--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Nov 25 15:36:12 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/1/140up-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2398.61 -2409.66 2 -2398.87 -2411.80 -------------------------------------- TOTAL -2398.73 -2411.22 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.820105 0.008222 0.651108 1.000156 0.812905 1067.72 1096.52 1.000 r(A<->C){all} 0.079087 0.000409 0.041854 0.120711 0.077942 920.17 989.87 1.000 r(A<->G){all} 0.196543 0.001057 0.134646 0.260142 0.195006 957.57 978.50 1.000 r(A<->T){all} 0.110014 0.000917 0.054042 0.169338 0.107765 988.70 1009.44 1.000 r(C<->G){all} 0.062425 0.000265 0.032195 0.095200 0.061588 1043.50 1109.52 1.000 r(C<->T){all} 0.494200 0.002429 0.399754 0.591764 0.493357 736.15 768.44 1.001 r(G<->T){all} 0.057731 0.000344 0.024252 0.094673 0.056321 1072.94 1103.32 1.000 pi(A){all} 0.259035 0.000210 0.230489 0.287533 0.258521 1089.84 1133.28 1.000 pi(C){all} 0.263281 0.000201 0.235066 0.289907 0.263120 1126.05 1163.10 1.000 pi(G){all} 0.269155 0.000207 0.240979 0.297106 0.268850 1156.56 1163.62 1.000 pi(T){all} 0.208530 0.000184 0.182554 0.234673 0.208347 1021.33 1107.82 1.000 alpha{1,2} 0.081995 0.001152 0.000923 0.129880 0.087793 1057.72 1164.39 1.001 alpha{3} 3.078765 0.938903 1.353621 4.886878 2.957174 1259.75 1380.38 1.000 pinvar{all} 0.201510 0.005327 0.064091 0.350348 0.203520 1282.21 1297.91 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2265.340105 Model 2: PositiveSelection -2265.340105 Model 0: one-ratio -2296.71442 Model 3: discrete -2263.30653 Model 7: beta -2263.441582 Model 8: beta&w>1 -2263.4416 Model 0 vs 1 62.74862999999914 Model 2 vs 1 0.0 Model 8 vs 7 3.600000036385609E-5
>C1 MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK TSEHVSLDTIK >C2 MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK TSEQVSLDTIK >C3 MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK TSEQVSLDTIK >C4 MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK TAEQVSLDSIK >C5 MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK VPEEVSLDSVK >C6 MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK KSSEVSLDSVK >C7 MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK VPEQVSLDSVK CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=261 C1 MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER C2 MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER C3 MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER C4 MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER C5 MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER C6 MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER C7 MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER *.*: ************ :: ..*:* ***.******* * *****:** C1 LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN C2 LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN C3 LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN C4 LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN C5 LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN C6 LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN C7 LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN **:**:*************:*********:************.******* C1 NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS C2 NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS C3 NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS C4 NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS C5 NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS C6 NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS C7 NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS *:****************:***********************:*****:* C1 VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL C2 VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL C3 VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL C4 VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL C5 VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL C6 VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL C7 VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL ****************:******:.*******************.***** C1 LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK C2 LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK C3 LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK C4 LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK C5 LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK C6 LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK C7 LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK *************************:*** ********: * ***.**** C1 TSEHVSLDTIK C2 TSEQVSLDTIK C3 TSEQVSLDTIK C4 TAEQVSLDSIK C5 VPEEVSLDSVK C6 KSSEVSLDSVK C7 VPEQVSLDSVK ...****::* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 261 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10962] Library Relaxation: Multi_proc [72] Relaxation Summary: [10962]--->[10962] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.398 Mb, Max= 30.781 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK TSEHVSLDTIK >C2 MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK TSEQVSLDTIK >C3 MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK TSEQVSLDTIK >C4 MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK TAEQVSLDSIK >C5 MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK VPEEVSLDSVK >C6 MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK KSSEVSLDSVK >C7 MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK VPEQVSLDSVK FORMAT of file /tmp/tmp3017220430560137762aln Not Supported[FATAL:T-COFFEE] >C1 MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK TSEHVSLDTIK >C2 MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK TSEQVSLDTIK >C3 MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK TSEQVSLDTIK >C4 MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK TAEQVSLDSIK >C5 MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK VPEEVSLDSVK >C6 MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK KSSEVSLDSVK >C7 MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK VPEQVSLDSVK input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:261 S:100 BS:261 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # PW_SEQ_DISTANCES BOT 0 1 96.55 C1 C2 96.55 TOP 1 0 96.55 C2 C1 96.55 BOT 0 2 96.17 C1 C3 96.17 TOP 2 0 96.17 C3 C1 96.17 BOT 0 3 92.34 C1 C4 92.34 TOP 3 0 92.34 C4 C1 92.34 BOT 0 4 92.34 C1 C5 92.34 TOP 4 0 92.34 C5 C1 92.34 BOT 0 5 92.72 C1 C6 92.72 TOP 5 0 92.72 C6 C1 92.72 BOT 0 6 91.57 C1 C7 91.57 TOP 6 0 91.57 C7 C1 91.57 BOT 1 2 99.62 C2 C3 99.62 TOP 2 1 99.62 C3 C2 99.62 BOT 1 3 90.80 C2 C4 90.80 TOP 3 1 90.80 C4 C2 90.80 BOT 1 4 90.80 C2 C5 90.80 TOP 4 1 90.80 C5 C2 90.80 BOT 1 5 91.19 C2 C6 91.19 TOP 5 1 91.19 C6 C2 91.19 BOT 1 6 91.19 C2 C7 91.19 TOP 6 1 91.19 C7 C2 91.19 BOT 2 3 90.42 C3 C4 90.42 TOP 3 2 90.42 C4 C3 90.42 BOT 2 4 90.42 C3 C5 90.42 TOP 4 2 90.42 C5 C3 90.42 BOT 2 5 90.80 C3 C6 90.80 TOP 5 2 90.80 C6 C3 90.80 BOT 2 6 90.80 C3 C7 90.80 TOP 6 2 90.80 C7 C3 90.80 BOT 3 4 90.80 C4 C5 90.80 TOP 4 3 90.80 C5 C4 90.80 BOT 3 5 90.42 C4 C6 90.42 TOP 5 3 90.42 C6 C4 90.42 BOT 3 6 91.57 C4 C7 91.57 TOP 6 3 91.57 C7 C4 91.57 BOT 4 5 94.25 C5 C6 94.25 TOP 5 4 94.25 C6 C5 94.25 BOT 4 6 94.25 C5 C7 94.25 TOP 6 4 94.25 C7 C5 94.25 BOT 5 6 93.49 C6 C7 93.49 TOP 6 5 93.49 C7 C6 93.49 AVG 0 C1 * 93.61 AVG 1 C2 * 93.36 AVG 2 C3 * 93.04 AVG 3 C4 * 91.06 AVG 4 C5 * 92.15 AVG 5 C6 * 92.15 AVG 6 C7 * 92.15 TOT TOT * 92.50 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAATTTTCTGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC C2 ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC C3 ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC C4 ATGAATTTTCTGTGGAAAGGCCGTCGGTTTCTGATCGCAGGTATCCTGCC C5 ATGAGTTTCTTGTGGAAAGGACGCCGGTTTCTGATCGCCGGGATCCTGCC C6 ATGAGTTTCTTGTGGAAAGGACGACGGTTTTTGATTGCCGGCATTCTGCC C7 ATGAGTTTTTTGTTGAAAGGACGCCGGTTTTTGATCGCCGGCATCCTGCC ****.