -- (-701.847) (-702.594) (-703.312) [-704.315] * (-708.065) [-703.879] (-702.052) (-701.438) -- 0:00:09
341000 -- (-703.310) (-701.355) [-701.869] (-703.301) * (-702.271) (-703.472) [-701.944] (-701.967) -- 0:00:09
341500 -- (-703.810) (-703.552) (-701.605) [-701.838] * (-703.530) (-703.965) [-703.678] (-702.363) -- 0:00:09
342000 -- [-707.709] (-704.974) (-701.065) (-703.150) * (-705.893) (-704.441) [-703.342] (-702.676) -- 0:00:09
342500 -- (-702.311) (-701.615) [-702.340] (-702.288) * (-702.204) (-704.004) [-702.215] (-702.556) -- 0:00:09
343000 -- [-701.934] (-702.592) (-705.503) (-702.743) * (-702.820) (-705.542) [-702.861] (-702.224) -- 0:00:09
343500 -- (-703.455) (-702.149) (-703.247) [-701.785] * (-703.567) (-701.031) [-705.292] (-703.154) -- 0:00:09
344000 -- [-702.093] (-701.609) (-702.429) (-701.940) * (-702.905) [-702.416] (-709.988) (-703.283) -- 0:00:09
344500 -- (-703.821) (-703.795) [-704.868] (-702.048) * [-703.947] (-700.917) (-707.405) (-701.103) -- 0:00:09
345000 -- (-701.824) (-700.749) [-706.994] (-702.444) * (-702.856) (-702.156) [-704.449] (-706.997) -- 0:00:09
Average standard deviation of split frequencies: 0.011808
345500 -- (-703.977) [-700.735] (-702.683) (-704.268) * [-702.579] (-705.809) (-701.860) (-704.231) -- 0:00:09
346000 -- (-701.987) (-702.320) [-702.201] (-704.247) * [-701.738] (-700.813) (-702.347) (-703.425) -- 0:00:09
346500 -- (-708.246) (-701.696) [-705.460] (-701.488) * [-702.183] (-703.329) (-703.580) (-704.135) -- 0:00:09
347000 -- (-704.103) (-704.075) (-704.055) [-701.597] * (-704.733) [-703.525] (-704.950) (-704.377) -- 0:00:09
347500 -- (-703.147) (-701.611) (-701.785) [-701.482] * (-704.388) (-706.161) [-703.529] (-703.385) -- 0:00:09
348000 -- (-704.026) (-702.046) [-701.710] (-702.033) * (-701.474) (-701.682) (-702.976) [-707.071] -- 0:00:09
348500 -- (-701.922) (-702.845) [-701.439] (-702.104) * (-701.420) (-702.882) [-702.207] (-704.212) -- 0:00:09
349000 -- [-702.426] (-702.466) (-704.898) (-704.650) * (-702.272) [-702.486] (-708.954) (-703.253) -- 0:00:09
349500 -- (-702.838) [-703.031] (-711.352) (-705.184) * [-702.705] (-702.859) (-713.318) (-701.902) -- 0:00:09
350000 -- (-701.462) (-703.335) [-708.052] (-706.050) * (-701.255) (-702.297) [-703.651] (-702.817) -- 0:00:09
Average standard deviation of split frequencies: 0.011800
350500 -- [-702.429] (-703.258) (-701.830) (-704.299) * (-703.103) (-702.848) [-704.777] (-701.656) -- 0:00:09
351000 -- [-702.464] (-701.370) (-701.384) (-703.544) * [-703.218] (-707.923) (-700.974) (-706.235) -- 0:00:09
351500 -- (-702.463) (-702.848) (-704.791) [-702.723] * (-703.400) [-701.475] (-704.102) (-708.819) -- 0:00:09
352000 -- [-703.435] (-701.930) (-701.936) (-702.363) * (-702.157) (-702.306) [-704.725] (-702.859) -- 0:00:09
352500 -- (-703.210) [-701.904] (-702.744) (-701.531) * (-701.527) [-702.774] (-704.456) (-702.124) -- 0:00:09
353000 -- (-702.416) (-702.126) [-702.747] (-703.059) * (-702.920) (-701.828) [-703.577] (-701.533) -- 0:00:09
353500 -- (-701.495) (-702.293) (-703.110) [-702.008] * (-704.040) (-702.833) (-702.081) [-702.928] -- 0:00:09
354000 -- (-701.796) (-703.440) (-702.632) [-702.971] * (-701.539) [-701.974] (-702.436) (-702.490) -- 0:00:09
354500 -- [-704.560] (-702.792) (-704.077) (-700.911) * (-702.653) (-701.719) [-702.187] (-701.975) -- 0:00:09
355000 -- (-704.883) (-703.529) (-701.969) [-704.575] * (-702.236) [-702.421] (-704.417) (-702.597) -- 0:00:08
Average standard deviation of split frequencies: 0.011991
355500 -- (-706.446) (-706.486) (-702.897) [-701.748] * (-705.140) (-702.984) [-704.510] (-707.952) -- 0:00:08
356000 -- (-707.832) (-707.475) (-704.019) [-703.006] * [-702.384] (-702.952) (-701.121) (-705.141) -- 0:00:08
356500 -- [-705.511] (-704.208) (-704.698) (-701.144) * (-702.860) (-703.812) (-701.676) [-702.224] -- 0:00:08
357000 -- (-704.322) (-705.950) (-703.357) [-701.633] * (-700.905) (-703.385) [-702.507] (-709.670) -- 0:00:08
357500 -- (-701.206) [-702.024] (-704.340) (-701.504) * [-701.802] (-701.786) (-702.841) (-701.341) -- 0:00:08
358000 -- (-703.864) [-702.763] (-703.599) (-704.034) * (-701.915) (-704.713) (-703.500) [-702.650] -- 0:00:08
358500 -- [-704.438] (-701.963) (-704.294) (-702.736) * (-701.430) [-706.516] (-704.009) (-707.775) -- 0:00:08
359000 -- [-701.924] (-705.175) (-703.327) (-705.328) * (-701.546) (-706.309) (-705.315) [-703.240] -- 0:00:08
359500 -- [-702.761] (-706.856) (-703.575) (-703.349) * (-702.618) [-705.885] (-704.327) (-702.947) -- 0:00:08
360000 -- [-702.594] (-707.700) (-707.130) (-701.693) * (-706.485) [-705.282] (-704.327) (-704.380) -- 0:00:08
Average standard deviation of split frequencies: 0.009841
360500 -- [-705.796] (-703.425) (-704.562) (-701.207) * (-705.960) (-703.664) [-702.934] (-702.218) -- 0:00:08
361000 -- (-704.949) (-702.822) (-704.761) [-702.821] * (-701.750) (-702.796) (-703.150) [-703.145] -- 0:00:08
361500 -- (-703.907) (-702.021) (-701.428) [-702.829] * [-702.285] (-701.701) (-706.626) (-701.891) -- 0:00:08
362000 -- (-705.908) (-703.415) (-701.752) [-704.538] * (-705.138) [-702.369] (-701.927) (-706.674) -- 0:00:08
362500 -- (-706.532) (-706.275) (-702.616) [-702.249] * (-704.315) [-701.315] (-702.641) (-706.111) -- 0:00:08
363000 -- (-704.256) [-701.349] (-702.934) (-705.990) * (-703.898) (-702.466) [-705.673] (-702.940) -- 0:00:08
363500 -- (-704.617) (-701.545) [-702.105] (-707.996) * (-703.465) [-702.690] (-704.562) (-706.181) -- 0:00:08
364000 -- [-703.322] (-703.843) (-701.842) (-702.215) * (-702.682) [-704.860] (-703.608) (-709.916) -- 0:00:08
364500 -- [-704.021] (-704.343) (-707.188) (-702.902) * (-706.370) (-701.659) [-701.145] (-709.104) -- 0:00:08
365000 -- (-702.526) (-703.059) [-701.987] (-702.474) * [-704.898] (-704.593) (-701.798) (-700.922) -- 0:00:08
Average standard deviation of split frequencies: 0.009319
365500 -- [-702.841] (-702.405) (-703.048) (-704.672) * (-704.992) [-705.457] (-700.963) (-701.263) -- 0:00:08
366000 -- (-702.394) [-701.017] (-702.166) (-701.730) * (-704.462) (-704.675) (-702.136) [-702.804] -- 0:00:08
366500 -- [-702.705] (-702.523) (-706.423) (-704.390) * (-708.435) [-703.137] (-702.125) (-702.295) -- 0:00:08
367000 -- (-703.347) (-704.201) (-704.003) [-702.886] * [-704.235] (-706.560) (-701.456) (-705.450) -- 0:00:08
367500 -- [-701.791] (-704.934) (-705.051) (-704.792) * (-702.993) (-705.160) [-703.077] (-705.857) -- 0:00:08
368000 -- (-701.940) (-705.798) (-706.341) [-701.761] * (-702.112) (-701.287) [-701.291] (-704.529) -- 0:00:08
368500 -- (-704.203) (-703.449) (-702.464) [-701.036] * (-701.883) (-702.615) [-702.149] (-701.429) -- 0:00:08
369000 -- (-702.530) [-702.877] (-706.003) (-703.220) * (-701.703) (-701.423) (-702.658) [-702.799] -- 0:00:08
369500 -- (-703.400) (-704.065) (-703.488) [-701.102] * (-706.781) (-701.310) [-703.097] (-703.036) -- 0:00:08
370000 -- [-702.657] (-701.974) (-709.485) (-703.272) * [-701.833] (-704.517) (-706.285) (-702.897) -- 0:00:08
Average standard deviation of split frequencies: 0.010473
370500 -- (-701.973) [-704.084] (-703.136) (-703.259) * [-702.148] (-702.293) (-706.736) (-704.214) -- 0:00:08
371000 -- (-702.960) (-701.537) [-705.927] (-702.788) * [-702.777] (-703.790) (-701.322) (-703.988) -- 0:00:07
371500 -- [-701.323] (-705.204) (-708.286) (-702.755) * (-702.373) (-702.289) (-701.721) [-701.982] -- 0:00:07
372000 -- (-703.377) (-703.502) [-702.781] (-702.856) * (-702.282) (-703.067) (-702.600) [-704.409] -- 0:00:07
372500 -- (-705.545) (-702.742) [-704.731] (-707.132) * (-702.476) (-701.419) (-703.891) [-704.457] -- 0:00:07
373000 -- (-704.405) (-704.132) (-706.576) [-706.784] * (-704.221) (-701.439) [-702.550] (-703.591) -- 0:00:07
373500 -- (-702.932) (-705.451) (-702.110) [-702.907] * (-701.286) (-701.264) [-702.852] (-702.184) -- 0:00:07
374000 -- (-702.763) (-704.608) (-704.829) [-700.725] * (-701.044) (-701.825) [-703.945] (-702.686) -- 0:00:07
374500 -- [-702.109] (-704.129) (-706.607) (-701.945) * [-701.662] (-703.092) (-705.057) (-703.474) -- 0:00:07
375000 -- [-702.224] (-703.262) (-702.954) (-701.052) * (-702.314) (-703.554) [-702.459] (-705.015) -- 0:00:07
Average standard deviation of split frequencies: 0.008407
375500 -- [-703.379] (-700.950) (-701.423) (-702.542) * [-704.108] (-707.390) (-704.346) (-703.728) -- 0:00:07
376000 -- (-705.127) (-701.635) [-701.894] (-704.601) * (-708.596) [-707.057] (-705.540) (-703.766) -- 0:00:07
376500 -- (-701.637) [-702.331] (-702.225) (-702.760) * (-700.937) [-702.534] (-702.615) (-702.405) -- 0:00:07
377000 -- (-703.143) (-704.350) (-703.506) [-705.502] * (-700.899) (-702.098) (-702.842) [-701.244] -- 0:00:07
377500 -- (-704.512) (-707.581) [-701.749] (-702.583) * (-704.624) [-705.151] (-704.299) (-701.585) -- 0:00:07
378000 -- (-704.173) (-703.196) (-702.912) [-706.011] * (-705.258) (-704.135) [-706.159] (-702.554) -- 0:00:07
378500 -- (-702.262) (-702.095) (-706.024) [-707.744] * (-702.729) [-703.972] (-704.658) (-708.423) -- 0:00:07
379000 -- (-701.556) [-705.059] (-705.550) (-709.170) * (-702.066) [-701.139] (-704.384) (-702.181) -- 0:00:07
379500 -- (-702.319) (-703.827) [-702.744] (-702.428) * (-702.224) (-702.074) (-703.507) [-702.438] -- 0:00:07
380000 -- (-703.649) (-702.194) (-701.480) [-705.548] * (-702.101) (-708.133) [-701.729] (-702.037) -- 0:00:07
Average standard deviation of split frequencies: 0.009324
380500 -- (-701.274) (-706.674) (-702.910) [-702.843] * (-704.227) [-704.300] (-705.462) (-701.729) -- 0:00:07
381000 -- [-703.607] (-710.032) (-701.700) (-704.375) * (-706.974) (-701.725) [-702.224] (-702.651) -- 0:00:07
381500 -- (-702.471) (-707.869) [-702.277] (-703.339) * (-702.862) (-704.186) (-702.468) [-703.104] -- 0:00:07
382000 -- (-701.836) [-705.132] (-701.101) (-701.224) * [-701.171] (-707.023) (-702.784) (-702.076) -- 0:00:07
382500 -- [-704.316] (-706.107) (-707.170) (-703.143) * (-701.718) (-706.425) [-702.531] (-703.535) -- 0:00:07
383000 -- (-707.884) (-705.333) (-702.486) [-701.736] * (-702.364) (-705.250) (-702.698) [-702.086] -- 0:00:07
383500 -- (-705.361) [-703.309] (-703.969) (-700.953) * (-702.883) [-701.058] (-703.484) (-704.943) -- 0:00:07