*** *** ******.** ****** **** **.** ** ***** C1 AACATTCGAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAACAAAACAT C2 AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT C3 AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT C4 AACATTTGACGGCAGCTCAGACGACATAATCGACAAGGAAAGCAAAACTT C5 GATCATGGAAAACGGCGCCGACGACATAAAGGACAAGGAAAACAAGACCT C6 AGTCCTAGAACGCGGCGCAGATGACATAGTGGATAAGGAAAACAAGACCT C7 AGCTTTTGAACGCGGCCCAGACGACATAGTGGATAAGGAAAACAAGACTT .. * *. .*. * *.** **.***.: ** *******. **.** * C1 ACAAGGCCTTTCTGGCCAGTAAACCACCAGAGGAAACAGGACTGGAGCGC C2 ACAAGGCATTTCTGGACAGTAAACTACCAGAAGAAACGGGACTGGAGCGC C3 ACAAGGCCTTTCTGGACCGTAAACTACCAGAGGAAACGGGACTGGAGCGC C4 ACAAGGCCTTCCTGGCCAGTAAACCACCAGAGGAAACGGGACTGGAGCGC C5 ACAAGGCTTTCCTGGCCAGTAAACCGCCGGAGGAAACGGGTCTGGAGCGC C6 ACAAGGCATTCCTAGCCAGTAAACCACCAGAGGAAACAGGAATGGAGCGC C7 ATAAGGCATTCCTGGCCAGTAAACCGCCAGAGGAAACGGGACTGGAGCGC * ***** ** **.*.*.****** .**.**.*****.**:.******** C1 CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCCTCCGAGCT C2 CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT C3 CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT C4 CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCGTCCGAACT C5 CTCAAACAAATGTTTTCCATCGACGAGTTTGGAAGCATATCCTCCGAGTT C6 CTTAAACATATGTTTACAATCGACGAGTTCGGTAGTATATCCTCTGAACT C7 CTCAAACAAATGTTTTCAATTGACGAGTTTGGTAGTATATCTTCCGAGCT ** **.**:******:*.** ******** ** ** ***** ** **. * C1 TAACTCGGTTTACCAGGCCGGCTTCCTAGGATTCCTTATTGGAGCTATTT C2 TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT C3 TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT C4 TAACTCTGTTTACCAGGCTGGCTTCCTGGGATTCCTCGTTGGAGCAATTT C5 GAACTCCATTTACCAGGCCGGCTTCCTGGGCTTCCTCATTGGAGCCATTT C6 GAATTCAATTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCGATTT C7 GAATTCAATTTACCAGGCCGGTTTCCTGGGATTCCTCATTGGAGCGATTT ** ** .**** ***** ** *****.**.***** .******* **** C1 ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC C2 ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC C3 ACGGCGGAGTTACACAATCGCGCGTGGCTTATATGAATTTCATGGAGAAC C4 ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC C5 ATGGAGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC C6 ACGGTGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC C7 ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC * ** ********************** ** ****************** C1 AACCAGGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA C2 AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA C3 AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA C4 AACGAAGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA C5 AACCAGGCGACAGCCTTCAAATCTCACTTTGATGCCAAGAAAAAGCTGCA C6 AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTTCA C7 AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTACA *** *.** ***** ** ***** *********************** ** C1 AGATCAATTCACAGTCAACTTTGCCAAAGGCGGCTTCAAATGGGGCTGGC C2 AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC C3 AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC C4 AGATCAATTCACAGTCAACTTCGCCAAAGGCGGTTTCAAATGGGGCTGGC C5 GGATGAGTTCACAGTCAACTTTGCCAAGGGTGGTTTCAAATGGGGCTGGC C6 GGACCAATTTACTGTTAACTTTGCCAAAGGCGGCTTTAAATGGGGTTGGC C7 GGACCAATTTACGGTCAACTTTGCCAAGGGCGGCTTCAAATGGGGCTGGC .** *.** ** ** ***** *****.** ** ** ******** **** C1 GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACTTGTATGTCG C2 GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG C3 GAGTAGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG C4 GAGTGGGACTTTTTACCACATCCTACCTCGGCATCATCACCTGCATTTCG C5 GCGTGGGCCTCTTTACCACCTCCTACTTTGGGATCATCACCTGCATGTCG C6 GAGTGGGACTTTTCACCACTTCCTACTTTGGCATCATTACGTGCATGTCG C7 GAGTGGGACTTTTTACAACTTCCTACTTCGGCATCATCACCTGCATATCT *.**.**.** ** **.** ****** * ** ***** ** ** ** ** C1 GTGTACCGTGGAAAATCCTCAATCTACGAATACTTGGCCGCTGGTTCCAT C2 GTGTACCGTGGAAAATCCTCAATATACGAATACTTGGCCGCTGGCTCCGT C3 GTGTACCGTGGAAAATCCTCAATTTACGAATACTTGGCCGCTGGTTCCGT C4 GTGTACCGTGGAAAGTCCTCAATTTATGAGTACTTGGCCGCTGGTTCCAT C5 GTGTACCGTGGCAAATCCTCGATCTACGAGTACCTGGCCGCCGGTTCCAT C6 GTGTACCGTGGAAAATCATCTATCTACGAGTACTTGGCCGCTGGATCCGT C7 GTGTATCGTGGAAAATCGTCGATCTACGAGTACTTGGCCGCAGGTTCCGT ***** *****.**.** ** ** ** **.*** ******* ** ***.* C1 CACCGGCTCGCTTTACAAAGTGAGTCTTGGTCTGCGGGGCATGGCGGCAG C2 CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG C3 CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG C4 CACCGGCTCACTTTACAAAATGAATCTTGGTCTGCGGGGCATGGCGGCAG C5 CACCGGCTCGCTCTACAAGATGAATTTGGGACTGCGCGGCATGGCGGCAG C6 CACCGGCTCCCTTTACAAAGTAAATCTGGGACTACGGGGTATGGCAGCAG C7 CACCGGCTCCCTTTACAAAATGAATCTGGGACTGCGAGGCATGGCGGCAG ********* ** *****..*.*.* * **:**.** ** *****.**** C1 GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG C2 GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG C3 GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGTTG C4 GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGGTGGTGTAACGTCCCTG C5 GTGGAATCATTGGAGGCTTCCTGGGCGGAGTGGCTGGCGTGACCTCGCTG C6 GCGGGATCATTGGTGGCTTCTTGGGCGGAGTCGCTGGAGTCACCTCCCTG C7 GCGGGATCATTGGCGGCTTCTTGGGCGGAGTGGCTGGAGTCACCTCCCTG * **.******** ** *** *******.** * *** ** ** ** ** C1 CTGCTGATGAAAGCATCAGGGACCTCGATGGAAGAGGTTCGCTACTGGCA C2 CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA C3 CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA C4 CTGCTGATGAAGGCATCCGGGACTTCGATGGAGGAGGTTCGCTACTGGCA C5 CTGCTGATGAAGGCTTCCGGCACCTCGATGGAGGAGGTGCGCTACTGGCA C6 CTGCTGATGAAGGCATCCGGCACTTCGATGGAGGAAGTGCGCTACTGGCA C7 CTACTGATGAAGGCATCCGGCACTTCGATGGAGGAGGTGCGCTATTGGCA **.********.**:**.** ** ********.**.** ***** ***** C1 GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA C2 GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA C3 GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA C4 GTACAAATGGCGACTCGATCGCGACGAGAACATTCAACTGGCGTTCAAAA C5 GTACAAGTGGCGACTCGACCGCGACGAAAACATCCAGCTGGCCTTCAAAA C6 GTACAAGTGGCGACTGGATCGCGACGAAAACATTCAGCTGGCGTTCAAAA C7 GTACAAGTGGCGGCTCGATCGCGATGATAACATCCAGCAGGCCTTCAAAA ******.*****.** ** ***** ** ***** **.*:*** ******* C1 AACTGACAGAGGACGAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA C2 AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA C3 AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA C4 AACTGACAGAGGATGAAACCCCAGAACTTTTCAAGGTCCACGACGAAAAA C5 AGCTGACGGAAGACGAAAACCCAGCGCTCTTCAAGGCGCACGACGAAAAA C6 AACTGACGGAGGATGAAACCCCTGAGTTGTTTAAGGCCCATGATGAAAAG C7 AACTGACAGAGGATGAACAACCGGAGCTGTTCAAGGTCCATGACGAAAAG *.*****.**.** **...** *.. * ** **** ** ** **.**. C1 ACATCCGAACATGTATCGCTGGACACGATCAAG C2 ACATCCGAACAGGTATCGCTGGACACGATCAAG C3 ACATCCGAACAGGTATCGCTGGACACGATCAAG C4 ACAGCCGAACAGGTATCGCTGGACTCGATCAAG C5 GTACCCGAAGAGGTGTCCCTGGACTCGGTCAAG C6 AAATCCTCTGAGGTATCCCTCGACTCGGTCAAG C7 GTACCCGAACAGGTATCCCTGGACTCGGTCAAG . * ** .: * **.** ** ***:**.***** >C1 ATGAATTTTCTGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC AACATTCGAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAACAAAACAT ACAAGGCCTTTCTGGCCAGTAAACCACCAGAGGAAACAGGACTGGAGCGC CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCCTCCGAGCT TAACTCGGTTTACCAGGCCGGCTTCCTAGGATTCCTTATTGGAGCTATTT ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC AACCAGGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA AGATCAATTCACAGTCAACTTTGCCAAAGGCGGCTTCAAATGGGGCTGGC GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACTTGTATGTCG GTGTACCGTGGAAAATCCTCAATCTACGAATACTTGGCCGCTGGTTCCAT CACCGGCTCGCTTTACAAAGTGAGTCTTGGTCTGCGGGGCATGGCGGCAG GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG CTGCTGATGAAAGCATCAGGGACCTCGATGGAAGAGGTTCGCTACTGGCA GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA AACTGACAGAGGACGAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA ACATCCGAACATGTATCGCTGGACACGATCAAG >C2 ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT ACAAGGCATTTCTGGACAGTAAACTACCAGAAGAAACGGGACTGGAGCGC CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG GTGTACCGTGGAAAATCCTCAATATACGAATACTTGGCCGCTGGCTCCGT CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA ACATCCGAACAGGTATCGCTGGACACGATCAAG >C3 ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT ACAAGGCCTTTCTGGACCGTAAACTACCAGAGGAAACGGGACTGGAGCGC CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT ACGGCGGAGTTACACAATCGCGCGTGGCTTATATGAATTTCATGGAGAAC AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC GAGTAGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG GTGTACCGTGGAAAATCCTCAATTTACGAATACTTGGCCGCTGGTTCCGT CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGTTG CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA ACATCCGAACAGGTATCGCTGGACACGATCAAG >C4 ATGAATTTTCTGTGGAAAGGCCGTCGGTTTCTGATCGCAGGTATCCTGCC AACATTTGACGGCAGCTCAGACGACATAATCGACAAGGAAAGCAAAACTT ACAAGGCCTTCCTGGCCAGTAAACCACCAGAGGAAACGGGACTGGAGCGC CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCGTCCGAACT TAACTCTGTTTACCAGGCTGGCTTCCTGGGATTCCTCGTTGGAGCAATTT ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC AACGAAGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA AGATCAATTCACAGTCAACTTCGCCAAAGGCGGTTTCAAATGGGGCTGGC GAGTGGGACTTTTTACCACATCCTACCTCGGCATCATCACCTGCATTTCG GTGTACCGTGGAAAGTCCTCAATTTATGAGTACTTGGCCGCTGGTTCCAT CACCGGCTCACTTTACAAAATGAATCTTGGTCTGCGGGGCATGGCGGCAG GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGGTGGTGTAACGTCCCTG CTGCTGATGAAGGCATCCGGGACTTCGATGGAGGAGGTTCGCTACTGGCA GTACAAATGGCGACTCGATCGCGACGAGAACATTCAACTGGCGTTCAAAA AACTGACAGAGGATGAAACCCCAGAACTTTTCAAGGTCCACGACGAAAAA ACAGCCGAACAGGTATCGCTGGACTCGATCAAG >C5 ATGAGTTTCTTGTGGAAAGGACGCCGGTTTCTGATCGCCGGGATCCTGCC GATCATGGAAAACGGCGCCGACGACATAAAGGACAAGGAAAACAAGACCT ACAAGGCTTTCCTGGCCAGTAAACCGCCGGAGGAAACGGGTCTGGAGCGC CTCAAACAAATGTTTTCCATCGACGAGTTTGGAAGCATATCCTCCGAGTT GAACTCCATTTACCAGGCCGGCTTCCTGGGCTTCCTCATTGGAGCCATTT ATGGAGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC AACCAGGCGACAGCCTTCAAATCTCACTTTGATGCCAAGAAAAAGCTGCA GGATGAGTTCACAGTCAACTTTGCCAAGGGTGGTTTCAAATGGGGCTGGC GCGTGGGCCTCTTTACCACCTCCTACTTTGGGATCATCACCTGCATGTCG GTGTACCGTGGCAAATCCTCGATCTACGAGTACCTGGCCGCCGGTTCCAT CACCGGCTCGCTCTACAAGATGAATTTGGGACTGCGCGGCATGGCGGCAG GTGGAATCATTGGAGGCTTCCTGGGCGGAGTGGCTGGCGTGACCTCGCTG CTGCTGATGAAGGCTTCCGGCACCTCGATGGAGGAGGTGCGCTACTGGCA GTACAAGTGGCGACTCGACCGCGACGAAAACATCCAGCTGGCCTTCAAAA AGCTGACGGAAGACGAAAACCCAGCGCTCTTCAAGGCGCACGACGAAAAA GTACCCGAAGAGGTGTCCCTGGACTCGGTCAAG >C6 ATGAGTTTCTTGTGGAAAGGACGACGGTTTTTGATTGCCGGCATTCTGCC AGTCCTAGAACGCGGCGCAGATGACATAGTGGATAAGGAAAACAAGACCT ACAAGGCATTCCTAGCCAGTAAACCACCAGAGGAAACAGGAATGGAGCGC CTTAAACATATGTTTACAATCGACGAGTTCGGTAGTATATCCTCTGAACT GAATTCAATTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCGATTT ACGGTGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTTCA GGACCAATTTACTGTTAACTTTGCCAAAGGCGGCTTTAAATGGGGTTGGC GAGTGGGACTTTTCACCACTTCCTACTTTGGCATCATTACGTGCATGTCG GTGTACCGTGGAAAATCATCTATCTACGAGTACTTGGCCGCTGGATCCGT CACCGGCTCCCTTTACAAAGTAAATCTGGGACTACGGGGTATGGCAGCAG GCGGGATCATTGGTGGCTTCTTGGGCGGAGTCGCTGGAGTCACCTCCCTG CTGCTGATGAAGGCATCCGGCACTTCGATGGAGGAAGTGCGCTACTGGCA GTACAAGTGGCGACTGGATCGCGACGAAAACATTCAGCTGGCGTTCAAAA AACTGACGGAGGATGAAACCCCTGAGTTGTTTAAGGCCCATGATGAAAAG AAATCCTCTGAGGTATCCCTCGACTCGGTCAAG >C7 ATGAGTTTTTTGTTGAAAGGACGCCGGTTTTTGATCGCCGGCATCCTGCC AGCTTTTGAACGCGGCCCAGACGACATAGTGGATAAGGAAAACAAGACTT ATAAGGCATTCCTGGCCAGTAAACCGCCAGAGGAAACGGGACTGGAGCGC CTCAAACAAATGTTTTCAATTGACGAGTTTGGTAGTATATCTTCCGAGCT GAATTCAATTTACCAGGCCGGTTTCCTGGGATTCCTCATTGGAGCGATTT ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTACA GGACCAATTTACGGTCAACTTTGCCAAGGGCGGCTTCAAATGGGGCTGGC GAGTGGGACTTTTTACAACTTCCTACTTCGGCATCATCACCTGCATATCT GTGTATCGTGGAAAATCGTCGATCTACGAGTACTTGGCCGCAGGTTCCGT CACCGGCTCCCTTTACAAAATGAATCTGGGACTGCGAGGCATGGCGGCAG GCGGGATCATTGGCGGCTTCTTGGGCGGAGTGGCTGGAGTCACCTCCCTG CTACTGATGAAGGCATCCGGCACTTCGATGGAGGAGGTGCGCTATTGGCA GTACAAGTGGCGGCTCGATCGCGATGATAACATCCAGCAGGCCTTCAAAA AACTGACAGAGGATGAACAACCGGAGCTGTTCAAGGTCCATGACGAAAAG GTACCCGAACAGGTATCCCTGGACTCGGTCAAG >C1 MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK TSEHVSLDTIK >C2 MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK TSEQVSLDTIK >C3 MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK TSEQVSLDTIK >C4 MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK TAEQVSLDSIK >C5 MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK VPEEVSLDSVK >C6 MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK KSSEVSLDSVK >C7 MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK VPEQVSLDSVK MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 7 taxa and 783 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1480087610 Setting output file names to "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1942935382 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 7445175374 Seed = 1411937477 Swapseed = 1480087610 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 34 unique site patterns Division 2 has 21 unique site patterns Division 3 has 97 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3057.137270 -- -24.557203 Chain 2 -- -3017.143072 -- -24.557203 Chain 3 -- -3077.183432 -- -24.557203 Chain 4 -- -3043.100524 -- -24.557203 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3106.513707 -- -24.557203 Chain 2 -- -3067.588346 -- -24.557203 Chain 3 -- -3011.270554 -- -24.557203 Chain 4 -- -3087.423172 -- -24.557203 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3057.137] (-3017.143) (-3077.183) (-3043.101) * [-3106.514] (-3067.588) (-3011.271) (-3087.423) 500 -- [-2497.656] (-2501.302) (-2521.687) (-2522.326) * (-2523.408) (-2508.427) (-2518.942) [-2498.150] -- 0:33:19 1000 -- [-2473.464] (-2466.963) (-2496.718) (-2511.027) * (-2467.864) [-2475.865] (-2510.012) (-2479.840) -- 0:16:39 1500 -- [-2437.352] (-2424.769) (-2439.185) (-2467.864) * (-2451.429) [-2441.104] (-2476.704) (-2431.795) -- 0:11:05 2000 -- (-2411.857) [-2404.903] (-2417.298) (-2445.613) * [-2434.211] (-2424.379) (-2456.097) (-2441.274) -- 0:08:19 2500 -- [-2407.372] (-2412.336) (-2411.649) (-2428.464) * (-2412.344) (-2418.371) (-2438.216) [-2407.337] -- 0:06:39 3000 -- (-2415.450) (-2412.528) [-2409.746] (-2414.635) * (-2401.834) (-2409.261) (-2420.951) [-2401.683] -- 0:05:32 3500 -- (-2406.691) (-2404.278) (-2400.217) [-2404.753] * (-2398.152) (-2403.925) [-2406.352] (-2399.377) -- 0:09:29 4000 -- (-2410.538) (-2403.910) [-2396.709] (-2403.579) * (-2408.655) [-2408.019] (-2412.533) (-2405.219) -- 0:08:18 4500 -- (-2408.440) (-2403.216) (-2405.902) [-2412.268] * (-2403.539) (-2416.441) (-2406.630) [-2395.410] -- 0:07:22 5000 -- [-2408.919] (-2405.708) (-2402.771) (-2405.908) * (-2400.718) (-2413.132) [-2406.026] (-2400.791) -- 0:06:38 Average standard deviation of split frequencies: 0.125708 5500 -- (-2408.958) (-2400.816) [-2403.056] (-2400.501) * [-2403.091] (-2408.292) (-2400.187) (-2404.684) -- 0:06:01 6000 -- [-2405.249] (-2410.619) (-2404.271) (-2400.318) * (-2400.620) (-2404.927) (-2397.567) [-2402.042] -- 0:05:31 6500 -- (-2399.891) [-2401.726] (-2406.147) (-2410.857) * (-2404.796) [-2404.726] (-2407.140) (-2408.638) -- 0:07:38 7000 -- (-2396.493) (-2407.079) [-2403.604] (-2405.399) * (-2403.042) [-2406.643] (-2399.664) (-2406.921) -- 0:07:05 7500 -- (-2403.503) [-2403.968] (-2398.724) (-2407.985) * (-2403.450) (-2410.532) [-2400.058] (-2406.564) -- 0:06:37 8000 -- (-2401.222) (-2412.906) (-2402.545) [-2401.452] * [-2399.405] (-2400.200) (-2404.615) (-2402.990) -- 0:06:12 8500 -- [-2403.171] (-2408.040) (-2397.995) (-2409.741) * (-2399.335) (-2403.695) [-2400.915] (-2403.308) -- 0:05:49 9000 -- (-2402.481) (-2414.318) (-2400.907) [-2398.027] * [-2402.883] (-2409.599) (-2401.084) (-2404.211) -- 0:07:20 9500 -- [-2404.557] (-2416.882) (-2401.188) (-2399.724) * (-2412.764) (-2401.790) (-2402.875) [-2400.260] -- 0:06:57 10000 -- [-2400.179] (-2408.943) (-2404.376) (-2404.447) * (-2407.814) [-2400.001] (-2404.309) (-2406.107) -- 0:06:36 Average standard deviation of split frequencies: 0.070711 10500 -- [-2405.416] (-2410.893) (-2403.151) (-2405.869) * [-2404.928] (-2399.478) (-2408.056) (-2413.745) -- 0:06:16 11000 -- (-2403.531) (-2401.874) (-2402.252) [-2399.389] * (-2404.534) (-2401.187) [-2398.594] (-2402.221) -- 0:05:59 11500 -- [-2406.904] (-2400.911) (-2400.065) (-2402.065) * (-2407.016) [-2401.420] (-2407.541) (-2406.873) -- 0:05:43 12000 -- (-2405.910) (-2396.546) (-2405.481) [-2404.942] * (-2406.917) (-2400.391) [-2405.134] (-2397.467) -- 0:06:51 12500 -- (-2403.584) (-2406.768) [-2405.263] (-2404.318) * [-2397.011] (-2399.445) (-2409.834) (-2404.883) -- 0:06:35 13000 -- (-2402.070) (-2404.932) [-2402.501] (-2407.177) * [-2401.389] (-2405.290) (-2407.623) (-2402.766) -- 0:06:19 13500 -- [-2401.925] (-2397.574) (-2406.014) (-2407.489) * (-2406.528) [-2405.370] (-2412.994) (-2404.018) -- 0:06:05 14000 -- [-2399.506] (-2404.556) (-2398.931) (-2403.125) * (-2398.739) (-2403.402) [-2403.558] (-2408.023) -- 0:05:52 14500 -- [-2396.969] (-2403.999) (-2409.338) (-2401.816) * (-2412.018) (-2409.106) [-2406.688] (-2407.017) -- 0:05:39 15000 -- (-2405.543) (-2408.207) (-2402.285) [-2398.376] * (-2411.880) (-2399.383) (-2407.796) [-2400.735] -- 0:06:34 Average standard deviation of split frequencies: 0.035355 15500 -- (-2401.175) (-2403.832) (-2410.951) [-2397.426] * (-2408.487) [-2396.512] (-2415.664) (-2405.378) -- 0:06:21 16000 -- (-2403.572) [-2405.975] (-2404.995) (-2411.173) * [-2409.213] (-2409.817) (-2405.139) (-2403.642) -- 0:06:09 16500 -- (-2403.960) (-2404.668) [-2402.149] (-2401.800) * (-2409.851) (-2408.724) [-2399.861] (-2409.296) -- 0:05:57 17000 -- [-2400.390] (-2402.744) (-2400.147) (-2404.344) * [-2409.620] (-2403.204) (-2403.507) (-2405.275) -- 0:05:46 17500 -- (-2401.769) (-2410.579) [-2402.095] (-2405.049) * (-2409.930) (-2411.931) (-2409.405) [-2406.164] -- 0:05:36 18000 -- (-2396.658) (-2408.855) [-2403.265] (-2400.274) * (-2407.905) (-2408.354) (-2408.888) [-2406.400] -- 0:06:21 18500 -- (-2414.690) (-2408.763) [-2404.861] (-2399.402) * (-2418.547) (-2401.695) (-2400.383) [-2406.021] -- 0:06:11 19000 -- (-2401.889) (-2404.373) [-2402.062] (-2401.988) * (-2407.705) [-2399.421] (-2406.081) (-2415.933) -- 0:06:01 19500 -- (-2407.225) (-2400.091) [-2411.683] (-2403.921) * (-2406.868) [-2400.842] (-2405.588) (-2407.522) -- 0:05:51 20000 -- (-2402.633) [-2404.559] (-2403.849) (-2403.422) * [-2400.151] (-2403.185) (-2404.750) (-2401.298) -- 0:05:43 Average standard deviation of split frequencies: 0.045620 20500 -- (-2409.764) (-2415.370) [-2399.656] (-2408.850) * (-2404.276) (-2411.182) [-2407.066] (-2401.317) -- 0:05:34 21000 -- [-2394.590] (-2406.891) (-2409.154) (-2408.486) * (-2402.474) (-2413.082) (-2402.197) [-2400.594] -- 0:06:12 21500 -- [-2403.998] (-2406.277) (-2405.535) (-2411.150) * (-2397.432) (-2403.464) (-2402.065) [-2400.380] -- 0:06:04 22000 -- [-2397.083] (-2415.402) (-2404.297) (-2405.527) * (-2403.836) (-2399.338) [-2402.516] (-2401.037) -- 0:05:55 22500 -- (-2402.546) (-2414.778) [-2401.819] (-2410.808) * (-2399.773) (-2408.151) [-2400.180] (-2401.079) -- 0:05:47 23000 -- [-2405.507] (-2408.608) (-2415.676) (-2403.747) * (-2404.215) (-2402.443) (-2403.576) [-2400.867] -- 0:05:39 23500 -- (-2408.500) [-2407.639] (-2397.791) (-2407.508) * (-2406.532) (-2398.583) (-2398.268) [-2401.579] -- 0:05:32 24000 -- (-2399.863) (-2401.748) (-2405.561) [-2397.593] * (-2398.062) (-2412.269) (-2402.938) [-2401.239] -- 0:06:06 24500 -- [-2399.069] (-2400.519) (-2404.829) (-2403.666) * [-2402.894] (-2400.516) (-2408.286) (-2407.182) -- 0:05:58 25000 -- (-2405.161) (-2406.038) (-2406.456) [-2400.643] * (-2405.091) (-2408.008) [-2401.496] (-2398.602) -- 0:05:51 Average standard deviation of split frequencies: 0.029010 25500 -- [-2398.856] (-2412.060) (-2398.413) (-2405.673) * [-2402.943] (-2407.625) (-2411.722) (-2407.528) -- 0:05:43 26000 -- (-2403.115) (-2410.923) [-2402.091] (-2403.279) * (-2403.295) [-2402.810] (-2410.408) (-2406.888) -- 0:05:37 26500 -- [-2398.162] (-2417.103) (-2402.702) (-2407.557) * (-2406.974) (-2399.020) (-2406.976) [-2403.887] -- 0:06:07 27000 -- (-2400.285) (-2405.978) [-2401.810] (-2407.241) * (-2403.085) (-2402.506) [-2404.406] (-2406.376) -- 0:06:00 27500 -- [-2404.651] (-2405.270) (-2401.179) (-2401.872) * [-2405.564] (-2399.479) (-2407.283) (-2407.876) -- 0:05:53 28000 -- [-2408.133] (-2405.850) (-2405.927) (-2402.905) * (-2398.045) [-2403.913] (-2403.504) (-2402.313) -- 0:05:47 28500 -- (-2401.640) (-2403.512) [-2402.488] (-2400.676) * (-2403.330) [-2401.171] (-2406.776) (-2404.297) -- 0:05:40 29000 -- (-2408.341) (-2401.494) (-2409.370) [-2402.730] * (-2403.159) [-2399.664] (-2400.481) (-2403.178) -- 0:05:34 29500 -- (-2410.267) (-2402.163) [-2405.872] (-2408.659) * [-2402.215] (-2411.425) (-2406.977) (-2407.462) -- 0:06:01 30000 -- (-2401.835) [-2401.015] (-2404.721) (-2401.813) * (-2404.769) (-2407.727) (-2402.868) [-2404.234] -- 0:05:55 Average standard deviation of split frequencies: 0.018446 30500 -- (-2405.595) (-2404.020) (-2402.335) [-2397.854] * (-2407.429) (-2404.272) (-2400.395) [-2400.643] -- 0:05:49 31000 -- (-2409.798) [-2402.079] (-2405.568) (-2412.306) * (-2405.676) (-2406.376) (-2412.223) [-2401.279] -- 0:05:43 31500 -- (-2402.502) (-2401.581) (-2411.456) [-2408.057] * (-2403.451) (-2405.906) [-2402.611] (-2402.384) -- 0:05:38 32000 -- (-2401.262) (-2407.670) [-2407.617] (-2410.622) * (-2407.224) (-2410.142) (-2401.964) [-2405.931] -- 0:05:32 32500 -- [-2398.169] (-2408.243) (-2403.712) (-2417.381) * [-2407.562] (-2415.201) (-2406.174) (-2403.727) -- 0:05:57 33000 -- [-2403.804] (-2403.634) (-2403.001) (-2412.463) * (-2403.819) (-2409.486) [-2401.408] (-2405.511) -- 0:05:51 33500 -- (-2403.479) (-2403.524) [-2402.109] (-2407.417) * (-2409.615) (-2404.660) (-2402.415) [-2404.907] -- 0:05:46 34000 -- (-2402.305) (-2407.823) (-2401.628) [-2404.714] * [-2400.695] (-2405.188) (-2405.181) (-2405.281) -- 0:05:40 34500 -- [-2397.675] (-2407.503) (-2404.698) (-2407.109) * (-2408.956) (-2405.827) [-2399.219] (-2405.776) -- 0:05:35 35000 -- (-2403.362) (-2396.968) [-2405.014] (-2406.885) * (-2408.704) [-2407.403] (-2406.116) (-2409.542) -- 0:05:30 Average standard deviation of split frequencies: 0.015713 35500 -- (-2409.201) [-2397.623] (-2401.026) (-2409.299) * [-2401.973] (-2414.011) (-2400.704) (-2418.702) -- 0:05:53 36000 -- (-2408.871) [-2409.017] (-2415.125) (-2405.947) * (-2413.363) (-2407.630) [-2400.751] (-2414.936) -- 0:05:48 36500 -- (-2404.200) (-2406.191) (-2409.479) [-2401.722] * (-2411.991) [-2403.356] (-2396.903) (-2413.142) -- 0:05:43 37000 -- [-2400.796] (-2408.116) (-2407.346) (-2413.389) * (-2398.530) (-2412.146) [-2402.165] (-2415.718) -- 0:05:38 37500 -- (-2402.852) [-2401.998] (-2413.246) (-2410.526) * (-2404.376) (-2409.238) [-2401.185] (-2414.139) -- 0:05:33 38000 -- [-2408.623] (-2404.984) (-2413.293) (-2411.735) * (-2403.545) (-2404.450) [-2401.407] (-2404.803) -- 0:05:54 38500 -- [-2409.202] (-2408.251) (-2408.888) (-2407.944) * (-2407.016) (-2402.678) [-2401.717] (-2403.174) -- 0:05:49 39000 -- (-2411.076) [-2402.753] (-2407.948) (-2403.357) * [-2402.963] (-2404.153) (-2410.241) (-2405.376) -- 0:05:44 39500 -- (-2404.147) (-2397.680) (-2398.680) [-2408.114] * [-2400.613] (-2403.256) (-2406.391) (-2404.667) -- 0:05:40 40000 -- [-2400.934] (-2405.834) (-2402.126) (-2406.251) * [-2405.499] (-2413.362) (-2409.718) (-2399.696) -- 0:05:36 Average standard deviation of split frequencies: 0.027821 40500 -- [-2402.159] (-2409.312) (-2412.023) (-2400.132) * (-2405.113) (-2409.607) (-2402.095) [-2410.078] -- 0:05:55 41000 -- (-2407.744) [-2402.913] (-2402.945) (-2405.675) * (-2404.383) (-2403.977) (-2406.640) [-2408.846] -- 0:05:50 41500 -- (-2407.644) (-2400.165) (-2402.172) [-2405.908] * [-2405.968] (-2406.054) (-2407.246) (-2402.395) -- 0:05:46 42000 -- (-2410.981) (-2408.744) (-2410.323) [-2399.657] * (-2409.414) (-2406.802) [-2401.824] (-2409.923) -- 0:05:42 42500 -- (-2402.183) (-2406.837) [-2403.137] (-2403.741) * (-2404.288) (-2410.276) (-2405.700) [-2405.816] -- 0:05:37 43000 -- (-2405.276) (-2400.584) [-2403.955] (-2406.187) * [-2402.279] (-2402.443) (-2401.314) (-2410.655) -- 0:05:33 43500 -- (-2400.834) (-2406.426) (-2408.076) [-2401.529] * (-2404.349) (-2399.347) [-2405.591] (-2398.040) -- 0:05:51 44000 -- (-2405.829) (-2396.385) [-2405.027] (-2402.755) * (-2407.097) (-2403.003) (-2402.934) [-2402.027] -- 0:05:47 44500 -- (-2403.783) (-2397.997) [-2395.903] (-2404.563) * (-2404.306) (-2407.416) [-2403.860] (-2400.705) -- 0:05:43 45000 -- (-2410.976) [-2406.083] (-2405.833) (-2401.471) * (-2404.673) [-2403.650] (-2405.823) (-2400.071) -- 0:05:39 Average standard deviation of split frequencies: 0.024595 45500 -- (-2402.183) [-2407.897] (-2400.887) (-2404.975) * (-2406.874) [-2403.031] (-2405.569) (-2405.816) -- 0:05:35 46000 -- (-2402.544) (-2406.426) [-2407.328] (-2410.814) * (-2403.281) (-2399.661) [-2401.821] (-2404.544) -- 0:05:31 46500 -- (-2403.626) (-2403.481) [-2403.702] (-2405.146) * (-2407.415) [-2404.221] (-2400.515) (-2398.044) -- 0:05:48 47000 -- (-2403.153) [-2409.726] (-2410.372) (-2403.816) * (-2404.589) (-2402.316) [-2405.556] (-2400.947) -- 0:05:44 47500 -- [-2399.221] (-2412.369) (-2408.636) (-2402.668) * (-2397.600) (-2399.785) [-2405.366] (-2404.698) -- 0:05:40 48000 -- (-2403.310) (-2412.713) (-2402.448) [-2400.615] * (-2403.276) [-2399.059] (-2407.912) (-2409.179) -- 0:05:37 48500 -- (-2401.319) [-2402.668] (-2401.796) (-2409.817) * [-2402.863] (-2407.019) (-2408.653) (-2405.896) -- 0:05:33 49000 -- (-2399.276) (-2404.075) (-2405.223) [-2404.553] * (-2403.762) (-2407.718) (-2403.653) [-2403.000] -- 0:05:49 49500 -- (-2402.228) [-2402.052] (-2400.349) (-2397.548) * (-2397.106) (-2400.865) (-2400.478) [-2402.183] -- 0:05:45 50000 -- [-2404.114] (-2418.693) (-2412.739) (-2408.678) * (-2401.287) (-2408.876) [-2398.673] (-2400.234) -- 0:05:42 Average standard deviation of split frequencies: 0.026051 50500 -- [-2400.972] (-2403.652) (-2408.605) (-2407.595) * (-2397.492) (-2407.173) [-2404.344] (-2400.888) -- 0:05:38 51000 -- (-2397.984) [-2399.460] (-2401.329) (-2404.706) * (-2399.860) [-2399.330] (-2401.203) (-2404.590) -- 0:05:34 51500 -- (-2400.089) (-2407.021) (-2406.313) [-2410.428] * (-2402.721) [-2401.698] (-2401.017) (-2410.991) -- 0:05:31 52000 -- (-2399.366) (-2403.566) (-2403.700) [-2403.272] * [-2407.027] (-2401.743) (-2399.553) (-2404.840) -- 0:05:46 52500 -- (-2405.741) (-2404.596) (-2402.050) [-2402.990] * (-2402.361) (-2401.994) [-2403.179] (-2409.227) -- 0:05:42 53000 -- [-2400.751] (-2404.982) (-2402.420) (-2406.469) * [-2401.863] (-2399.445) (-2401.349) (-2402.550) -- 0:05:39 53500 -- (-2404.282) [-2404.671] (-2411.693) (-2408.465) * [-2405.231] (-2405.935) (-2407.949) (-2400.836) -- 0:05:36 54000 -- (-2399.320) (-2404.492) [-2409.045] (-2408.413) * (-2408.158) [-2400.818] (-2409.245) (-2407.599) -- 0:05:32 54500 -- (-2406.995) (-2398.730) (-2412.003) [-2404.147] * (-2398.769) (-2401.590) (-2412.897) [-2399.888] -- 0:05:29 55000 -- (-2404.423) (-2404.314) [-2405.183] (-2405.027) * (-2406.303) (-2403.401) [-2406.883] (-2399.139) -- 0:05:43 Average standard deviation of split frequencies: 0.033672 55500 -- (-2406.905) (-2403.691) (-2398.714) [-2399.342] * [-2400.956] (-2399.422) (-2403.952) (-2405.458) -- 0:05:40 56000 -- (-2402.710) (-2410.071) (-2402.723) [-2403.676] * (-2402.436) (-2398.952) (-2410.615) [-2403.697] -- 0:05:37 56500 -- (-2407.461) (-2401.137) (-2406.288) [-2406.733] * [-2401.049] (-2405.213) (-2409.824) (-2399.532) -- 0:05:33 57000 -- (-2408.245) (-2404.122) [-2402.205] (-2405.305) * (-2406.021) (-2405.256) [-2403.662] (-2413.643) -- 0:05:30 57500 -- (-2412.375) [-2405.444] (-2401.994) (-2406.355) * [-2406.389] (-2406.780) (-2409.870) (-2407.665) -- 0:05:27 58000 -- [-2401.552] (-2408.393) (-2401.476) (-2407.098) * (-2402.931) (-2404.216) (-2401.308) [-2399.526] -- 0:05:41 58500 -- (-2404.273) (-2405.551) [-2403.864] (-2408.423) * [-2397.560] (-2409.458) (-2407.560) (-2399.283) -- 0:05:37 59000 -- (-2403.219) (-2415.211) (-2406.799) [-2399.808] * [-2407.079] (-2399.590) (-2408.073) (-2413.476) -- 0:05:34 59500 -- (-2399.251) (-2408.142) (-2403.891) [-2404.677] * (-2414.606) (-2401.736) [-2405.370] (-2404.571) -- 0:05:31 60000 -- [-2405.421] (-2407.693) (-2405.047) (-2409.076) * (-2413.921) [-2409.931] (-2401.023) (-2399.719) -- 0:05:29 Average standard deviation of split frequencies: 0.024865 60500 -- (-2402.835) (-2404.478) [-2409.247] (-2406.734) * (-2405.761) (-2401.708) [-2400.752] (-2405.741) -- 0:05:41 61000 -- [-2400.491] (-2404.135) (-2403.036) (-2407.393) * (-2406.500) (-2400.000) (-2402.741) [-2402.275] -- 0:05:38 61500 -- (-2410.382) (-2402.091) [-2406.712] (-2399.930) * [-2402.436] (-2407.076) (-2406.575) (-2402.545) -- 0:05:35 62000 -- (-2406.267) [-2402.288] (-2402.547) (-2398.095) * (-2399.432) (-2409.330) (-2417.941) [-2408.313] -- 0:05:32 62500 -- (-2399.055) (-2400.073) (-2399.173) [-2399.455] * [-2401.536] (-2403.050) (-2410.010) (-2407.089) -- 0:05:30 63000 -- (-2399.909) (-2402.921) [-2403.458] (-2407.956) * (-2403.657) [-2401.831] (-2404.384) (-2407.199) -- 0:05:27 63500 -- [-2401.401] (-2399.822) (-2405.534) (-2406.535) * [-2398.192] (-2407.732) (-2403.980) (-2411.245) -- 0:05:39 64000 -- (-2403.130) (-2412.379) [-2416.897] (-2403.977) * [-2403.719] (-2399.250) (-2408.898) (-2400.388) -- 0:05:36 64500 -- (-2411.030) (-2396.061) [-2401.147] (-2397.077) * (-2399.457) (-2403.643) [-2402.633] (-2405.699) -- 0:05:33 65000 -- (-2403.541) [-2395.861] (-2405.991) (-2398.341) * (-2403.973) (-2410.805) [-2398.384] (-2417.072) -- 0:05:30 Average standard deviation of split frequencies: 0.025713 65500 -- (-2403.268) (-2401.578) (-2401.929) [-2400.311] * (-2399.803) (-2404.329) [-2399.742] (-2404.256) -- 0:05:28 66000 -- [-2404.643] (-2400.622) (-2404.841) (-2402.243) * (-2406.410) (-2407.964) [-2401.702] (-2408.890) -- 0:05:25 66500 -- (-2407.060) (-2400.883) (-2404.221) [-2398.489] * [-2400.245] (-2411.421) (-2405.983) (-2409.260) -- 0:05:36 67000 -- (-2409.278) (-2406.014) [-2400.423] (-2400.715) * [-2402.732] (-2411.143) (-2403.756) (-2412.366) -- 0:05:34 67500 -- [-2401.308] (-2397.718) (-2421.688) (-2405.461) * (-2402.705) (-2412.599) [-2406.427] (-2411.824) -- 0:05:31 68000 -- [-2406.271] (-2399.322) (-2405.152) (-2410.889) * (-2411.675) (-2411.388) [-2402.602] (-2410.413) -- 0:05:28 68500 -- (-2406.024) (-2399.568) [-2404.877] (-2402.033) * (-2404.753) (-2399.653) [-2402.624] (-2402.916) -- 0:05:26 69000 -- (-2402.867) [-2398.749] (-2404.545) (-2407.645) * [-2405.864] (-2404.350) (-2401.177) (-2410.253) -- 0:05:37 69500 -- (-2399.499) (-2401.061) [-2399.896] (-2399.814) * (-2405.558) (-2406.611) (-2406.389) [-2405.959] -- 0:05:34 70000 -- (-2403.255) (-2410.567) [-2405.052] (-2399.436) * (-2408.103) (-2404.662) (-2401.540) [-2407.276] -- 0:05:32 Average standard deviation of split frequencies: 0.025349 70500 -- (-2403.447) [-2410.743] (-2408.370) (-2406.894) * (-2397.682) (-2406.176) (-2400.932) [-2401.144] -- 0:05:29 71000 -- (-2401.199) (-2401.761) [-2405.894] (-2412.873) * (-2410.107) (-2404.590) [-2398.611] (-2402.558) -- 0:05:27 71500 -- (-2407.826) (-2402.036) [-2410.107] (-2408.913) * (-2409.167) (-2409.999) (-2401.779) [-2400.297] -- 0:05:24 72000 -- [-2399.301] (-2400.381) (-2401.663) (-2403.746) * (-2403.517) (-2404.624) [-2403.878] (-2410.172) -- 0:05:35 72500 -- [-2405.923] (-2407.908) (-2403.719) (-2406.614) * (-2405.376) [-2399.526] (-2412.685) (-2400.692) -- 0:05:32 73000 -- (-2406.856) (-2398.031) [-2407.013] (-2399.681) * (-2405.816) [-2401.558] (-2404.387) (-2400.665) -- 0:05:30 73500 -- [-2403.017] (-2399.301) (-2400.584) (-2401.710) * (-2403.495) (-2403.786) (-2399.942) [-2401.901] -- 0:05:27 74000 -- (-2404.985) (-2406.540) [-2402.195] (-2402.111) * (-2397.963) (-2405.523) (-2401.347) [-2407.800] -- 0:05:25 74500 -- (-2407.530) (-2412.414) (-2404.157) [-2403.268] * [-2397.961] (-2402.484) (-2402.136) (-2401.812) -- 0:05:22 75000 -- [-2400.153] (-2409.426) (-2403.085) (-2408.529) * [-2403.871] (-2404.607) (-2401.236) (-2402.409) -- 0:05:33 Average standard deviation of split frequencies: 0.028532 75500 -- (-2403.563) [-2406.912] (-2403.306) (-2410.911) * [-2401.426] (-2401.964) (-2401.530) (-2401.747) -- 0:05:30 76000 -- (-2411.916) (-2405.061) [-2401.812] (-2409.317) * (-2405.795) (-2401.754) (-2404.299) [-2407.209] -- 0:05:28 76500 -- [-2400.464] (-2399.188) (-2399.739) (-2413.003) * (-2403.224) (-2405.353) (-2404.103) [-2410.234] -- 0:05:25 77000 -- (-2400.029) [-2403.149] (-2403.929) (-2405.158) * (-2409.426) [-2398.048] (-2401.913) (-2405.220) -- 0:05:23 77500 -- [-2402.896] (-2405.277) (-2407.251) (-2405.604) * (-2402.492) (-2399.346) [-2407.082] (-2406.403) -- 0:05:21 78000 -- [-2397.661] (-2403.700) (-2398.999) (-2406.336) * (-2402.807) [-2401.178] (-2402.144) (-2403.404) -- 0:05:30 78500 -- (-2410.497) [-2401.869] (-2399.085) (-2399.714) * (-2400.004) [-2400.133] (-2406.006) (-2403.706) -- 0:05:28 79000 -- (-2399.188) [-2403.230] (-2404.436) (-2405.741) * (-2406.022) [-2404.382] (-2401.230) (-2404.491) -- 0:05:26 79500 -- (-2405.982) (-2408.660) [-2401.582] (-2401.936) * [-2401.074] (-2397.547) (-2400.893) (-2403.903) -- 0:05:24 80000 -- (-2413.413) (-2395.873) (-2399.030) [-2405.059] * (-2405.021) [-2398.780] (-2400.717) (-2401.487) -- 0:05:22 Average standard deviation of split frequencies: 0.024544 80500 -- (-2410.657) [-2403.366] (-2410.233) (-2405.451) * (-2404.929) (-2402.482) (-2406.768) [-2400.470] -- 0:05:31 81000 -- (-2411.333) (-2402.409) [-2404.547] (-2405.433) * [-2404.708] (-2401.714) (-2400.652) (-2398.433) -- 0:05:29 81500 -- [-2408.159] (-2409.961) (-2405.868) (-2403.853) * (-2410.038) (-2405.141) (-2409.142) [-2402.233] -- 0:05:26 82000 -- (-2410.490) [-2402.057] (-2411.962) (-2398.809) * [-2406.463] (-2401.515) (-2405.103) (-2408.874) -- 0:05:24 82500 -- [-2400.012] (-2401.798) (-2403.665) (-2411.175) * (-2410.678) [-2404.240] (-2410.983) (-2415.865) -- 0:05:22 83000 -- (-2407.537) [-2397.759] (-2408.307) (-2398.125) * [-2401.712] (-2408.205) (-2402.990) (-2402.470) -- 0:05:20 83500 -- (-2410.328) (-2401.239) (-2400.593) [-2401.880] * (-2407.220) (-2407.464) [-2407.694] (-2396.191) -- 0:05:29 84000 -- (-2412.292) (-2402.423) (-2403.948) [-2404.295] * (-2407.358) [-2404.644] (-2405.742) (-2400.663) -- 0:05:27 84500 -- (-2404.608) [-2403.826] (-2403.554) (-2405.005) * (-2410.628) (-2405.960) [-2398.703] (-2402.237) -- 0:05:25 85000 -- (-2415.841) (-2405.711) [-2401.922] (-2405.996) * (-2402.461) (-2398.909) [-2399.572] (-2405.379) -- 0:05:22 Average standard deviation of split frequencies: 0.029600 85500 -- [-2407.373] (-2404.249) (-2401.458) (-2408.210) * [-2404.796] (-2403.374) (-2400.203) (-2401.606) -- 0:05:20 86000 -- [-2407.226] (-2401.467) (-2395.884) (-2403.448) * (-2411.854) (-2401.398) (-2403.664) [-2402.224] -- 0:05:18 86500 -- [-2407.573] (-2401.200) (-2399.636) (-2409.643) * (-2412.491) (-2403.518) (-2405.215) [-2404.735] -- 0:05:27 87000 -- (-2399.554) [-2401.651] (-2399.851) (-2406.261) * (-2400.369) [-2405.007] (-2411.233) (-2401.600) -- 0:05:25 87500 -- (-2405.293) [-2400.636] (-2403.018) (-2406.431) * [-2398.768] (-2400.898) (-2401.876) (-2405.074) -- 0:05:23 88000 -- (-2406.224) (-2405.324) [-2400.910] (-2408.943) * (-2400.417) (-2405.092) [-2409.125] (-2402.532) -- 0:05:21 88500 -- (-2403.222) (-2410.495) (-2396.018) [-2397.416] * (-2399.436) [-2403.329] (-2401.539) (-2408.222) -- 0:05:19 89000 -- (-2420.319) [-2402.978] (-2402.085) (-2398.328) * [-2405.081] (-2402.865) (-2403.450) (-2396.665) -- 0:05:27 89500 -- (-2400.006) [-2398.030] (-2398.277) (-2403.287) * (-2405.883) (-2402.359) (-2400.937) [-2398.532] -- 0:05:25 90000 -- (-2400.358) (-2397.496) [-2397.315] (-2405.506) * (-2404.824) (-2404.466) [-2409.548] (-2405.222) -- 0:05:23 Average standard deviation of split frequencies: 0.028076 90500 -- (-2414.230) (-2403.771) (-2396.589) [-2403.029] * (-2416.048) (-2401.596) [-2401.647] (-2398.392) -- 0:05:21 91000 -- (-2402.148) (-2401.716) (-2402.078) [-2400.274] * (-2401.442) [-2405.245] (-2404.890) (-2409.382) -- 0:05:19 91500 -- (-2399.698) [-2401.448] (-2403.394) (-2398.965) * (-2407.496) (-2403.835) (-2400.852) [-2405.225] -- 0:05:17 92000 -- (-2406.849) (-2400.716) [-2402.824] (-2405.881) * (-2406.262) [-2405.770] (-2399.211) (-2397.214) -- 0:05:25 92500 -- [-2403.818] (-2410.028) (-2405.246) (-2406.516) * (-2410.676) (-2401.430) [-2397.123] (-2403.592) -- 0:05:23 93000 -- (-2405.292) [-2399.036] (-2403.737) (-2410.114) * (-2413.494) [-2404.158] (-2413.681) (-2410.345) -- 0:05:21 93500 -- (-2407.176) [-2401.735] (-2400.593) (-2401.041) * (-2404.290) (-2400.689) (-2404.568) [-2402.197] -- 0:05:19 94000 -- (-2408.494) (-2399.491) [-2408.093] (-2402.335) * (-2403.323) [-2405.179] (-2404.910) (-2400.452) -- 0:05:18 94500 -- (-2423.668) (-2405.806) (-2400.109) [-2403.582] * [-2401.206] (-2407.862) (-2399.963) (-2406.663) -- 0:05:16 95000 -- (-2406.279) (-2398.743) (-2399.320) [-2405.845] * (-2405.038) (-2407.497) [-2403.868] (-2402.643) -- 0:05:23 Average standard deviation of split frequencies: 0.026517 95500 -- (-2403.205) [-2400.548] (-2400.460) (-2402.191) * (-2407.870) (-2411.322) (-2404.672) [-2403.419] -- 0:05:22 96000 -- (-2415.945) [-2403.506] (-2399.672) (-2401.700) * [-2398.366] (-2403.822) (-2406.934) (-2403.474) -- 0:05:20 96500 -- (-2402.424) (-2402.396) [-2401.948] (-2413.334) * (-2402.705) [-2405.871] (-2415.359) (-2400.536) -- 0:05:18 97000 -- [-2402.852] (-2406.075) (-2401.529) (-2403.272) * (-2403.562) [-2408.231] (-2400.803) (-2407.238) -- 0:05:16 97500 -- (-2405.781) (-2404.756) [-2407.704] (-2398.813) * [-2402.328] (-2398.282) (-2404.034) (-2410.997) -- 0:05:14 98000 -- (-2409.138) [-2400.242] (-2401.620) (-2406.141) * (-2406.968) (-2399.940) (-2406.754) [-2406.337] -- 0:05:22 98500 -- (-2409.197) (-2399.448) (-2402.321) [-2403.475] * (-2407.679) [-2407.398] (-2402.058) (-2400.964) -- 0:05:20 99000 -- (-2403.343) [-2402.927] (-2405.816) (-2404.102) * [-2399.340] (-2407.213) (-2401.279) (-2404.704) -- 0:05:18 99500 -- (-2406.706) [-2402.723] (-2399.070) (-2404.880) * (-2405.402) (-2404.762) [-2403.938] (-2403.352) -- 0:05:16 100000 -- (-2404.412) [-2402.318] (-2401.330) (-2402.631) * (-2410.862) (-2400.053) [-2400.245] (-2406.485) -- 0:05:15 Average standard deviation of split frequencies: 0.032780 100500 -- [-2407.434] (-2403.228) (-2402.991) (-2400.256) * (-2402.966) [-2405.599] (-2403.925) (-2409.729) -- 0:05:22 101000 -- (-2407.134) [-2402.833] (-2408.545) (-2407.689) * (-2400.375) [-2402.923] (-2405.118) (-2407.457) -- 0:05:20 101500 -- (-2409.243) (-2410.738) (-2407.469) [-2400.943] * [-2402.465] (-2405.693) (-2405.825) (-2407.125) -- 0:05:18 102000 -- (-2403.304) (-2407.749) (-2407.133) [-2396.678] * [-2403.266] (-2405.651) (-2401.032) (-2401.972) -- 0:05:16 102500 -- (-2402.301) (-2405.647) [-2404.459] (-2402.700) * (-2408.032) [-2404.186] (-2406.126) (-2409.705) -- 0:05:15 103000 -- (-2404.093) (-2411.444) [-2399.491] (-2402.087) * (-2406.146) (-2401.334) (-2404.188) [-2406.398] -- 0:05:13 103500 -- (-2402.901) [-2408.261] (-2401.262) (-2406.210) * (-2406.171) (-2403.277) [-2407.494] (-2407.302) -- 0:05:20 104000 -- [-2405.425] (-2400.510) (-2399.546) (-2410.667) * [-2401.379] (-2396.430) (-2412.329) (-2406.363) -- 0:05:18 104500 -- (-2405.806) [-2403.748] (-2409.460) (-2403.461) * (-2402.764) (-2399.655) [-2402.418] (-2400.064) -- 0:05:17 105000 -- (-2401.910) [-2405.042] (-2410.760) (-2402.152) * (-2395.721) (-2411.095) (-2403.929) [-2399.964] -- 0:05:15 Average standard deviation of split frequencies: 0.032020 105500 -- (-2408.879) (-2410.178) (-2405.391) [-2403.807] * (-2403.738) [-2404.156] (-2398.586) (-2405.635) -- 0:05:13 106000 -- [-2399.786] (-2414.610) (-2407.524) (-2403.203) * (-2404.147) [-2401.759] (-2405.752) (-2411.400) -- 0:05:12 106500 -- [-2407.251] (-2403.681) (-2397.322) (-2399.981) * (-2409.959) [-2398.857] (-2400.714) (-2394.451) -- 