384000 -- (-703.589) (-701.016) (-703.031) [-700.789] * (-705.960) (-706.495) [-704.861] (-704.245) -- 0:00:07
384500 -- (-703.528) (-701.702) [-703.170] (-703.281) * [-702.692] (-705.085) (-702.079) (-702.620) -- 0:00:07
385000 -- [-704.821] (-704.318) (-701.291) (-702.587) * (-705.189) [-703.328] (-707.451) (-707.055) -- 0:00:07
Average standard deviation of split frequencies: 0.009339
385500 -- (-703.309) (-705.008) (-701.776) [-702.864] * (-705.604) [-702.141] (-705.577) (-702.737) -- 0:00:07
386000 -- (-703.281) [-707.734] (-704.161) (-701.766) * (-704.738) [-702.191] (-701.941) (-702.687) -- 0:00:07
386500 -- [-702.403] (-704.010) (-702.265) (-702.732) * [-705.217] (-702.668) (-701.887) (-701.299) -- 0:00:07
387000 -- [-702.664] (-702.286) (-701.333) (-703.170) * (-706.592) [-702.190] (-702.650) (-704.562) -- 0:00:07
387500 -- (-701.658) (-705.321) [-701.873] (-706.532) * [-701.343] (-702.468) (-704.502) (-707.925) -- 0:00:06
388000 -- (-701.716) [-702.143] (-703.172) (-704.190) * [-704.114] (-701.973) (-703.407) (-703.908) -- 0:00:06
388500 -- (-702.949) (-702.094) (-701.860) [-702.267] * (-704.287) (-700.907) (-702.479) [-701.918] -- 0:00:06
389000 -- [-706.110] (-702.098) (-701.527) (-703.565) * (-703.222) [-703.808] (-703.088) (-701.069) -- 0:00:06
389500 -- (-704.193) (-702.822) [-705.095] (-706.100) * (-704.515) [-703.536] (-703.122) (-700.738) -- 0:00:06
390000 -- (-703.367) (-704.269) [-701.691] (-703.356) * (-703.910) [-704.120] (-703.114) (-701.068) -- 0:00:06
Average standard deviation of split frequencies: 0.009369
390500 -- (-702.283) [-703.769] (-704.174) (-703.930) * (-702.044) (-705.429) [-702.322] (-706.138) -- 0:00:06
391000 -- (-702.219) (-703.330) [-702.078] (-701.538) * (-701.359) [-701.713] (-702.453) (-703.793) -- 0:00:06
391500 -- [-701.965] (-703.985) (-701.458) (-702.799) * [-702.267] (-701.797) (-703.808) (-705.685) -- 0:00:06
392000 -- (-702.722) [-702.004] (-703.094) (-702.500) * (-703.334) (-702.834) [-701.918] (-702.402) -- 0:00:06
392500 -- (-703.617) (-703.315) (-702.935) [-703.189] * (-703.016) (-702.711) (-704.048) [-701.699] -- 0:00:06
393000 -- [-704.154] (-702.762) (-703.676) (-701.812) * (-712.630) (-703.310) [-702.587] (-703.448) -- 0:00:06
393500 -- [-706.055] (-704.777) (-702.946) (-701.501) * (-702.364) [-700.823] (-700.969) (-704.093) -- 0:00:06
394000 -- (-704.369) [-701.617] (-702.164) (-702.444) * (-701.940) [-701.983] (-702.046) (-704.963) -- 0:00:06
394500 -- (-704.971) [-701.373] (-701.166) (-704.282) * (-703.519) (-702.563) [-701.887] (-706.243) -- 0:00:06
395000 -- (-701.899) [-701.539] (-702.382) (-702.428) * (-703.410) (-704.030) (-702.765) [-704.559] -- 0:00:06
Average standard deviation of split frequencies: 0.009313
395500 -- (-706.479) (-703.167) (-705.709) [-702.283] * [-705.470] (-704.568) (-701.547) (-703.126) -- 0:00:06
396000 -- [-701.929] (-703.139) (-705.491) (-701.516) * (-703.491) [-703.167] (-704.152) (-705.074) -- 0:00:06
396500 -- (-702.343) [-702.796] (-705.455) (-705.223) * [-700.936] (-702.084) (-703.181) (-703.212) -- 0:00:06
397000 -- (-701.077) (-702.471) [-705.132] (-705.312) * (-701.415) (-702.406) (-704.656) [-703.925] -- 0:00:06
397500 -- [-703.136] (-704.482) (-702.823) (-701.657) * (-701.299) (-703.387) (-706.470) [-702.580] -- 0:00:06
398000 -- (-704.969) [-702.982] (-702.147) (-701.307) * (-701.818) (-704.843) (-705.377) [-701.501] -- 0:00:06
398500 -- [-701.725] (-702.296) (-703.822) (-702.286) * (-704.074) (-705.683) (-703.443) [-703.900] -- 0:00:06
399000 -- (-704.258) (-705.060) (-702.982) [-701.778] * [-702.123] (-702.284) (-703.741) (-701.935) -- 0:00:06
399500 -- (-702.018) (-702.740) (-704.327) [-702.281] * [-702.279] (-703.655) (-704.427) (-702.393) -- 0:00:06
400000 -- (-706.998) (-702.913) [-701.954] (-702.205) * (-701.483) (-701.286) (-703.272) [-703.271] -- 0:00:06
Average standard deviation of split frequencies: 0.010174
400500 -- [-705.375] (-706.714) (-703.874) (-701.315) * (-702.194) (-702.520) [-702.056] (-702.847) -- 0:00:06
401000 -- (-701.677) [-701.301] (-705.102) (-705.427) * (-702.197) (-703.531) [-701.777] (-702.644) -- 0:00:06
401500 -- (-701.374) (-702.618) (-704.466) [-702.878] * [-704.136] (-703.233) (-702.765) (-702.622) -- 0:00:06
402000 -- (-700.897) (-703.017) [-708.420] (-702.992) * (-702.693) (-709.013) [-702.099] (-707.412) -- 0:00:06
402500 -- (-706.203) [-703.314] (-703.206) (-702.972) * (-705.035) [-706.092] (-701.226) (-702.827) -- 0:00:06
403000 -- [-702.499] (-703.174) (-704.986) (-702.850) * (-702.290) [-701.236] (-701.370) (-703.383) -- 0:00:06
403500 -- [-701.916] (-702.341) (-702.359) (-703.357) * (-701.371) [-702.303] (-703.240) (-703.388) -- 0:00:05
404000 -- [-701.184] (-702.745) (-702.474) (-703.036) * (-701.632) (-701.742) [-707.496] (-704.615) -- 0:00:05
404500 -- (-702.566) (-705.430) (-703.263) [-707.780] * [-701.659] (-703.662) (-708.972) (-702.080) -- 0:00:05
405000 -- (-702.235) [-703.435] (-702.662) (-702.570) * (-704.572) [-701.660] (-703.561) (-703.488) -- 0:00:05
Average standard deviation of split frequencies: 0.011095
405500 -- [-703.326] (-707.944) (-702.705) (-701.503) * [-702.306] (-705.280) (-701.731) (-704.238) -- 0:00:05
406000 -- [-703.372] (-706.178) (-707.132) (-703.956) * (-705.436) (-708.560) [-702.937] (-701.613) -- 0:00:05
406500 -- (-703.747) (-705.914) (-706.377) [-706.522] * [-704.233] (-702.995) (-702.258) (-701.878) -- 0:00:05
407000 -- (-701.205) (-704.381) [-711.068] (-704.447) * [-704.387] (-704.092) (-702.699) (-702.594) -- 0:00:05
407500 -- (-701.779) (-705.191) [-704.767] (-702.711) * [-704.129] (-704.249) (-704.651) (-703.928) -- 0:00:05
408000 -- (-705.244) (-701.932) (-703.057) [-701.411] * (-702.355) (-705.314) (-702.070) [-701.798] -- 0:00:05
408500 -- (-704.237) [-702.958] (-702.976) (-703.885) * (-701.740) (-702.973) [-702.936] (-701.377) -- 0:00:05
409000 -- (-701.399) (-704.920) (-705.599) [-706.403] * (-701.945) (-705.551) [-702.665] (-701.106) -- 0:00:05
409500 -- (-702.810) (-701.074) [-702.213] (-704.756) * (-707.204) (-702.473) [-701.792] (-701.910) -- 0:00:05
410000 -- [-701.881] (-702.601) (-702.167) (-701.801) * [-702.628] (-703.231) (-702.049) (-703.180) -- 0:00:05
Average standard deviation of split frequencies: 0.010669
410500 -- [-706.220] (-701.674) (-703.617) (-703.576) * (-702.274) [-703.488] (-705.639) (-704.538) -- 0:00:05
411000 -- (-702.317) (-701.053) (-702.620) [-704.793] * [-701.815] (-703.946) (-701.413) (-707.570) -- 0:00:05
411500 -- (-702.054) (-702.965) (-705.404) [-704.994] * (-704.648) (-703.105) (-702.568) [-704.018] -- 0:00:05
412000 -- (-701.997) (-703.498) [-703.374] (-704.916) * (-702.369) (-704.716) [-702.446] (-704.273) -- 0:00:05
412500 -- [-702.044] (-702.601) (-703.180) (-701.591) * (-703.658) (-704.758) [-702.644] (-702.486) -- 0:00:05
413000 -- (-704.554) [-703.179] (-703.873) (-701.180) * (-704.836) [-704.387] (-701.095) (-702.429) -- 0:00:05
413500 -- (-703.149) [-702.653] (-703.487) (-702.024) * [-702.072] (-705.200) (-701.468) (-701.349) -- 0:00:05
414000 -- (-703.149) [-703.605] (-704.714) (-701.162) * (-703.040) (-703.137) (-703.148) [-702.146] -- 0:00:05
414500 -- (-703.973) (-705.352) (-702.026) [-702.074] * (-703.339) (-703.356) (-703.342) [-700.893] -- 0:00:05
415000 -- (-702.236) (-705.877) [-701.587] (-703.042) * (-702.814) (-702.404) (-706.154) [-702.782] -- 0:00:05
Average standard deviation of split frequencies: 0.009865
415500 -- (-703.433) (-702.523) [-700.995] (-706.460) * (-701.974) (-701.976) (-705.738) [-701.020] -- 0:00:05
416000 -- (-704.161) [-701.431] (-703.155) (-704.942) * (-700.918) [-703.480] (-701.527) (-703.555) -- 0:00:05
416500 -- (-703.185) (-703.935) (-703.897) [-702.624] * (-700.746) [-701.003] (-701.066) (-706.514) -- 0:00:05
417000 -- [-703.391] (-705.578) (-702.210) (-702.850) * (-701.015) [-701.019] (-702.836) (-707.426) -- 0:00:05
417500 -- [-704.913] (-705.365) (-703.442) (-702.234) * (-701.345) (-701.830) [-704.148] (-703.360) -- 0:00:05
418000 -- [-701.753] (-703.205) (-702.560) (-701.377) * [-703.882] (-703.028) (-702.051) (-703.773) -- 0:00:05
418500 -- [-705.234] (-701.633) (-702.672) (-701.174) * (-702.437) (-703.159) (-704.382) [-706.121] -- 0:00:05
419000 -- (-702.564) [-701.664] (-702.334) (-701.457) * [-702.320] (-702.232) (-704.317) (-704.468) -- 0:00:05
419500 -- [-703.008] (-702.009) (-708.442) (-701.866) * (-702.173) [-702.692] (-703.554) (-705.165) -- 0:00:04
420000 -- (-706.797) (-705.819) [-703.275] (-703.566) * (-702.548) [-705.160] (-703.415) (-703.248) -- 0:00:04
Average standard deviation of split frequencies: 0.009665
420500 -- (-707.196) [-702.682] (-708.945) (-704.174) * (-702.141) [-703.348] (-702.598) (-701.847) -- 0:00:04
421000 -- (-701.306) [-701.738] (-702.309) (-703.654) * [-702.175] (-703.972) (-703.934) (-702.184) -- 0:00:04
421500 -- [-702.129] (-701.901) (-708.912) (-701.318) * (-703.268) (-706.595) [-701.407] (-701.476) -- 0:00:04
422000 -- [-701.912] (-702.966) (-702.708) (-703.327) * (-701.540) (-701.533) [-702.239] (-700.966) -- 0:00:04
422500 -- (-703.967) (-702.644) [-702.592] (-701.810) * [-704.896] (-702.328) (-701.011) (-706.278) -- 0:00:04
423000 -- (-702.340) (-702.003) (-705.919) [-701.828] * [-704.162] (-702.172) (-702.439) (-706.694) -- 0:00:04
423500 -- (-701.754) (-702.029) [-703.246] (-702.402) * (-703.056) (-701.836) [-704.934] (-706.746) -- 0:00:04
424000 -- (-701.973) (-705.320) (-704.524) [-705.388] * [-703.022] (-706.824) (-702.444) (-703.613) -- 0:00:04
424500 -- (-703.458) [-701.070] (-701.721) (-705.306) * (-705.680) (-702.376) [-703.133] (-703.816) -- 0:00:04
425000 -- (-702.116) [-703.597] (-702.168) (-706.887) * (-703.491) (-702.333) (-703.070) [-701.867] -- 0:00:04
Average standard deviation of split frequencies: 0.010220
425500 -- [-701.736] (-703.134) (-702.386) (-702.569) * [-701.502] (-703.607) (-701.630) (-702.331) -- 0:00:04
426000 -- (-704.294) (-703.530) (-703.847) [-702.573] * (-701.508) (-701.669) [-701.708] (-703.760) -- 0:00:04
426500 -- [-701.649] (-706.989) (-702.647) (-706.014) * (-701.768) (-701.821) [-702.893] (-704.434) -- 0:00:04
427000 -- [-701.396] (-702.952) (-705.661) (-703.208) * (-701.921) (-703.098) [-701.492] (-704.797) -- 0:00:04
427500 -- [-701.027] (-706.328) (-705.558) (-703.091) * (-702.152) (-705.710) (-702.680) [-701.821] -- 0:00:04
428000 -- (-702.265) [-701.920] (-702.345) (-701.821) * (-702.449) [-705.606] (-704.034) (-701.305) -- 0:00:04
428500 -- [-701.151] (-703.992) (-703.927) (-702.864) * (-703.660) (-703.933) [-702.965] (-701.458) -- 0:00:04
429000 -- (-700.931) (-706.192) [-702.865] (-702.605) * (-704.627) [-704.583] (-701.733) (-702.006) -- 0:00:04
429500 -- (-702.845) (-701.100) [-704.074] (-700.882) * [-701.680] (-706.355) (-704.105) (-704.758) -- 0:00:04
430000 -- (-702.446) [-702.213] (-703.953) (-700.956) * (-709.457) (-705.041) (-701.566) [-704.241] -- 0:00:04
Average standard deviation of split frequencies: 0.010109
430500 -- (-704.084) (-703.168) (-702.806) [-702.759] * (-704.141) [-703.568] (-703.213) (-704.505) -- 0:00:04
431000 -- (-706.824) [-705.150] (-702.470) (-702.261) * (-701.548) (-701.316) [-703.195] (-703.105) -- 0:00:04
431500 -- (-702.744) (-702.302) [-701.752] (-704.728) * (-702.639) (-701.821) (-701.615) [-703.310] -- 0:00:04
432000 -- (-702.693) (-704.142) [-702.293] (-702.806) * (-705.303) (-702.602) (-702.798) [-702.933] -- 0:00:04
432500 -- [-701.954] (-705.390) (-705.160) (-701.548) * (-702.586) (-706.668) [-703.375] (-703.800) -- 0:00:04
433000 -- (-702.828) [-703.263] (-702.650) (-702.234) * (-705.230) [-706.352] (-702.134) (-701.278) -- 0:00:04
433500 -- (-705.564) [-705.849] (-705.826) (-701.873) * [-704.961] (-702.635) (-704.795) (-703.416) -- 0:00:04
434000 -- (-705.720) [-703.444] (-702.963) (-703.085) * (-702.488) [-704.103] (-704.319) (-703.574) -- 0:00:04
434500 -- (-705.185) (-703.209) (-703.939) [-703.828] * [-703.748] (-702.148) (-701.369) (-703.318) -- 0:00:04
435000 -- [-703.614] (-703.331) (-702.818) (-702.560) * [-704.661] (-703.248) (-703.290) (-705.606) -- 0:00:04
Average standard deviation of split frequencies: 0.009540
435500 -- [-705.203] (-704.213) (-704.656) (-706.469) * (-702.776) [-703.193] (-704.014) (-701.113) -- 0:00:03
436000 -- (-703.572) (-702.278) [-701.628] (-705.292) * [-702.331] (-702.313) (-708.608) (-701.503) -- 0:00:03
436500 -- (-705.657) (-703.711) [-705.327] (-703.745) * (-704.836) (-704.580) (-707.310) [-702.069] -- 0:00:03
437000 -- (-703.669) (-702.446) [-702.318] (-702.279) * [-702.170] (-702.869) (-703.381) (-708.275) -- 0:00:03
437500 -- (-703.165) (-702.116) [-706.191] (-702.200) * (-706.103) [-700.756] (-705.382) (-703.034) -- 0:00:03
438000 -- (-702.252) (-704.144) (-703.762) [-704.855] * (-703.684) (-700.985) [-700.972] (-701.622) -- 0:00:03
438500 -- (-703.944) (-703.950) [-707.908] (-705.570) * (-702.161) (-704.340) [-705.599] (-703.074) -- 0:00:03
439000 -- [-701.480] (-701.766) (-703.005) (-702.310) * (-703.393) [-703.581] (-707.391) (-707.123) -- 0:00:03
439500 -- (-706.399) (-701.200) [-704.854] (-701.406) * (-702.912) (-706.971) [-701.551] (-702.109) -- 0:00:03
440000 -- (-704.055) [-701.740] (-701.368) (-701.514) * (-702.635) (-704.052) (-702.055) [-702.696] -- 0:00:03
Average standard deviation of split frequencies: 0.010068
440500 -- (-701.830) [-704.545] (-701.731) (-702.867) * (-702.684) [-701.195] (-705.267) (-702.826) -- 0:00:03
441000 -- (-701.502) [-703.455] (-704.154) (-701.542) * (-706.141) (-703.458) [-701.473] (-702.342) -- 0:00:03
441500 -- (-703.847) [-702.060] (-703.224) (-702.376) * (-701.812) (-701.893) [-702.017] (-703.653) -- 0:00:03
442000 -- (-703.369) (-703.155) [-705.166] (-703.218) * (-703.449) [-701.405] (-707.875) (-701.105) -- 0:00:03
442500 -- (-702.406) (-702.310) (-702.549) [-702.070] * (-703.220) [-701.432] (-705.811) (-702.332) -- 0:00:03
443000 -- (-703.136) [-704.365] (-701.512) (-703.840) * (-704.850) [-703.485] (-703.364) (-706.862) -- 0:00:03
443500 -- (-704.313) (-704.067) (-702.526) [-703.688] * (-701.487) (-701.130) (-703.551) [-703.484] -- 0:00:03
444000 -- (-705.207) (-704.651) [-702.059] (-703.561) * (-703.132) (-702.682) (-701.901) [-707.285] -- 0:00:03
444500 -- (-706.281) (-701.890) (-702.409) [-702.163] * (-703.130) (-703.953) [-703.813] (-704.736) -- 0:00:03
445000 -- (-703.889) (-702.161) [-701.176] (-701.088) * (-706.769) (-705.245) (-703.815) [-705.411] -- 0:00:03
Average standard deviation of split frequencies: 0.009824
445500 -- (-707.318) [-702.029] (-702.307) (-701.345) * (-702.332) (-712.818) [-704.314] (-704.897) -- 0:00:03
446000 -- (-703.576) (-702.942) (-706.541) [-701.425] * (-702.205) (-703.758) (-702.343) [-706.483] -- 0:00:03
446500 -- (-702.747) (-701.422) [-701.192] (-700.786) * (-702.512) (-701.553) [-705.039] (-703.020) -- 0:00:03
447000 -- [-702.793] (-703.454) (-701.015) (-702.109) * (-702.595) [-704.017] (-706.303) (-701.107) -- 0:00:03
447500 -- [-700.905] (-702.576) (-702.224) (-706.302) * [-702.301] (-704.433) (-707.025) (-701.287) -- 0:00:03
448000 -- [-703.886] (-701.037) (-702.804) (-703.385) * [-702.956] (-703.638) (-703.939) (-703.040) -- 0:00:03
448500 -- (-703.473) [-703.485] (-703.763) (-702.330) * (-701.055) [-701.506] (-702.655) (-706.172) -- 0:00:03
449000 -- [-704.882] (-701.421) (-702.433) (-704.357) * (-701.179) [-701.944] (-701.732) (-705.263) -- 0:00:03
449500 -- (-704.496) (-702.357) (-705.414) [-701.756] * (-703.379) (-703.890) [-702.331] (-704.482) -- 0:00:03
450000 -- [-705.204] (-704.367) (-704.952) (-705.527) * (-703.305) (-702.240) [-702.006] (-703.062) -- 0:00:03
Average standard deviation of split frequencies: 0.009783
450500 -- (-707.886) (-702.545) (-707.382) [-702.863] * (-703.482) [-701.132] (-702.600) (-705.667) -- 0:00:03
451000 -- (-701.441) [-704.246] (-701.410) (-702.384) * [-701.163] (-701.456) (-701.113) (-703.177) -- 0:00:03
451500 -- [-701.930] (-703.224) (-701.892) (-701.520) * (-702.457) [-701.338] (-702.105) (-707.810) -- 0:00:03
452000 -- (-701.829) (-703.464) [-701.093] (-703.848) * (-702.883) [-701.689] (-703.763) (-705.913) -- 0:00:02
452500 -- (-705.094) [-702.005] (-704.140) (-703.486) * (-702.609) [-701.361] (-703.740) (-705.239) -- 0:00:02
453000 -- (-701.618) (-709.782) (-703.083) [-703.152] * (-701.807) (-703.963) [-706.619] (-706.980) -- 0:00:02
453500 -- [-704.704] (-705.426) (-702.052) (-705.968) * (-702.818) (-702.173) (-704.195) [-705.332] -- 0:00:02
454000 -- (-708.165) (-703.707) [-703.134] (-708.152) * (-701.498) [-704.034] (-703.795) (-701.562) -- 0:00:02
454500 -- (-702.669) (-702.048) [-702.452] (-701.622) * (-703.945) [-705.955] (-705.312) (-703.364) -- 0:00:02
455000 -- [-704.450] (-701.550) (-702.376) (-705.785) * [-702.563] (-702.070) (-708.595) (-704.622) -- 0:00:02
Average standard deviation of split frequencies: 0.008916
455500 -- (-703.735) (-706.066) [-704.143] (-704.142) * [-703.149] (-703.452) (-706.005) (-702.898) -- 0:00:02
456000 -- (-705.161) [-705.662] (-701.515) (-702.137) * (-701.540) [-705.823] (-703.100) (-702.346) -- 0:00:02
456500 -- (-701.710) [-701.706] (-703.799) (-702.368) * (-707.288) (-705.354) (-704.970) [-701.942] -- 0:00:02
457000 -- [-701.113] (-703.230) (-708.323) (-702.358) * (-704.361) [-702.445] (-704.721) (-702.779) -- 0:00:02
457500 -- (-704.917) [-705.033] (-706.505) (-701.729) * (-701.448) (-701.498) [-703.220] (-703.106) -- 0:00:02
458000 -- (-702.777) [-705.878] (-704.125) (-701.876) * (-702.657) (-704.104) (-703.278) [-701.134] -- 0:00:02
458500 -- [-703.189] (-702.042) (-702.812) (-703.532) * [-704.330] (-705.521) (-701.622) (-704.939) -- 0:00:02
459000 -- [-704.885] (-704.018) (-703.666) (-703.282) * (-703.994) (-703.427) [-701.794] (-704.913) -- 0:00:02
459500 -- (-703.323) (-701.811) (-702.549) [-702.241] * (-703.398) (-700.850) (-706.882) [-701.773] -- 0:00:02
460000 -- (-703.448) (-705.596) (-702.548) [-702.849] * [-701.709] (-702.702) (-703.351) (-702.608) -- 0:00:02
Average standard deviation of split frequencies: 0.007483
460500 -- (-708.061) (-703.838) [-703.444] (-703.667) * (-703.472) (-701.555) (-703.469) [-701.726] -- 0:00:02
461000 -- (-703.106) (-702.244) [-701.644] (-703.403) * (-703.094) [-702.591] (-705.689) (-704.121) -- 0:00:02
461500 -- (-705.849) [-706.382] (-701.577) (-704.804) * [-704.760] (-703.395) (-701.892) (-701.289) -- 0:00:02
462000 -- [-704.936] (-708.530) (-702.721) (-705.436) * (-702.787) (-701.356) (-701.470) [-701.278] -- 0:00:02
462500 -- (-702.611) [-703.457] (-706.145) (-701.073) * (-702.140) [-703.840] (-716.357) (-701.623) -- 0:00:02
463000 -- [-706.752] (-704.702) (-705.364) (-703.336) * (-702.413) (-706.659) (-704.857) [-704.544] -- 0:00:02
463500 -- (-705.949) (-703.731) (-702.533) [-702.900] * (-705.124) (-704.483) (-705.431) [-704.671] -- 0:00:02
464000 -- (-703.551) [-701.716] (-707.045) (-703.501) * (-702.527) (-704.391) [-707.446] (-704.076) -- 0:00:02
464500 -- (-704.958) (-702.582) [-706.720] (-702.813) * (-701.689) [-703.095] (-702.481) (-703.177) -- 0:00:02
465000 -- (-704.630) (-708.650) [-704.236] (-702.643) * (-701.866) (-701.156) [-701.771] (-701.807) -- 0:00:02
Average standard deviation of split frequencies: 0.007777
465500 -- (-707.135) [-704.599] (-704.227) (-704.174) * (-705.171) (-701.997) [-701.227] (-703.140) -- 0:00:02
466000 -- (-704.294) [-701.622] (-704.230) (-702.183) * [-703.119] (-704.667) (-701.231) (-703.651) -- 0:00:02
466500 -- (-707.861) (-702.342) (-703.850) [-702.343] * (-701.964) (-707.441) (-702.293) [-701.857] -- 0:00:02
467000 -- (-702.052) [-704.751] (-703.952) (-703.729) * [-701.949] (-703.855) (-707.303) (-701.434) -- 0:00:02
467500 -- (-703.610) (-704.484) (-704.033) [-701.683] * [-704.683] (-701.689) (-703.099) (-701.563) -- 0:00:02
468000 -- [-702.264] (-704.813) (-702.009) (-703.466) * (-703.227) [-703.296] (-703.165) (-702.430) -- 0:00:01
468500 -- (-710.430) (-701.667) [-702.077] (-705.743) * (-704.271) [-704.053] (-704.766) (-702.358) -- 0:00:01
469000 -- (-706.549) (-703.203) (-702.193) [-701.158] * [-703.222] (-704.556) (-704.938) (-705.129) -- 0:00:01
469500 -- [-703.226] (-712.096) (-704.135) (-702.311) * (-702.810) [-704.430] (-703.904) (-703.057) -- 0:00:01