0:05:18 107000 -- (-2408.480) [-2403.086] (-2403.030) (-2406.459) * (-2403.208) [-2398.815] (-2402.796) (-2403.340) -- 0:05:17 107500 -- (-2402.960) [-2401.133] (-2402.061) (-2411.636) * (-2407.210) (-2402.696) [-2405.291] (-2405.353) -- 0:05:15 108000 -- [-2405.310] (-2405.415) (-2406.009) (-2399.858) * (-2405.175) (-2402.844) [-2405.917] (-2406.460) -- 0:05:13 108500 -- (-2411.421) [-2402.751] (-2417.533) (-2404.525) * (-2407.561) (-2400.250) [-2401.666] (-2410.611) -- 0:05:12 109000 -- (-2400.374) (-2401.090) [-2407.500] (-2401.777) * (-2406.517) (-2401.823) (-2406.817) [-2398.966] -- 0:05:10 109500 -- (-2405.946) (-2404.907) (-2403.789) [-2401.284] * (-2402.850) (-2401.245) (-2402.627) [-2404.135] -- 0:05:17 110000 -- (-2407.384) [-2405.781] (-2400.679) (-2403.489) * [-2402.149] (-2402.894) (-2396.340) (-2399.972) -- 0:05:15 Average standard deviation of split frequencies: 0.030670 110500 -- (-2401.748) (-2403.863) [-2403.199] (-2404.842) * [-2399.724] (-2400.590) (-2402.796) (-2401.766) -- 0:05:13 111000 -- (-2402.151) (-2402.880) (-2402.740) [-2401.730] * (-2408.008) [-2401.247] (-2406.878) (-2410.585) -- 0:05:12 111500 -- [-2396.816] (-2402.787) (-2398.498) (-2403.170) * (-2405.373) (-2414.472) (-2401.058) [-2404.716] -- 0:05:10 112000 -- (-2398.543) (-2406.416) [-2399.669] (-2405.849) * (-2404.846) (-2405.023) (-2407.110) [-2402.041] -- 0:05:17 112500 -- (-2406.461) [-2404.793] (-2403.142) (-2403.524) * (-2402.648) [-2400.618] (-2409.099) (-2409.040) -- 0:05:15 113000 -- [-2406.822] (-2401.141) (-2401.239) (-2411.289) * (-2402.576) (-2400.856) (-2401.755) [-2404.159] -- 0:05:13 113500 -- (-2403.152) (-2407.269) [-2404.679] (-2402.514) * (-2394.401) [-2402.189] (-2411.904) (-2408.373) -- 0:05:12 114000 -- (-2402.552) (-2401.836) (-2404.800) [-2399.083] * [-2401.438] (-2400.536) (-2405.912) (-2411.726) -- 0:05:10 114500 -- (-2398.500) (-2403.805) (-2398.437) [-2401.714] * (-2400.399) (-2400.853) (-2404.323) [-2407.514] -- 0:05:09 115000 -- (-2411.483) (-2401.240) [-2395.246] (-2403.434) * (-2399.775) (-2401.674) [-2396.963] (-2405.173) -- 0:05:15 Average standard deviation of split frequencies: 0.026009 115500 -- (-2409.293) (-2402.507) [-2403.729] (-2401.421) * (-2409.523) [-2399.629] (-2400.632) (-2403.302) -- 0:05:13 116000 -- (-2418.787) (-2404.105) [-2402.067] (-2408.381) * (-2406.090) [-2403.331] (-2411.973) (-2401.753) -- 0:05:12 116500 -- (-2404.328) (-2398.360) (-2402.699) [-2406.065] * (-2416.906) (-2405.482) [-2404.136] (-2399.784) -- 0:05:10 117000 -- (-2413.756) (-2410.728) [-2403.738] (-2402.260) * (-2411.948) (-2398.615) (-2401.730) [-2405.351] -- 0:05:09 117500 -- (-2406.492) [-2405.343] (-2395.307) (-2402.813) * (-2412.133) (-2403.769) [-2398.112] (-2405.598) -- 0:05:15 118000 -- (-2403.592) [-2402.562] (-2399.810) (-2399.873) * (-2404.561) [-2399.640] (-2395.947) (-2413.797) -- 0:05:13 118500 -- (-2406.497) [-2399.236] (-2404.958) (-2398.698) * (-2401.099) [-2408.365] (-2405.773) (-2407.320) -- 0:05:12 119000 -- (-2406.031) (-2408.491) [-2399.642] (-2405.507) * (-2401.877) (-2414.633) [-2402.416] (-2401.318) -- 0:05:10 119500 -- (-2405.835) (-2403.488) [-2401.895] (-2406.630) * (-2407.415) (-2416.788) (-2404.753) [-2407.415] -- 0:05:09 120000 -- [-2402.298] (-2416.145) (-2408.789) (-2408.857) * (-2403.379) (-2404.877) (-2397.535) [-2404.077] -- 0:05:08 Average standard deviation of split frequencies: 0.025003 120500 -- [-2407.094] (-2400.319) (-2399.964) (-2398.546) * (-2413.277) [-2405.145] (-2401.274) (-2402.712) -- 0:05:13 121000 -- (-2403.016) [-2403.133] (-2405.259) (-2406.157) * (-2402.730) [-2404.147] (-2406.264) (-2400.124) -- 0:05:12 121500 -- (-2400.922) [-2398.509] (-2403.932) (-2408.601) * (-2403.586) (-2405.890) [-2400.677] (-2400.809) -- 0:05:10 122000 -- (-2404.879) (-2399.531) [-2402.731] (-2401.484) * [-2406.274] (-2414.161) (-2407.010) (-2408.122) -- 0:05:09 122500 -- (-2397.019) [-2400.251] (-2406.341) (-2403.686) * (-2404.643) (-2409.193) (-2408.269) [-2405.587] -- 0:05:08 123000 -- (-2399.815) [-2398.533] (-2403.766) (-2405.679) * (-2402.660) [-2405.933] (-2401.270) (-2401.492) -- 0:05:06 123500 -- (-2398.970) [-2398.908] (-2403.003) (-2404.262) * (-2416.424) (-2409.008) (-2401.655) [-2399.866] -- 0:05:12 124000 -- (-2402.620) (-2400.189) (-2397.640) [-2401.108] * [-2406.998] (-2404.502) (-2399.250) (-2403.517) -- 0:05:10 124500 -- (-2405.141) (-2403.507) [-2404.587] (-2404.055) * (-2410.784) (-2404.348) (-2400.862) [-2397.815] -- 0:05:09 125000 -- (-2409.708) (-2397.195) [-2402.094] (-2417.523) * (-2409.006) (-2412.906) [-2407.433] (-2404.316) -- 0:05:08 Average standard deviation of split frequencies: 0.011972 125500 -- (-2402.732) [-2404.866] (-2406.146) (-2405.858) * [-2405.931] (-2407.702) (-2401.735) (-2408.227) -- 0:05:06 126000 -- (-2397.217) [-2399.577] (-2408.557) (-2405.174) * (-2407.768) (-2404.304) (-2404.127) [-2405.284] -- 0:05:12 126500 -- (-2402.897) [-2407.570] (-2404.431) (-2400.563) * [-2410.956] (-2413.632) (-2405.299) (-2405.484) -- 0:05:10 127000 -- [-2405.995] (-2403.662) (-2400.524) (-2407.908) * (-2400.789) [-2404.643] (-2397.388) (-2402.445) -- 0:05:09 127500 -- (-2408.222) (-2415.398) (-2404.611) [-2408.739] * (-2404.218) (-2407.386) (-2403.965) [-2417.593] -- 0:05:07 128000 -- (-2399.508) [-2400.744] (-2405.358) (-2400.706) * (-2406.734) [-2405.501] (-2405.125) (-2411.780) -- 0:05:06 128500 -- (-2405.096) (-2407.339) [-2405.959] (-2401.992) * [-2398.724] (-2406.760) (-2402.240) (-2403.828) -- 0:05:05 129000 -- (-2403.876) (-2402.359) (-2405.412) [-2399.678] * (-2402.693) [-2397.892] (-2406.885) (-2410.399) -- 0:05:10 129500 -- [-2399.078] (-2406.241) (-2407.657) (-2399.603) * (-2399.827) (-2399.942) (-2402.133) [-2407.254] -- 0:05:09 130000 -- (-2405.246) (-2401.104) (-2402.590) [-2401.632] * (-2414.081) (-2399.841) [-2404.518] (-2405.631) -- 0:05:07 Average standard deviation of split frequencies: 0.008658 130500 -- (-2400.182) (-2400.292) (-2401.045) [-2400.721] * [-2406.578] (-2399.892) (-2403.499) (-2402.946) -- 0:05:06 131000 -- (-2404.432) [-2404.768] (-2400.732) (-2408.608) * (-2406.541) (-2402.093) (-2403.853) [-2397.339] -- 0:05:05 131500 -- [-2411.183] (-2403.843) (-2407.014) (-2405.170) * (-2409.567) (-2405.218) [-2396.072] (-2398.516) -- 0:05:03 132000 -- (-2405.042) [-2401.263] (-2403.176) (-2405.092) * (-2404.227) [-2403.857] (-2397.359) (-2409.684) -- 0:05:09 132500 -- (-2407.876) [-2402.919] (-2402.151) (-2411.001) * (-2408.504) (-2411.659) [-2403.308] (-2404.158) -- 0:05:07 133000 -- (-2412.313) (-2398.251) [-2400.137] (-2407.019) * (-2401.254) [-2403.774] (-2406.759) (-2406.130) -- 0:05:06 133500 -- (-2402.400) [-2403.893] (-2402.259) (-2404.382) * [-2401.235] (-2402.622) (-2411.800) (-2403.660) -- 0:05:05 134000 -- (-2400.350) (-2403.904) [-2402.071] (-2414.851) * (-2408.790) [-2406.728] (-2410.978) (-2412.504) -- 0:05:03 134500 -- (-2401.693) (-2405.843) [-2401.176] (-2401.761) * (-2414.022) (-2405.898) [-2407.756] (-2401.606) -- 0:05:08 135000 -- [-2411.958] (-2402.619) (-2408.147) (-2401.556) * (-2415.781) (-2399.890) [-2401.866] (-2407.080) -- 0:05:07 Average standard deviation of split frequencies: 0.009705 135500 -- (-2403.277) [-2407.290] (-2402.421) (-2403.986) * (-2411.666) (-2402.644) [-2400.923] (-2415.007) -- 0:05:06 136000 -- [-2404.883] (-2407.702) (-2404.552) (-2405.657) * (-2404.615) (-2406.906) [-2403.613] (-2408.716) -- 0:05:04 136500 -- [-2397.834] (-2405.717) (-2399.389) (-2404.669) * (-2409.021) (-2406.231) [-2403.623] (-2405.019) -- 0:05:03 137000 -- (-2405.048) [-2403.077] (-2399.899) (-2403.550) * (-2407.898) (-2407.309) (-2409.830) [-2403.185] -- 0:05:02 137500 -- [-2405.336] (-2405.981) (-2403.856) (-2406.048) * (-2409.564) (-2406.608) (-2407.396) [-2399.475] -- 0:05:07 138000 -- (-2402.244) [-2406.618] (-2399.090) (-2397.211) * (-2402.637) (-2398.851) (-2404.974) [-2400.898] -- 0:05:06 