470000 -- (-704.013) [-703.754] (-702.616) (-704.991) * [-701.524] (-702.707) (-701.776) (-701.763) -- 0:00:01
Average standard deviation of split frequencies: 0.006744
470500 -- (-702.981) [-701.458] (-701.758) (-701.919) * (-701.965) (-704.745) [-706.429] (-707.752) -- 0:00:01
471000 -- (-703.178) (-702.195) [-706.043] (-701.456) * (-701.064) [-701.531] (-706.185) (-702.282) -- 0:00:01
471500 -- (-706.232) (-702.147) (-701.091) [-702.417] * (-703.288) (-702.625) [-703.364] (-702.630) -- 0:00:01
472000 -- [-702.444] (-701.649) (-702.263) (-707.544) * (-703.305) [-701.988] (-704.292) (-701.343) -- 0:00:01
472500 -- (-702.145) [-702.111] (-701.872) (-705.369) * (-701.564) (-701.824) [-704.763] (-704.630) -- 0:00:01
473000 -- [-701.719] (-704.299) (-705.329) (-702.794) * (-702.457) (-705.515) (-702.836) [-702.098] -- 0:00:01
473500 -- (-702.636) [-702.914] (-701.486) (-703.997) * (-700.983) [-702.917] (-702.958) (-702.198) -- 0:00:01
474000 -- (-702.250) (-701.984) [-703.081] (-703.228) * (-703.282) (-703.504) (-701.775) [-702.065] -- 0:00:01
474500 -- (-702.323) [-702.011] (-703.227) (-709.704) * (-702.004) (-703.775) (-702.095) [-702.226] -- 0:00:01
475000 -- [-703.568] (-707.417) (-704.474) (-707.899) * (-701.252) (-704.576) [-704.112] (-702.410) -- 0:00:01
Average standard deviation of split frequencies: 0.006074
475500 -- [-707.771] (-700.872) (-704.477) (-710.444) * (-704.463) [-702.389] (-704.599) (-703.317) -- 0:00:01
476000 -- (-704.024) (-704.876) (-704.877) [-704.981] * (-703.727) [-702.996] (-703.726) (-701.716) -- 0:00:01
476500 -- [-702.847] (-712.527) (-701.809) (-702.681) * (-704.638) [-700.798] (-707.806) (-702.974) -- 0:00:01
477000 -- (-703.815) [-711.541] (-702.133) (-706.362) * (-703.938) (-702.771) [-703.379] (-701.189) -- 0:00:01
477500 -- [-701.597] (-706.992) (-703.270) (-702.140) * (-702.107) (-702.502) [-701.675] (-702.658) -- 0:00:01
478000 -- [-701.705] (-708.337) (-703.914) (-703.919) * [-702.077] (-702.107) (-702.721) (-702.626) -- 0:00:01
478500 -- [-702.024] (-705.729) (-704.422) (-704.232) * [-702.455] (-705.508) (-702.966) (-703.657) -- 0:00:01
479000 -- (-704.036) (-703.759) [-704.133] (-704.251) * [-703.961] (-702.226) (-702.840) (-701.694) -- 0:00:01
479500 -- (-709.578) (-701.535) [-702.504] (-702.691) * (-707.676) (-703.608) [-703.060] (-702.348) -- 0:00:01
480000 -- (-704.116) [-701.435] (-702.588) (-705.095) * [-701.615] (-707.085) (-703.818) (-703.184) -- 0:00:01
Average standard deviation of split frequencies: 0.006211
480500 -- (-704.575) (-704.084) (-706.652) [-703.134] * (-702.789) (-702.568) [-705.070] (-701.562) -- 0:00:01
481000 -- [-703.320] (-700.934) (-701.775) (-704.134) * (-702.325) (-703.977) (-709.530) [-701.601] -- 0:00:01
481500 -- (-703.931) (-702.065) [-702.401] (-707.803) * (-702.811) (-705.948) [-703.328] (-703.463) -- 0:00:01
482000 -- (-702.872) (-702.734) [-700.975] (-704.110) * (-706.370) [-702.930] (-703.491) (-703.020) -- 0:00:01
482500 -- (-701.757) [-706.555] (-703.425) (-702.317) * (-709.426) (-704.294) [-703.848] (-701.553) -- 0:00:01
483000 -- (-703.874) [-702.845] (-703.164) (-702.035) * (-703.148) [-703.645] (-703.647) (-703.030) -- 0:00:01
483500 -- [-702.874] (-704.236) (-702.739) (-702.841) * (-702.877) [-703.215] (-704.111) (-705.869) -- 0:00:00
484000 -- (-701.192) [-702.496] (-703.996) (-702.027) * [-702.993] (-703.778) (-702.464) (-704.009) -- 0:00:00
484500 -- (-701.628) (-701.517) (-704.264) [-702.561] * [-710.349] (-704.526) (-704.241) (-701.443) -- 0:00:00
485000 -- (-701.572) [-703.330] (-701.216) (-703.962) * (-710.072) (-702.082) (-702.677) [-702.635] -- 0:00:00
Average standard deviation of split frequencies: 0.006426
485500 -- (-704.425) (-708.102) (-705.987) [-703.638] * (-701.682) (-702.312) [-703.541] (-707.803) -- 0:00:00
486000 -- (-708.718) (-703.912) [-703.570] (-707.619) * (-704.964) (-703.801) [-702.815] (-703.654) -- 0:00:00
486500 -- (-703.712) (-704.079) [-703.855] (-705.926) * [-702.983] (-704.574) (-704.952) (-702.522) -- 0:00:00
487000 -- (-701.647) (-703.245) (-706.529) [-705.335] * [-703.984] (-701.335) (-701.076) (-701.589) -- 0:00:00
487500 -- (-700.969) [-702.455] (-704.931) (-703.543) * (-703.754) [-702.573] (-705.844) (-702.085) -- 0:00:00
488000 -- (-701.319) (-708.081) (-702.186) [-703.562] * (-702.617) (-701.370) (-701.388) [-702.538] -- 0:00:00
488500 -- (-701.464) [-703.445] (-703.414) (-702.070) * [-708.476] (-703.044) (-701.614) (-702.979) -- 0:00:00
489000 -- [-703.696] (-705.882) (-704.960) (-701.627) * (-705.520) (-704.779) [-701.173] (-702.160) -- 0:00:00
489500 -- [-701.228] (-708.064) (-704.349) (-702.609) * [-701.430] (-704.830) (-702.295) (-705.250) -- 0:00:00
490000 -- (-704.152) (-701.478) [-702.187] (-703.650) * [-702.443] (-701.293) (-701.775) (-705.543) -- 0:00:00
Average standard deviation of split frequencies: 0.006005
490500 -- [-701.647] (-705.157) (-708.123) (-704.082) * (-702.749) (-701.834) (-708.075) [-706.083] -- 0:00:00
491000 -- [-701.321] (-704.616) (-700.749) (-701.894) * (-706.090) (-701.697) [-702.929] (-702.992) -- 0:00:00
491500 -- [-702.537] (-703.704) (-705.695) (-702.149) * (-703.745) (-703.949) [-703.311] (-701.311) -- 0:00:00
492000 -- (-703.531) [-701.533] (-703.821) (-704.105) * (-702.389) [-702.616] (-701.988) (-706.548) -- 0:00:00
492500 -- (-703.911) (-704.372) [-704.507] (-702.613) * (-703.279) (-703.847) (-702.673) [-704.095] -- 0:00:00
493000 -- (-704.177) (-701.482) [-704.698] (-702.181) * [-701.606] (-703.848) (-702.768) (-705.025) -- 0:00:00
493500 -- (-702.398) (-701.103) (-710.654) [-701.224] * [-701.886] (-703.144) (-702.734) (-702.325) -- 0:00:00
494000 -- (-701.801) [-702.631] (-708.469) (-704.120) * [-703.227] (-701.897) (-701.356) (-702.311) -- 0:00:00
494500 -- [-703.775] (-704.208) (-705.599) (-701.451) * [-702.989] (-701.715) (-701.090) (-705.716) -- 0:00:00
495000 -- (-702.647) [-703.380] (-704.551) (-702.769) * (-702.177) (-701.650) [-702.140] (-703.633) -- 0:00:00
Average standard deviation of split frequencies: 0.005821
495500 -- (-708.189) (-701.815) (-704.069) [-702.115] * (-703.342) [-701.872] (-703.852) (-704.315) -- 0:00:00
496000 -- (-703.509) [-702.586] (-701.841) (-701.972) * [-701.564] (-703.733) (-707.030) (-702.582) -- 0:00:00
496500 -- [-702.090] (-703.503) (-705.517) (-706.807) * [-702.532] (-703.790) (-704.316) (-701.803) -- 0:00:00
497000 -- (-704.334) (-703.632) (-703.845) [-701.909] * (-701.069) [-702.846] (-704.102) (-704.287) -- 0:00:00
497500 -- (-701.547) [-702.787] (-707.002) (-707.726) * (-701.536) [-702.445] (-702.761) (-703.095) -- 0:00:00
498000 -- [-705.952] (-703.269) (-703.575) (-704.249) * (-707.321) (-703.036) (-706.521) [-701.406] -- 0:00:00
498500 -- (-701.965) (-702.897) (-702.510) [-705.933] * (-702.608) [-703.066] (-705.169) (-702.380) -- 0:00:00
499000 -- (-701.181) [-701.970] (-702.975) (-703.632) * (-711.690) [-702.484] (-702.321) (-703.382) -- 0:00:00
499500 -- [-702.808] (-701.469) (-702.101) (-704.197) * (-701.114) (-702.382) [-702.998] (-703.516) -- 0:00:00
500000 -- (-706.354) [-702.002] (-703.839) (-701.563) * (-703.235) (-704.392) (-705.059) [-704.150] -- 0:00:00
Average standard deviation of split frequencies: 0.006002
Analysis completed in 30 seconds
Analysis used 30.01 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -700.66
Likelihood of best state for "cold" chain of run 2 was -700.66
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
78.5 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.4 % ( 37 %) Dirichlet(Pi{all})
36.4 % ( 28 %) Slider(Pi{all})
88.2 % ( 80 %) Multiplier(Alpha{1,2})
87.9 % ( 78 %) Multiplier(Alpha{3})
21.2 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
30.7 % ( 27 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
35.4 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
78.3 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.0 % ( 41 %) Dirichlet(Pi{all})
36.4 % ( 29 %) Slider(Pi{all})
88.6 % ( 80 %) Multiplier(Alpha{1,2})
87.3 % ( 84 %) Multiplier(Alpha{3})
20.1 % ( 20 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.4 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 86 %) ParsSPR(Tau{all},V{all})
30.8 % ( 30 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
35.5 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83479 0.82 0.67
3 | 83295 83381 0.83
4 | 83155 83176 83514
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.80 0.64 0.50
2 | 83305 0.82 0.67
3 | 82823 83857 0.84
4 | 83686 82781 83548
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -702.24
| 1 1 1 21 2 |
| 1 1 2 1 221 2 11 |
| 2 21 2 2 1 12 12|
| 1 12 1 222 * 2 11 2 2 2 2 |
| 1 2 11 22 2 |
| 2 2 1 12 1 2 21 2 1 21|
| 2 2 * *2 1122112 1 2 1 2 1 |
| 2 2 1 2 1 2 2 21 1 * |
|1 1 1 1 1 1 2 1 |
| 2 1 21 1 1 1 2 12 |
| 1 12 |
|2 1 |
| 2 2 |
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -704.72
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.38 -705.96
2 -702.41 -705.33
--------------------------------------
TOTAL -702.39 -705.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.911656 0.096813 0.348168 1.525815 0.873717 695.06 723.03 1.001
r(A<->C){all} 0.197807 0.023986 0.000038 0.495866 0.162081 46.20 67.24 1.001
r(A<->G){all} 0.179999 0.023572 0.000180 0.490866 0.137931 55.52 96.85 1.023
r(A<->T){all} 0.164434 0.020429 0.000029 0.465313 0.120254 78.71 88.50 1.002
r(C<->G){all} 0.162080 0.020647 0.000244 0.462343 0.121937 121.67 138.65 1.004
r(C<->T){all} 0.156126 0.017614 0.000153 0.426231 0.118188 84.96 138.05 1.006
r(G<->T){all} 0.139554 0.012414 0.000003 0.362579 0.113890 65.54 75.52 0.999
pi(A){all} 0.198172 0.000312 0.168082 0.235737 0.198160 628.44 688.61 1.000
pi(C){all} 0.342478 0.000437 0.302997 0.385630 0.341734 517.75 607.47 0.999
pi(G){all} 0.297867 0.000398 0.258522 0.335923 0.297571 585.54 668.27 1.002
pi(T){all} 0.161483 0.000253 0.131312 0.192975 0.161113 594.03 648.38 1.000
alpha{1,2} 0.419948 0.244740 0.000125 1.382229 0.259446 564.35 584.41 1.004
alpha{3} 0.481986 0.254383 0.000232 1.441250 0.329692 539.31 566.24 1.001
pinvar{all} 0.997036 0.000012 0.990388 0.999996 0.998161 513.92 579.56 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- ...**.
9 -- .*.***
10 -- ..**..
11 -- .**.**
12 -- ...*.*
13 -- ..*.*.
14 -- .*..*.
15 -- ....**
16 -- ..*..*
17 -- .**...
18 -- .*.*..
19 -- .****.
20 -- ..****
21 -- .***.*
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 236 0.157124 0.005649 0.153129 0.161119 2
8 233 0.155126 0.010357 0.147803 0.162450 2
9 231 0.153795 0.006591 0.149134 0.158455 2
10 228 0.151798 0.005649 0.147803 0.155792 2
11 224 0.149134 0.001883 0.147803 0.150466 2
12 219 0.145806 0.000942 0.145140 0.146471 2
13 218 0.145140 0.000000 0.145140 0.145140 2
14 213 0.141811 0.006591 0.137150 0.146471 2
15 208 0.138482 0.011299 0.130493 0.146471 2
16 207 0.137816 0.006591 0.133156 0.142477 2
17 206 0.137150 0.003766 0.134487 0.139814 2
18 203 0.135153 0.004708 0.131824 0.138482 2
19 200 0.133156 0.015065 0.122503 0.143808 2
20 200 0.133156 0.007532 0.127830 0.138482 2
21 199 0.132490 0.004708 0.129161 0.135819 2
22 153 0.101864 0.004708 0.098535 0.105193 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099728 0.010674 0.000050 0.287001 0.067784 1.000 2
length{all}[2] 0.101949 0.010537 0.000014 0.306168 0.071508 1.000 2
length{all}[3] 0.102370 0.011541 0.000046 0.315037 0.067179 1.000 2
length{all}[4] 0.106540 0.011251 0.000069 0.304813 0.075876 1.001 2
length{all}[5] 0.096914 0.010497 0.000056 0.295424 0.064721 1.000 2
length{all}[6] 0.097660 0.010083 0.000022 0.300374 0.067980 1.000 2
length{all}[7] 0.095322 0.009057 0.001064 0.281641 0.067258 0.997 2
length{all}[8] 0.112786 0.014141 0.000164 0.283498 0.091337 0.997 2
length{all}[9] 0.096189 0.008790 0.000225 0.284662 0.067134 0.996 2
length{all}[10] 0.094987 0.007915 0.001616 0.271854 0.063430 0.998 2
length{all}[11] 0.116413 0.012700 0.000261 0.338990 0.083220 0.996 2
length{all}[12] 0.114806 0.014337 0.000302 0.331059 0.070012 1.009 2
length{all}[13] 0.088925 0.006458 0.000415 0.267687 0.063221 0.999 2
length{all}[14] 0.108987 0.008904 0.000355 0.294674 0.090214 0.997 2
length{all}[15] 0.104046 0.012220 0.000121 0.368470 0.067340 0.995 2
length{all}[16] 0.100719 0.010788 0.000050 0.341889 0.069824 0.995 2
length{all}[17] 0.104481 0.011886 0.000093 0.335657 0.064679 1.000 2
length{all}[18] 0.091024 0.008014 0.000600 0.297912 0.069584 0.998 2
length{all}[19] 0.103141 0.012788 0.000233 0.309705 0.063571 0.997 2
length{all}[20] 0.107563 0.011750 0.000930 0.313750 0.072372 0.997 2
length{all}[21] 0.103079 0.009046 0.000938 0.290598 0.075321 0.996 2
length{all}[22] 0.101219 0.010917 0.000233 0.308924 0.063882 0.994 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006002
Maximum standard deviation of split frequencies = 0.015065
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.998
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 42 trees
90 % credible set contains 88 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 522
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 174 / 174 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 174 / 174 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.094858 0.070434 0.046220 0.012301 0.025675 0.068579 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -746.648559
Iterating by ming2
Initial: fx= 746.648559
x= 0.09486 0.07043 0.04622 0.01230 0.02568 0.06858 0.30000 1.30000
1 h-m-p 0.0000 0.0001 417.5092 ++ 734.148837 m 0.0001 13 | 1/8
2 h-m-p 0.0008 0.0207 35.8846 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 381.4048 ++ 722.775943 m 0.0001 44 | 2/8
4 h-m-p 0.0009 0.0301 29.5883 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 341.4043 ++ 708.717987 m 0.0001 75 | 3/8
6 h-m-p 0.0015 0.0596 23.4243 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 296.3180 ++ 697.145449 m 0.0001 106 | 4/8
8 h-m-p 0.0018 0.0795 17.7884 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 242.6948 ++ 696.502329 m 0.0000 138 | 5/8
10 h-m-p 0.0002 0.1181 12.1719 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 171.2972 ++ 692.257177 m 0.0001 168 | 6/8
12 h-m-p 0.5342 8.0000 0.0000 ++ 692.257177 m 8.0000 179 | 6/8
13 h-m-p 0.3371 8.0000 0.0002 +++ 692.257177 m 8.0000 193 | 6/8
14 h-m-p 0.0160 8.0000 0.3835 +++++ 692.257165 m 8.0000 209 | 6/8
15 h-m-p 0.4107 8.0000 7.4695 +++ 692.257121 m 8.0000 223 | 6/8
16 h-m-p 1.6000 8.0000 4.0620 ++ 692.257117 m 8.0000 234 | 6/8
17 h-m-p 1.4298 8.0000 22.7268 ++ 692.257112 m 8.0000 245 | 6/8
18 h-m-p 1.6000 8.0000 38.4036 ++ 692.257110 m 8.0000 256 | 6/8
19 h-m-p 1.1806 5.9032 71.9399 ++ 692.257109 m 5.9032 267 | 6/8
20 h-m-p 0.9136 4.5680 220.9602 ----------------.. | 6/8
21 h-m-p 0.0160 8.0000 0.0000 ------N 692.257109 0 0.0000 309 | 7/8
22 h-m-p 0.0160 8.0000 0.0000 ------N 692.257109 0 0.0000 328
Out..
lnL = -692.257109
329 lfun, 329 eigenQcodon, 1974 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.024086 0.032277 0.060139 0.094171 0.035203 0.055139 999.000000 0.586260 0.482298
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.024143
np = 9
lnL0 = -742.969487
Iterating by ming2
Initial: fx= 742.969487
x= 0.02409 0.03228 0.06014 0.09417 0.03520 0.05514 951.42857 0.58626 0.48230
1 h-m-p 0.0000 0.0001 406.0155 ++ 719.104299 m 0.0001 14 | 1/9
2 h-m-p 0.0005 0.0023 69.3908 ++ 710.979345 m 0.0023 26 | 2/9
3 h-m-p 0.0000 0.0001 2815.8478 ++ 705.499821 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0001 2344.0068 ++ 699.526086 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0002 74.1688 ++ 697.949474 m 0.0002 62 | 5/9
6 h-m-p 0.0000 0.0002 68.7766 ++ 695.472887 m 0.0002 74 | 6/9
7 h-m-p 0.0093 0.4968 1.3347 -------------.. | 6/9
8 h-m-p 0.0000 0.0001 169.8135 ++ 692.257197 m 0.0001 109 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 692.257197 m 8.0000 121 | 6/9
10 h-m-p 0.0160 8.0000 0.0147 +++++ 692.257188 m 8.0000 138 | 6/9
11 h-m-p 0.2004 1.0020 0.4185 ++ 692.257167 m 1.0020 153 | 7/9
12 h-m-p 1.6000 8.0000 0.0000 Y 692.257167 0 1.6000 168 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 -----------N 692.257167 0 0.0000 193
Out..
lnL = -692.257167
194 lfun, 582 eigenQcodon, 2328 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.096125 0.098377 0.015973 0.045091 0.080858 0.027044 951.360868 1.791115 0.263496 0.487255 152.860952
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.001516
np = 11
lnL0 = -714.846575
Iterating by ming2
Initial: fx= 714.846575
x= 0.09613 0.09838 0.01597 0.04509 0.08086 0.02704 951.36087 1.79112 0.26350 0.48725 152.86095
1 h-m-p 0.0000 0.0006 59.1774 +++ 712.447364 m 0.0006 17 | 1/11
2 h-m-p 0.0020 0.0291 15.6380 ++ 704.799987 m 0.0291 31 | 2/11
3 h-m-p 0.0000 0.0001 343.9480 ++ 704.611361 m 0.0001 45 | 3/11
4 h-m-p 0.0000 0.0000 248475.2334 ++ 703.365501 m 0.0000 59 | 4/11
5 h-m-p 0.0004 0.0020 525.6242 ++ 699.807429 m 0.0020 73 | 5/11
6 h-m-p 0.0004 0.0018 30.5650 ++ 699.128197 m 0.0018 87 | 6/11
7 h-m-p 0.0426 0.2450 1.1963 ++ 692.257125 m 0.2450 101 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 692.257125 m 8.0000 115 | 7/11
9 h-m-p 0.0160 8.0000 0.0038 +++++ 692.257125 m 8.0000 136 | 7/11
10 h-m-p 0.0160 8.0000 2.3774 +++++ 692.257109 m 8.0000 157 | 7/11
11 h-m-p 1.6000 8.0000 0.0023 ---------Y 692.257109 0 0.0000 180 | 7/11
12 h-m-p 0.1874 8.0000 0.0000 Y 692.257109 0 0.1874 198
Out..
lnL = -692.257109
199 lfun, 796 eigenQcodon, 3582 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -692.253129 S = -692.253064 -0.000025
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:02
did 20 / 51 patterns 0:03
did 30 / 51 patterns 0:03
did 40 / 51 patterns 0:03
did 50 / 51 patterns 0:03
did 51 / 51 patterns 0:03
Time used: 0:03
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103771 0.072559 0.082777 0.017376 0.059575 0.029728 951.347663 0.885730 0.468274 72.702773 184.812282 228.672706
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 0.000211
np = 12
lnL0 = -749.765576
Iterating by ming2
Initial: fx= 749.765576
x= 0.10377 0.07256 0.08278 0.01738 0.05958 0.02973 951.34766 0.88573 0.46827 72.70277 184.81228 228.67271
1 h-m-p 0.0000 0.0001 362.2123 ++ 734.577144 m 0.0001 17 | 1/12
2 h-m-p 0.0020 0.0303 18.7763 ------------.. | 1/12
3 h-m-p 0.0000 0.0001 340.5119 ++ 725.231267 m 0.0001 57 | 2/12
4 h-m-p 0.0017 0.0422 13.8560 ------------.. | 2/12
5 h-m-p 0.0000 0.0002 309.3238 +++ 706.155060 m 0.0002 98 | 3/12
6 h-m-p 0.0061 0.0501 8.4745 ------------.. | 3/12
7 h-m-p 0.0000 0.0001 280.7281 ++ 699.553056 m 0.0001 138 | 4/12
8 h-m-p 0.0050 0.2384 3.7748 ------------.. | 4/12
9 h-m-p 0.0000 0.0001 232.6035 ++ 696.003240 m 0.0001 178 | 5/12
10 h-m-p 0.0160 8.0000 1.7676 -------------.. | 5/12
11 h-m-p 0.0000 0.0001 165.2634 ++ 692.257109 m 0.0001 219 | 6/12
12 h-m-p 1.6000 8.0000 0.0000 ----C 692.257109 0 0.0016 238 | 6/12
13 h-m-p 0.0592 8.0000 0.0000 ---N 692.257109 0 0.0002 262
Out..
lnL = -692.257109
263 lfun, 1052 eigenQcodon, 4734 P(t)
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.056800 0.105916 0.099003 0.056568 0.085457 0.041493 951.347663 1.131617 1.831602
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.032567
np = 9
lnL0 = -766.267271
Iterating by ming2
Initial: fx= 766.267271
x= 0.05680 0.10592 0.09900 0.05657 0.08546 0.04149 951.34766 1.13162 1.83160
1 h-m-p 0.0000 0.0003 392.4921 +++ 726.321821 m 0.0003 15 | 1/9
2 h-m-p 0.0065 0.0835 13.8572 ------------.. | 1/9
3 h-m-p 0.0000 0.0001 372.4074 ++ 713.547052 m 0.0001 49 | 2/9
4 h-m-p 0.0054 0.2410 5.5773 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 336.8183 ++ 713.388330 m 0.0000 83 | 3/9
6 h-m-p 0.0008 0.3933 3.8477 -----------.. | 3/9
7 h-m-p 0.0000 0.0002 289.9055 +++ 698.419448 m 0.0002 117 | 4/9
8 h-m-p 0.0174 1.1829 2.3827 -------------.. | 4/9
9 h-m-p 0.0000 0.0001 241.7024 ++ 693.526239 m 0.0001 152 | 5/9
10 h-m-p 0.0062 1.4254 2.2961 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 172.3727 ++ 692.257206 m 0.0000 186 | 6/9
12 h-m-p 0.4079 8.0000 0.0000 +++ 692.257206 m 8.0000 199 | 6/9
13 h-m-p 0.0206 8.0000 0.0003 --C 692.257206 0 0.0003 216
Out..
lnL = -692.257206
217 lfun, 2387 eigenQcodon, 13020 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.104586 0.040250 0.040501 0.054603 0.014948 0.082831 951.347663 0.900000 0.551845 1.585244 145.405546
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.001928
np = 11
lnL0 = -711.331492
Iterating by ming2
Initial: fx= 711.331492
x= 0.10459 0.04025 0.04050 0.05460 0.01495 0.08283 951.34766 0.90000 0.55185 1.58524 145.40555
1 h-m-p 0.0000 0.0007 119.1813 +++CYC 704.237433 2 0.0006 22 | 0/11
2 h-m-p 0.0000 0.0000 89.0570 ++ 704.196336 m 0.0000 36 | 1/11
3 h-m-p 0.0001 0.0235 8.0586 +++++ 702.444071 m 0.0235 53 | 2/11
4 h-m-p 0.0012 0.0060 31.4679 ++ 696.846015 m 0.0060 67 | 3/11
5 h-m-p 0.0002 0.0010 13.4933 ++ 696.793029 m 0.0010 81 | 4/11
6 h-m-p 0.0000 0.0003 535.2518 ++ 695.401874 m 0.0003 95 | 5/11
7 h-m-p 0.1708 1.1717 0.8892 ---------------.. | 5/11
8 h-m-p 0.0000 0.0005 65.6593 +++ 692.257138 m 0.0005 143 | 6/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 692.257138 m 8.0000 157 | 6/11
10 h-m-p 0.0107 5.3582 0.0378 ----------Y 692.257138 0 0.0000 186 | 6/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 692.257137 m 8.0000 208 | 6/11
12 h-m-p 0.0160 8.0000 0.0904 +++++ 692.257115 m 8.0000 230 | 6/11
13 h-m-p 1.6000 8.0000 0.0304 ++ 692.257113 m 8.0000 249 | 6/11
14 h-m-p 0.0825 0.4123 0.3984 +
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
+ 692.257113 m 0.4123 268
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68379) = 9.347233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68352) = 9.348360e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
| 6/11
15 h-m-p -0.0000 -0.0000 0.5501
h-m-p: -2.65070033e-18 -1.32535017e-17 5.50137540e-01 692.257113
..
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68379) = 9.347233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68352) = 9.348360e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347797e-161 2000 rounds
| 6/11
16 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347819e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.347887e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68366) = 9.348157e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68366) = 9.349238e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68366) = 9.353563e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
+ 692.257113 m 8.0000 306
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68379) = 9.358498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68352) = 9.359626e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.359062e-161 2000 rounds
| 6/11
17 h-m-p 0.0160 8.0000 0.0705
QuantileBeta(0.15, 0.00500, 2.68366) = 9.414939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68366) = 9.564255e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68366) = 1.019265e-160 2000 rounds
++++ 692.257110 m 8.0000 328
QuantileBeta(0.15, 0.00498, 2.68366) = 1.920267e-161 2000 rounds
| 6/11
18 h-m-p 1.6000 8.0000 0.0229 ++ 692.257109 m 8.0000 347
QuantileBeta(0.15, 0.00499, 2.68366) = 4.606924e-161 2000 rounds
| 6/11
19 h-m-p 0.0761 0.3804 0.3071 ++ 692.257109 m 0.3804 366
QuantileBeta(0.15, 0.00500, 2.68366) = 8.020308e-161 2000 rounds
| 7/11
20 h-m-p 0.2178 8.0000 0.0006 +++ 692.257109 m 8.0000 386 | 7/11
21 h-m-p 0.0125 0.0624 0.0854 ----Y 692.257109 0 0.0000 408 | 7/11
22 h-m-p 0.0182 8.0000 0.0001 -----C 692.257109 0 0.0000 431 | 7/11
23 h-m-p 0.0870 8.0000 0.0000 -C 692.257109 0 0.0054 450
Out..
lnL = -692.257109
451 lfun, 5412 eigenQcodon, 29766 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -692.253154 S = -692.253065 -0.000039
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:15
did 20 / 51 patterns 0:15
did 30 / 51 patterns 0:15
did 40 / 51 patterns 0:16
did 50 / 51 patterns 0:16
did 51 / 51 patterns 0:16
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=174
NC_011896_1_WP_010908737_1_2291_MLBR_RS10855 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
NC_002677_1_NP_302417_1_1289_ML2151 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE
**************************************************
NC_011896_1_WP_010908737_1_2291_MLBR_RS10855 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
NC_002677_1_NP_302417_1_1289_ML2151 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085 SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER
**************************************************
NC_011896_1_WP_010908737_1_2291_MLBR_RS10855 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
NC_002677_1_NP_302417_1_1289_ML2151 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085 VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP
**************************************************
NC_011896_1_WP_010908737_1_2291_MLBR_RS10855 APPQPPADNFPPTPGDVPSPLARP
NC_002677_1_NP_302417_1_1289_ML2151 APPQPPADNFPPTPGDVPSPLARP
NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375 APPQPPADNFPPTPGDVPSPLARP
NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835 APPQPPADNFPPTPGDVPSPLARP
NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760 APPQPPADNFPPTPGDVPSPLARP
NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085 APPQPPADNFPPTPGDVPSPLARP
************************
>NC_011896_1_WP_010908737_1_2291_MLBR_RS10855 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT ACCCTCACCCCTGGCGCGACCT >NC_002677_1_NP_302417_1_1289_ML2151 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT ACCCTCACCCCTGGCGCGACCT >NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT ACCCTCACCCCTGGCGCGACCT >NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT ACCCTCACCCCTGGCGCGACCT >NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT ACCCTCACCCCTGGCGCGACCT >NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085 ATGAGTGAAAGTTACCGTAAACTCACTACATCGAGCATCATCGTCGCTAA AATCACCTTTACCGGGGCGATGCTAGACGGCAGTATCGCTCTGGCCGGAC AGGCGAGCCCGGCCACCGACAGCGAATGGGATCAGGTAGCCCGTTGCGAG TCCGGTGGGAACTGGTCAATCAACACCGGCAACGGATACCTCGGTGGCCT GCAATTCTCGCAAGGTACCTGGGCGTCGCATGGTGGTGGCGAGTACGCAC CATCGGCTCAACTGGCTACCAGAGAACAGCAAATTGCCGTCGCTGAGCGC GTGCTGGCGACCCAGGGTAGCGGCGCCTGGCCTGCCTGCGGTCACGGATT ATCGGGCCCATCCCTGCAGGAAGTTCTTCCTGCAGGGATGGGCGCGCCCT GGATCAACGGTGCGCCAGCACCGCTAGCCCCACCGCCACCTGCAGAGCCC GCTCCGCCCCAGCCGCCGGCCGACAACTTCCCGCCGACACCGGGCGACGT ACCCTCACCCCTGGCGCGACCT
>NC_011896_1_WP_010908737_1_2291_MLBR_RS10855 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP APPQPPADNFPPTPGDVPSPLARP >NC_002677_1_NP_302417_1_1289_ML2151 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP APPQPPADNFPPTPGDVPSPLARP >NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP APPQPPADNFPPTPGDVPSPLARP >NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP APPQPPADNFPPTPGDVPSPLARP >NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP APPQPPADNFPPTPGDVPSPLARP >NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085 MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCE SGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAER VLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEP APPQPPADNFPPTPGDVPSPLARP
#NEXUS
[ID: 5153100948]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908737_1_2291_MLBR_RS10855
NC_002677_1_NP_302417_1_1289_ML2151
NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375
NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835
NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760
NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908737_1_2291_MLBR_RS10855,
2 NC_002677_1_NP_302417_1_1289_ML2151,
3 NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375,
4 NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835,
5 NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760,
6 NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06778398,2:0.07150811,3:0.06717895,4:0.07587584,5:0.06472063,6:0.06797962);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06778398,2:0.07150811,3:0.06717895,4:0.07587584,5:0.06472063,6:0.06797962);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -702.38 -705.96
2 -702.41 -705.33
--------------------------------------
TOTAL -702.39 -705.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2151/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.911656 0.096813 0.348168 1.525815 0.873717 695.06 723.03 1.001
r(A<->C){all} 0.197807 0.023986 0.000038 0.495866 0.162081 46.20 67.24 1.001
r(A<->G){all} 0.179999 0.023572 0.000180 0.490866 0.137931 55.52 96.85 1.023
r(A<->T){all} 0.164434 0.020429 0.000029 0.465313 0.120254 78.71 88.50 1.002
r(C<->G){all} 0.162080 0.020647 0.000244 0.462343 0.121937 121.67 138.65 1.004
r(C<->T){all} 0.156126 0.017614 0.000153 0.426231 0.118188 84.96 138.05 1.006
r(G<->T){all} 0.139554 0.012414 0.000003 0.362579 0.113890 65.54 75.52 0.999
pi(A){all} 0.198172 0.000312 0.168082 0.235737 0.198160 628.44 688.61 1.000
pi(C){all} 0.342478 0.000437 0.302997 0.385630 0.341734 517.75 607.47 0.999
pi(G){all} 0.297867 0.000398 0.258522 0.335923 0.297571 585.54 668.27 1.002
pi(T){all} 0.161483 0.000253 0.131312 0.192975 0.161113 594.03 648.38 1.000
alpha{1,2} 0.419948 0.244740 0.000125 1.382229 0.259446 564.35 584.41 1.004
alpha{3} 0.481986 0.254383 0.000232 1.441250 0.329692 539.31 566.24 1.001
pinvar{all} 0.997036 0.000012 0.990388 0.999996 0.998161 513.92 579.56 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2151/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 174
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 2 2 2 2 2 2 | TAC 3 3 3 3 3 3 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 4 4 4 4 4 4 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 2 2 2 | CCC 5 5 5 5 5 5 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 2 2 2 2 2 2 | CCA 5 5 5 5 5 5 | Gln CAA 4 4 4 4 4 4 | CGA 1 1 1 1 1 1
CTG 6 6 6 6 6 6 | CCG 9 9 9 9 9 9 | CAG 6 6 6 6 6 6 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 3 3 3 3 3 3
ATC 6 6 6 6 6 6 | ACC 7 7 7 7 7 7 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 0 0 0 0 0 0 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 6 6 6 6 6 6 | Asp GAT 1 1 1 1 1 1 | Gly GGT 8 8 8 8 8 8
GTC 2 2 2 2 2 2 | GCC 8 8 8 8 8 8 | GAC 4 4 4 4 4 4 | GGC 8 8 8 8 8 8
GTA 2 2 2 2 2 2 | GCA 4 4 4 4 4 4 | Glu GAA 4 4 4 4 4 4 | GGA 3 3 3 3 3 3
GTG 1 1 1 1 1 1 | GCG 7 7 7 7 7 7 | GAG 4 4 4 4 4 4 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908737_1_2291_MLBR_RS10855
position 1: T:0.13218 C:0.28736 A:0.20115 G:0.37931
position 2: T:0.17816 C:0.38506 A:0.20115 G:0.23563
position 3: T:0.17241 C:0.35632 A:0.18966 G:0.28161
Average T:0.16092 C:0.34291 A:0.19732 G:0.29885
#2: NC_002677_1_NP_302417_1_1289_ML2151
position 1: T:0.13218 C:0.28736 A:0.20115 G:0.37931
position 2: T:0.17816 C:0.38506 A:0.20115 G:0.23563
position 3: T:0.17241 C:0.35632 A:0.18966 G:0.28161
Average T:0.16092 C:0.34291 A:0.19732 G:0.29885
#3: NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375
position 1: T:0.13218 C:0.28736 A:0.20115 G:0.37931
position 2: T:0.17816 C:0.38506 A:0.20115 G:0.23563
position 3: T:0.17241 C:0.35632 A:0.18966 G:0.28161
Average T:0.16092 C:0.34291 A:0.19732 G:0.29885
#4: NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835
position 1: T:0.13218 C:0.28736 A:0.20115 G:0.37931
position 2: T:0.17816 C:0.38506 A:0.20115 G:0.23563
position 3: T:0.17241 C:0.35632 A:0.18966 G:0.28161
Average T:0.16092 C:0.34291 A:0.19732 G:0.29885
#5: NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760
position 1: T:0.13218 C:0.28736 A:0.20115 G:0.37931
position 2: T:0.17816 C:0.38506 A:0.20115 G:0.23563
position 3: T:0.17241 C:0.35632 A:0.18966 G:0.28161
Average T:0.16092 C:0.34291 A:0.19732 G:0.29885
#6: NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085
position 1: T:0.13218 C:0.28736 A:0.20115 G:0.37931
position 2: T:0.17816 C:0.38506 A:0.20115 G:0.23563
position 3: T:0.17241 C:0.35632 A:0.18966 G:0.28161
Average T:0.16092 C:0.34291 A:0.19732 G:0.29885
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 12 | TAC 18 | TGC 12
Leu L TTA 6 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 30 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 24 | His H CAT 6 | Arg R CGT 12
CTC 12 | CCC 30 | CAC 6 | CGC 6
CTA 12 | CCA 30 | Gln Q CAA 24 | CGA 6
CTG 36 | CCG 54 | CAG 36 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 18
ATC 36 | ACC 42 | AAC 30 | AGC 24
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 18 | ACG 0 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 36 | Asp D GAT 6 | Gly G GGT 48
GTC 12 | GCC 48 | GAC 24 | GGC 48
GTA 12 | GCA 24 | Glu E GAA 24 | GGA 18
GTG 6 | GCG 42 | GAG 24 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13218 C:0.28736 A:0.20115 G:0.37931
position 2: T:0.17816 C:0.38506 A:0.20115 G:0.23563
position 3: T:0.17241 C:0.35632 A:0.18966 G:0.28161
Average T:0.16092 C:0.34291 A:0.19732 G:0.29885
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -692.257109 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 999.000000 145.405546
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908737_1_2291_MLBR_RS10855: 0.000004, NC_002677_1_NP_302417_1_1289_ML2151: 0.000004, NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375: 0.000004, NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835: 0.000004, NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760: 0.000004, NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 145.40555
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.3 179.7 145.4055 0.0000 0.0000 0.0 0.0
7..2 0.000 342.3 179.7 145.4055 0.0000 0.0000 0.0 0.0
7..3 0.000 342.3 179.7 145.4055 0.0000 0.0000 0.0 0.0
7..4 0.000 342.3 179.7 145.4055 0.0000 0.0000 0.0 0.0
7..5 0.000 342.3 179.7 145.4055 0.0000 0.0000 0.0 0.0
7..6 0.000 342.3 179.7 145.4055 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -692.257167 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.360868 0.000010 0.042424
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908737_1_2291_MLBR_RS10855: 0.000004, NC_002677_1_NP_302417_1_1289_ML2151: 0.000004, NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375: 0.000004, NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835: 0.000004, NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760: 0.000004, NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.36087
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.04242 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.4 179.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 342.4 179.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 342.4 179.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 342.4 179.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 342.4 179.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 342.4 179.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -692.257109 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.347663 0.002117 0.000000 0.000001 154.191687
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908737_1_2291_MLBR_RS10855: 0.000004, NC_002677_1_NP_302417_1_1289_ML2151: 0.000004, NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375: 0.000004, NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835: 0.000004, NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760: 0.000004, NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.34766
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00212 0.00000 0.99788
w: 0.00000 1.00000 154.19169
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.4 179.6 153.8652 0.0000 0.0000 0.0 0.0
7..2 0.000 342.4 179.6 153.8652 0.0000 0.0000 0.0 0.0
7..3 0.000 342.4 179.6 153.8652 0.0000 0.0000 0.0 0.0
7..4 0.000 342.4 179.6 153.8652 0.0000 0.0000 0.0 0.0
7..5 0.000 342.4 179.6 153.8652 0.0000 0.0000 0.0 0.0
7..6 0.000 342.4 179.6 153.8652 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908737_1_2291_MLBR_RS10855)
Pr(w>1) post mean +- SE for w
1 M 0.998** 153.865
2 S 0.998** 153.865
3 E 0.998** 153.865
4 S 0.998** 153.865
5 Y 0.998** 153.865
6 R 0.998** 153.865
7 K 0.998** 153.865
8 L 0.998** 153.865
9 T 0.998** 153.865
10 T 0.998** 153.865
11 S 0.998** 153.865
12 S 0.998** 153.865
13 I 0.998** 153.865
14 I 0.998** 153.865
15 V 0.998** 153.865
16 A 0.998** 153.865
17 K 0.998** 153.865
18 I 0.998** 153.865
19 T 0.998** 153.865
20 F 0.998** 153.865
21 T 0.998** 153.865
22 G 0.998** 153.865
23 A 0.998** 153.865
24 M 0.998** 153.865
25 L 0.998** 153.865
26 D 0.998** 153.865
27 G 0.998** 153.865
28 S 0.998** 153.865
29 I 0.998** 153.865
30 A 0.998** 153.865
31 L 0.998** 153.865
32 A 0.998** 153.865
33 G 0.998** 153.865
34 Q 0.998** 153.865
35 A 0.998** 153.865
36 S 0.998** 153.865
37 P 0.998** 153.865
38 A 0.998** 153.865
39 T 0.998** 153.865
40 D 0.998** 153.865
41 S 0.998** 153.865
42 E 0.998** 153.865
43 W 0.998** 153.865
44 D 0.998** 153.865
45 Q 0.998** 153.865
46 V 0.998** 153.865
47 A 0.998** 153.865
48 R 0.998** 153.865
49 C 0.998** 153.865
50 E 0.998** 153.865
51 S 0.998** 153.865
52 G 0.998** 153.865
53 G 0.998** 153.865
54 N 0.998** 153.865
55 W 0.998** 153.865
56 S 0.998** 153.865
57 I 0.998** 153.865
58 N 0.998** 153.865
59 T 0.998** 153.865
60 G 0.998** 153.865
61 N 0.998** 153.865
62 G 0.998** 153.865
63 Y 0.998** 153.865
64 L 0.998** 153.865
65 G 0.998** 153.865
66 G 0.998** 153.865
67 L 0.998** 153.865
68 Q 0.998** 153.865
69 F 0.998** 153.865
70 S 0.998** 153.865
71 Q 0.998** 153.865
72 G 0.998** 153.865
73 T 0.998** 153.865
74 W 0.998** 153.865
75 A 0.998** 153.865
76 S 0.998** 153.865
77 H 0.998** 153.865
78 G 0.998** 153.865
79 G 0.998** 153.865
80 G 0.998** 153.865
81 E 0.998** 153.865
82 Y 0.998** 153.865
83 A 0.998** 153.865
84 P 0.998** 153.865
85 S 0.998** 153.865
86 A 0.998** 153.865
87 Q 0.998** 153.865
88 L 0.998** 153.865
89 A 0.998** 153.865
90 T 0.998** 153.865
91 R 0.998** 153.865
92 E 0.998** 153.865
93 Q 0.998** 153.865
94 Q 0.998** 153.865
95 I 0.998** 153.865
96 A 0.998** 153.865
97 V 0.998** 153.865
98 A 0.998** 153.865
99 E 0.998** 153.865
100 R 0.998** 153.865
101 V 0.998** 153.865
102 L 0.998** 153.865
103 A 0.998** 153.865
104 T 0.998** 153.865
105 Q 0.998** 153.865
106 G 0.998** 153.865
107 S 0.998** 153.865
108 G 0.998** 153.865
109 A 0.998** 153.865
110 W 0.998** 153.865
111 P 0.998** 153.865
112 A 0.998** 153.865
113 C 0.998** 153.865
114 G 0.998** 153.865
115 H 0.998** 153.865
116 G 0.998** 153.865
117 L 0.998** 153.865
118 S 0.998** 153.865
119 G 0.998** 153.865
120 P 0.998** 153.865
121 S 0.998** 153.865
122 L 0.998** 153.865
123 Q 0.998** 153.865
124 E 0.998** 153.865
125 V 0.998** 153.865
126 L 0.998** 153.865
127 P 0.998** 153.865
128 A 0.998** 153.865
129 G 0.998** 153.865
130 M 0.998** 153.865
131 G 0.998** 153.865
132 A 0.998** 153.865
133 P 0.998** 153.865
134 W 0.998** 153.865
135 I 0.998** 153.865
136 N 0.998** 153.865
137 G 0.998** 153.865
138 A 0.998** 153.865
139 P 0.998** 153.865
140 A 0.998** 153.865
141 P 0.998** 153.865
142 L 0.998** 153.865
143 A 0.998** 153.865
144 P 0.998** 153.865
145 P 0.998** 153.865
146 P 0.998** 153.865
147 P 0.998** 153.865
148 A 0.998** 153.865
149 E 0.998** 153.865
150 P 0.998** 153.865
151 A 0.998** 153.865
152 P 0.998** 153.865
153 P 0.998** 153.865
154 Q 0.998** 153.865
155 P 0.998** 153.865
156 P 0.998** 153.865
157 A 0.998** 153.865
158 D 0.998** 153.865
159 N 0.998** 153.865
160 F 0.998** 153.865
161 P 0.998** 153.865
162 P 0.998** 153.865
163 T 0.998** 153.865
164 P 0.998** 153.865
165 G 0.998** 153.865
166 D 0.998** 153.865
167 V 0.998** 153.865
168 P 0.998** 153.865
169 S 0.998** 153.865
170 P 0.998** 153.865
171 L 0.998** 153.865
172 A 0.998** 153.865
173 R 0.998** 153.865
174 P 0.998** 153.865
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908737_1_2291_MLBR_RS10855)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -692.257109 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.347663 0.482926 0.317961 72.702759 184.812284 228.672710
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908737_1_2291_MLBR_RS10855: 0.000004, NC_002677_1_NP_302417_1_1289_ML2151: 0.000004, NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375: 0.000004, NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835: 0.000004, NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760: 0.000004, NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.34766
MLEs of dN/dS (w) for site classes (K=3)
p: 0.48293 0.31796 0.19911
w: 72.70276 184.81228 228.67271
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.4 179.6 139.4048 0.0000 0.0000 0.0 0.0
7..2 0.000 342.4 179.6 139.4048 0.0000 0.0000 0.0 0.0
7..3 0.000 342.4 179.6 139.4048 0.0000 0.0000 0.0 0.0
7..4 0.000 342.4 179.6 139.4048 0.0000 0.0000 0.0 0.0
7..5 0.000 342.4 179.6 139.4048 0.0000 0.0000 0.0 0.0
7..6 0.000 342.4 179.6 139.4048 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908737_1_2291_MLBR_RS10855)
Pr(w>1) post mean +- SE for w
1 M 1.000** 139.404
2 S 1.000** 139.404
3 E 1.000** 139.404
4 S 1.000** 139.404
5 Y 1.000** 139.404
6 R 1.000** 139.404
7 K 1.000** 139.404
8 L 1.000** 139.404
9 T 1.000** 139.404
10 T 1.000** 139.404
11 S 1.000** 139.404
12 S 1.000** 139.404
13 I 1.000** 139.404
14 I 1.000** 139.404
15 V 1.000** 139.403
16 A 1.000** 139.404
17 K 1.000** 139.404
18 I 1.000** 139.404
19 T 1.000** 139.403
20 F 1.000** 139.404
21 T 1.000** 139.403
22 G 1.000** 139.404
23 A 1.000** 139.404
24 M 1.000** 139.404
25 L 1.000** 139.404
26 D 1.000** 139.404
27 G 1.000** 139.404
28 S 1.000** 139.404
29 I 1.000** 139.404
30 A 1.000** 139.404
31 L 1.000** 139.404
32 A 1.000** 139.404
33 G 1.000** 139.404
34 Q 1.000** 139.404
35 A 1.000** 139.404
36 S 1.000** 139.404
37 P 1.000** 139.404
38 A 1.000** 139.404
39 T 1.000** 139.403
40 D 1.000** 139.404
41 S 1.000** 139.404
42 E 1.000** 139.404
43 W 1.000** 139.404
44 D 1.000** 139.404
45 Q 1.000** 139.404
46 V 1.000** 139.404
47 A 1.000** 139.404
48 R 1.000** 139.404
49 C 1.000** 139.404
50 E 1.000** 139.404
51 S 1.000** 139.404
52 G 1.000** 139.404
53 G 1.000** 139.404
54 N 1.000** 139.404
55 W 1.000** 139.404
56 S 1.000** 139.404
57 I 1.000** 139.404
58 N 1.000** 139.404
59 T 1.000** 139.403
60 G 1.000** 139.404
61 N 1.000** 139.404
62 G 1.000** 139.404
63 Y 1.000** 139.404
64 L 1.000** 139.404
65 G 1.000** 139.404
66 G 1.000** 139.404
67 L 1.000** 139.404
68 Q 1.000** 139.405
69 F 1.000** 139.404
70 S 1.000** 139.404
71 Q 1.000** 139.405
72 G 1.000** 139.404
73 T 1.000** 139.403
74 W 1.000** 139.404
75 A 1.000** 139.404
76 S 1.000** 139.404
77 H 1.000** 139.404
78 G 1.000** 139.404
79 G 1.000** 139.404
80 G 1.000** 139.404
81 E 1.000** 139.404
82 Y 1.000** 139.404
83 A 1.000** 139.404
84 P 1.000** 139.404
85 S 1.000** 139.404
86 A 1.000** 139.404
87 Q 1.000** 139.405
88 L 1.000** 139.404
89 A 1.000** 139.404
90 T 1.000** 139.403
91 R 1.000** 139.404
92 E 1.000** 139.404
93 Q 1.000** 139.404
94 Q 1.000** 139.405
95 I 1.000** 139.404
96 A 1.000** 139.404
97 V 1.000** 139.403
98 A 1.000** 139.404
99 E 1.000** 139.404
100 R 1.000** 139.404
101 V 1.000** 139.404
102 L 1.000** 139.404
103 A 1.000** 139.404
104 T 1.000** 139.403
105 Q 1.000** 139.404
106 G 1.000** 139.404
107 S 1.000** 139.404
108 G 1.000** 139.404
109 A 1.000** 139.404
110 W 1.000** 139.404
111 P 1.000** 139.404
112 A 1.000** 139.404
113 C 1.000** 139.404
114 G 1.000** 139.404
115 H 1.000** 139.404
116 G 1.000** 139.404
117 L 1.000** 139.405
118 S 1.000** 139.404
119 G 1.000** 139.404
120 P 1.000** 139.404
121 S 1.000** 139.404
122 L 1.000** 139.404
123 Q 1.000** 139.404
124 E 1.000** 139.404
125 V 1.000** 139.404
126 L 1.000** 139.404
127 P 1.000** 139.404
128 A 1.000** 139.404
129 G 1.000** 139.404
130 M 1.000** 139.404
131 G 1.000** 139.404
132 A 1.000** 139.404
133 P 1.000** 139.404
134 W 1.000** 139.404
135 I 1.000** 139.404
136 N 1.000** 139.404
137 G 1.000** 139.404
138 A 1.000** 139.404
139 P 1.000** 139.404
140 A 1.000** 139.404
141 P 1.000** 139.404
142 L 1.000** 139.404
143 A 1.000** 139.404
144 P 1.000** 139.404
145 P 1.000** 139.404
146 P 1.000** 139.404
147 P 1.000** 139.404
148 A 1.000** 139.404
149 E 1.000** 139.404
150 P 1.000** 139.404
151 A 1.000** 139.404
152 P 1.000** 139.404
153 P 1.000** 139.404
154 Q 1.000** 139.404
155 P 1.000** 139.404
156 P 1.000** 139.404
157 A 1.000** 139.404
158 D 1.000** 139.404
159 N 1.000** 139.404
160 F 1.000** 139.404
161 P 1.000** 139.404
162 P 1.000** 139.404
163 T 1.000** 139.404
164 P 1.000** 139.404
165 G 1.000** 139.404
166 D 1.000** 139.404
167 V 1.000** 139.404
168 P 1.000** 139.404
169 S 1.000** 139.404
170 P 1.000** 139.404
171 L 1.000** 139.404
172 A 1.000** 139.404
173 R 1.000** 139.405
174 P 1.000** 139.404
Note: more than one w>1. Check rst for details
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -692.257206 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.347663 1.131454 1.831541
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908737_1_2291_MLBR_RS10855: 0.000004, NC_002677_1_NP_302417_1_1289_ML2151: 0.000004, NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375: 0.000004, NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835: 0.000004, NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760: 0.000004, NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.34766
Parameters in M7 (beta):
p = 1.13145 q = 1.83154
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.04015 0.10903 0.17619 0.24448 0.31548 0.39077 0.47241 0.56387 0.67234 0.82167
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.4 179.6 0.3806 0.0000 0.0000 0.0 0.0
7..2 0.000 342.4 179.6 0.3806 0.0000 0.0000 0.0 0.0
7..3 0.000 342.4 179.6 0.3806 0.0000 0.0000 0.0 0.0
7..4 0.000 342.4 179.6 0.3806 0.0000 0.0000 0.0 0.0
7..5 0.000 342.4 179.6 0.3806 0.0000 0.0000 0.0 0.0
7..6 0.000 342.4 179.6 0.3806 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -692.257109 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.377295 0.000010 0.005323 2.683655 145.531145
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908737_1_2291_MLBR_RS10855: 0.000004, NC_002677_1_NP_302417_1_1289_ML2151: 0.000004, NZ_LVXE01000011_1_WP_010908737_1_364_A3216_RS05375: 0.000004, NZ_LYPH01000017_1_WP_010908737_1_602_A8144_RS02835: 0.000004, NZ_CP029543_1_WP_010908737_1_2312_DIJ64_RS11760: 0.000004, NZ_AP014567_1_WP_010908737_1_2377_JK2ML_RS12085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.37730
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00532 q = 2.68366
(p1 = 0.99999) w = 145.53115
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 145.53115
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.4 179.6 145.5297 0.0000 0.0000 0.0 0.0
7..2 0.000 342.4 179.6 145.5297 0.0000 0.0000 0.0 0.0
7..3 0.000 342.4 179.6 145.5297 0.0000 0.0000 0.0 0.0
7..4 0.000 342.4 179.6 145.5297 0.0000 0.0000 0.0 0.0
7..5 0.000 342.4 179.6 145.5297 0.0000 0.0000 0.0 0.0
7..6 0.000 342.4 179.6 145.5297 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908737_1_2291_MLBR_RS10855)
Pr(w>1) post mean +- SE for w
1 M 1.000** 145.530
2 S 1.000** 145.530
3 E 1.000** 145.530
4 S 1.000** 145.530
5 Y 1.000** 145.530
6 R 1.000** 145.530
7 K 1.000** 145.530
8 L 1.000** 145.530
9 T 1.000** 145.530
10 T 1.000** 145.530
11 S 1.000** 145.530
12 S 1.000** 145.530
13 I 1.000** 145.530
14 I 1.000** 145.530
15 V 1.000** 145.530
16 A 1.000** 145.530
17 K 1.000** 145.530
18 I 1.000** 145.530
19 T 1.000** 145.530
20 F 1.000** 145.530
21 T 1.000** 145.530
22 G 1.000** 145.530
23 A 1.000** 145.530
24 M 1.000** 145.530
25 L 1.000** 145.530
26 D 1.000** 145.530
27 G 1.000** 145.530
28 S 1.000** 145.530
29 I 1.000** 145.530
30 A 1.000** 145.530
31 L 1.000** 145.530
32 A 1.000** 145.530
33 G 1.000** 145.530
34 Q 1.000** 145.530
35 A 1.000** 145.530
36 S 1.000** 145.530
37 P 1.000** 145.530
38 A 1.000** 145.530
39 T 1.000** 145.530
40 D 1.000** 145.530
41 S 1.000** 145.530
42 E 1.000** 145.530
43 W 1.000** 145.530
44 D 1.000** 145.530
45 Q 1.000** 145.530
46 V 1.000** 145.530
47 A 1.000** 145.530
48 R 1.000** 145.530
49 C 1.000** 145.530
50 E 1.000** 145.530
51 S 1.000** 145.530
52 G 1.000** 145.530
53 G 1.000** 145.530
54 N 1.000** 145.530
55 W 1.000** 145.530
56 S 1.000** 145.530
57 I 1.000** 145.530
58 N 1.000** 145.530
59 T 1.000** 145.530
60 G 1.000** 145.530
61 N 1.000** 145.530
62 G 1.000** 145.530
63 Y 1.000** 145.530
64 L 1.000** 145.530
65 G 1.000** 145.530
66 G 1.000** 145.530
67 L 1.000** 145.530
68 Q 1.000** 145.530
69 F 1.000** 145.530
70 S 1.000** 145.530
71 Q 1.000** 145.530
72 G 1.000** 145.530
73 T 1.000** 145.530
74 W 1.000** 145.530
75 A 1.000** 145.530
76 S 1.000** 145.530
77 H 1.000** 145.530
78 G 1.000** 145.530
79 G 1.000** 145.530
80 G 1.000** 145.530
81 E 1.000** 145.530
82 Y 1.000** 145.530
83 A 1.000** 145.530
84 P 1.000** 145.530
85 S 1.000** 145.530
86 A 1.000** 145.530
87 Q 1.000** 145.530
88 L 1.000** 145.530
89 A 1.000** 145.530
90 T 1.000** 145.530
91 R 1.000** 145.530
92 E 1.000** 145.530
93 Q 1.000** 145.530
94 Q 1.000** 145.530
95 I 1.000** 145.530
96 A 1.000** 145.530
97 V 1.000** 145.530
98 A 1.000** 145.530
99 E 1.000** 145.530
100 R 1.000** 145.530
101 V 1.000** 145.530
102 L 1.000** 145.530
103 A 1.000** 145.530
104 T 1.000** 145.530
105 Q 1.000** 145.530
106 G 1.000** 145.530
107 S 1.000** 145.530
108 G 1.000** 145.530
109 A 1.000** 145.530
110 W 1.000** 145.530
111 P 1.000** 145.530
112 A 1.000** 145.530
113 C 1.000** 145.530
114 G 1.000** 145.530
115 H 1.000** 145.530
116 G 1.000** 145.530
117 L 1.000** 145.530
118 S 1.000** 145.530
119 G 1.000** 145.530
120 P 1.000** 145.530
121 S 1.000** 145.530
122 L 1.000** 145.530
123 Q 1.000** 145.530
124 E 1.000** 145.530
125 V 1.000** 145.530
126 L 1.000** 145.530
127 P 1.000** 145.530
128 A 1.000** 145.530
129 G 1.000** 145.530
130 M 1.000** 145.530
131 G 1.000** 145.530
132 A 1.000** 145.530
133 P 1.000** 145.530
134 W 1.000** 145.530
135 I 1.000** 145.530
136 N 1.000** 145.530
137 G 1.000** 145.530
138 A 1.000** 145.530
139 P 1.000** 145.530
140 A 1.000** 145.530
141 P 1.000** 145.530
142 L 1.000** 145.530
143 A 1.000** 145.530
144 P 1.000** 145.530
145 P 1.000** 145.530
146 P 1.000** 145.530
147 P 1.000** 145.530
148 A 1.000** 145.530
149 E 1.000** 145.530
150 P 1.000** 145.530
151 A 1.000** 145.530
152 P 1.000** 145.530
153 P 1.000** 145.530
154 Q 1.000** 145.530
155 P 1.000** 145.530
156 P 1.000** 145.530
157 A 1.000** 145.530
158 D 1.000** 145.530
159 N 1.000** 145.530
160 F 1.000** 145.530
161 P 1.000** 145.530
162 P 1.000** 145.530
163 T 1.000** 145.530
164 P 1.000** 145.530
165 G 1.000** 145.530
166 D 1.000** 145.530
167 V 1.000** 145.530
168 P 1.000** 145.530
169 S 1.000** 145.530
170 P 1.000** 145.530
171 L 1.000** 145.530
172 A 1.000** 145.530
173 R 1.000** 145.530
174 P 1.000** 145.530
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908737_1_2291_MLBR_RS10855)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:16
Model 1: NearlyNeutral -692.257167 Model 2: PositiveSelection -692.257109 Model 0: one-ratio -692.257109 Model 3: discrete -692.257109 Model 7: beta -692.257206 Model 8: beta&w>1 -692.257109 Model 0 vs 1 1.1599999993450183E-4 Model 2 vs 1 1.1599999993450183E-4 Model 8 vs 7 1.9399999996494444E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