138500 -- (-2402.207) [-2404.151] (-2404.119) (-2400.492) * (-2404.475) (-2404.358) [-2402.424] (-2405.980) -- 0:05:04 139000 -- [-2402.014] (-2404.378) (-2400.321) (-2405.567) * [-2406.203] (-2401.724) (-2400.170) (-2399.108) -- 0:05:03 139500 -- (-2404.007) [-2397.675] (-2400.939) (-2413.085) * (-2402.435) [-2400.087] (-2400.548) (-2396.283) -- 0:05:02 140000 -- (-2402.503) [-2401.952] (-2397.798) (-2406.025) * (-2404.449) (-2408.000) (-2407.593) [-2403.348] -- 0:05:01 Average standard deviation of split frequencies: 0.012064 140500 -- [-2402.906] (-2410.669) (-2404.212) (-2403.436) * (-2403.389) (-2409.108) [-2403.838] (-2408.387) -- 0:05:05 141000 -- [-2409.124] (-2422.769) (-2406.621) (-2408.459) * (-2402.752) (-2402.205) [-2402.764] (-2400.716) -- 0:05:04 141500 -- (-2409.154) [-2408.424] (-2410.580) (-2404.293) * (-2406.615) (-2402.241) [-2399.274] (-2407.506) -- 0:05:03 142000 -- (-2404.435) (-2405.555) [-2408.288] (-2403.704) * [-2399.897] (-2403.679) (-2403.695) (-2401.554) -- 0:05:02 142500 -- [-2405.017] (-2404.291) (-2406.199) (-2399.677) * (-2407.736) (-2401.673) [-2403.617] (-2401.606) -- 0:05:00 143000 -- [-2403.437] (-2402.966) (-2402.127) (-2404.231) * (-2412.411) (-2402.233) [-2398.254] (-2407.544) -- 0:04:59 143500 -- (-2402.038) (-2406.504) (-2404.792) [-2404.500] * (-2411.905) (-2407.165) (-2402.634) [-2411.605] -- 0:05:04 144000 -- (-2402.343) (-2404.525) (-2397.313) [-2401.673] * (-2402.437) [-2405.906] (-2406.677) (-2405.124) -- 0:05:03 144500 -- [-2407.272] (-2407.208) (-2399.282) (-2402.970) * (-2409.721) [-2410.384] (-2412.313) (-2407.437) -- 0:05:01 145000 -- (-2404.855) (-2400.688) (-2408.905) [-2400.423] * (-2406.105) (-2416.064) [-2405.391] (-2410.127) -- 0:05:00 Average standard deviation of split frequencies: 0.011624 145500 -- (-2404.878) (-2405.634) [-2405.735] (-2410.193) * (-2401.887) [-2403.470] (-2407.346) (-2401.363) -- 0:04:59 146000 -- (-2415.060) (-2405.225) [-2402.290] (-2408.271) * (-2403.892) [-2404.318] (-2404.195) (-2406.398) -- 0:05:04 146500 -- (-2407.604) (-2407.732) [-2396.983] (-2404.610) * (-2398.552) (-2408.939) (-2413.176) [-2401.257] -- 0:05:02 147000 -- (-2402.437) (-2404.919) [-2399.782] (-2404.741) * (-2404.791) [-2403.902] (-2406.015) (-2401.845) -- 0:05:01 147500 -- (-2402.035) (-2407.578) [-2400.195] (-2398.739) * (-2401.110) [-2406.996] (-2408.185) (-2398.011) -- 0:05:00 148000 -- [-2402.284] (-2403.512) (-2401.111) (-2411.993) * (-2401.246) (-2400.188) (-2402.860) [-2397.436] -- 0:04:59 148500 -- (-2400.470) (-2402.865) (-2402.618) [-2398.886] * (-2398.814) (-2402.286) (-2407.584) [-2404.073] -- 0:04:58 149000 -- (-2408.482) [-2403.948] (-2406.042) (-2402.354) * (-2405.156) [-2402.122] (-2405.960) (-2409.847) -- 0:05:02 149500 -- (-2405.598) [-2403.451] (-2407.409) (-2402.978) * (-2409.121) (-2406.375) (-2408.838) [-2408.465] -- 0:05:01 150000 -- [-2400.097] (-2407.530) (-2406.171) (-2406.485) * [-2400.693] (-2406.583) (-2407.729) (-2406.665) -- 0:05:00 Average standard deviation of split frequencies: 0.005006 150500 -- (-2409.411) [-2405.074] (-2401.385) (-2402.379) * (-2412.835) (-2402.738) [-2402.054] (-2401.034) -- 0:04:59 151000 -- [-2404.731] (-2401.250) (-2406.484) (-2402.070) * [-2404.956] (-2404.500) (-2409.935) (-2410.113) -- 0:04:57 151500 -- [-2399.947] (-2412.854) (-2400.489) (-2397.660) * (-2407.235) [-2399.032] (-2413.305) (-2407.977) -- 0:04:56 152000 -- (-2403.000) (-2405.644) [-2404.163] (-2399.364) * (-2404.769) [-2396.031] (-2405.728) (-2402.697) -- 0:05:01 152500 -- (-2401.868) [-2400.912] (-2411.498) (-2403.729) * [-2402.465] (-2408.398) (-2406.684) (-2405.731) -- 0:05:00 153000 -- (-2413.338) (-2403.223) (-2401.627) [-2407.608] * (-2404.045) [-2402.173] (-2407.220) (-2403.349) -- 0:04:58 153500 -- (-2405.223) (-2409.720) [-2401.087] (-2409.621) * [-2400.157] (-2407.572) (-2407.238) (-2408.277) -- 0:04:57 154000 -- [-2403.987] (-2406.362) (-2403.030) (-2404.488) * (-2401.660) [-2403.773] (-2405.730) (-2403.808) -- 0:04:56 154500 -- (-2408.988) (-2400.758) [-2402.192] (-2406.526) * (-2408.984) [-2406.565] (-2410.883) (-2399.291) -- 0:04:55 155000 -- (-2404.646) [-2400.633] (-2403.566) (-2402.494) * (-2411.054) (-2410.667) (-2402.092) [-2396.824] -- 0:04:59 Average standard deviation of split frequencies: 0.003626 155500 -- (-2405.603) (-2400.138) [-2399.431] (-2399.416) * (-2402.294) [-2401.075] (-2406.131) (-2400.700) -- 0:04:58 156000 -- (-2403.392) (-2406.883) [-2403.903] (-2400.602) * (-2402.245) (-2407.215) [-2407.935] (-2401.356) -- 0:04:57 156500 -- [-2399.698] (-2404.685) (-2418.391) (-2405.460) * (-2405.888) [-2405.136] (-2408.115) (-2404.595) -- 0:04:56 157000 -- (-2420.810) [-2401.785] (-2410.918) (-2402.725) * (-2404.483) [-2396.028] (-2400.489) (-2400.865) -- 0:04:55 157500 -- (-2402.152) [-2402.207] (-2410.217) (-2405.589) * (-2407.765) (-2397.944) [-2404.809] (-2405.029) -- 0:04:59 158000 -- (-2397.907) [-2402.448] (-2403.832) (-2403.621) * (-2405.850) [-2399.231] (-2399.179) (-2406.935) -- 0:04:58 158500 -- (-2399.793) [-2401.983] (-2402.746) (-2414.850) * (-2401.394) (-2401.119) [-2402.127] (-2408.627) -- 0:04:57 159000 -- (-2400.874) (-2403.440) [-2405.420] (-2401.109) * (-2404.324) (-2401.128) (-2405.718) [-2411.924] -- 0:04:56 159500 -- (-2407.693) [-2401.947] (-2409.530) (-2414.491) * (-2399.182) (-2404.597) (-2409.683) [-2402.891] -- 0:04:55 160000 -- (-2409.950) (-2397.171) (-2403.475) [-2407.534] * (-2398.922) [-2399.920] (-2405.774) (-2419.248) -- 0:04:54 Average standard deviation of split frequencies: 0.001174 160500 -- (-2408.408) [-2401.691] (-2410.237) (-2403.466) * (-2400.700) (-2403.385) [-2401.486] (-2400.640) -- 0:04:58 161000 -- (-2403.447) (-2401.723) [-2400.038] (-2401.199) * (-2405.799) [-2399.995] (-2406.218) (-2404.080) -- 0:04:57 161500 -- (-2407.288) (-2401.751) (-2405.266) [-2400.999] * (-2405.492) [-2399.995] (-2412.642) (-2403.734) -- 0:04:55 162000 -- (-2400.341) [-2397.766] (-2403.705) (-2407.142) * [-2410.434] (-2400.971) (-2403.417) (-2409.447) -- 0:04:54 162500 -- (-2399.788) (-2397.862) [-2402.256] (-2406.497) * (-2402.532) (-2406.486) (-2406.786) [-2408.340] -- 0:04:53 163000 -- (-2403.746) [-2404.936] (-2404.611) (-2402.190) * (-2400.792) [-2397.248] (-2408.588) (-2404.435) -- 0:04:52 163500 -- [-2401.335] (-2402.884) (-2403.837) (-2409.334) * [-2403.303] (-2397.916) (-2416.933) (-2403.788) -- 0:04:56 164000 -- (-2410.201) (-2408.423) [-2406.162] (-2410.038) * (-2399.906) [-2409.766] (-2406.304) (-2399.228) -- 0:04:55 164500 -- [-2405.772] (-2407.691) (-2397.520) (-2407.961) * [-2399.247] (-2402.817) (-2405.978) (-2404.411) -- 0:04:54 165000 -- [-2411.596] (-2403.861) (-2405.372) (-2398.136) * [-2403.574] (-2400.565) (-2400.488) (-2401.256) -- 0:04:53 Average standard deviation of split frequencies: 0.003408 165500 -- [-2405.608] (-2411.837) (-2403.787) (-2402.181) * [-2401.175] (-2398.668) (-2413.165) (-2404.990) -- 0:04:52 166000 -- (-2403.594) [-2399.674] (-2401.251) (-2392.938) * (-2400.071) (-2407.892) (-2410.358) [-2397.431] -- 0:04:56 166500 -- (-2407.905) (-2398.012) (-2403.298) [-2402.811] * [-2401.379] (-2402.749) (-2412.210) (-2402.278) -- 0:04:55 167000 -- (-2405.424) (-2404.146) (-2398.276) [-2401.595] * (-2400.653) (-2404.890) (-2409.400) [-2400.303] -- 0:04:54 167500 -- (-2401.927) [-2400.855] (-2400.023) (-2406.591) * [-2409.087] (-2399.737) (-2410.552) (-2409.064) -- 0:04:53 168000 -- (-2406.847) [-2402.628] (-2416.760) (-2403.998) * (-2403.315) [-2402.220] (-2410.242) (-2404.650) -- 0:04:52 168500 -- (-2407.190) [-2405.579] (-2407.694) (-2398.737) * (-2399.486) (-2403.190) (-2409.244) [-2401.831] -- 0:04:51 169000 -- (-2396.497) (-2408.152) [-2399.779] (-2403.414) * [-2399.907] (-2409.482) (-2406.690) (-2409.193) -- 0:04:55 169500 -- (-2405.168) (-2400.360) (-2404.396) [-2400.292] * [-2406.353] (-2410.165) (-2408.775) (-2402.124) -- 0:04:53 170000 -- (-2403.311) [-2400.470] (-2403.893) (-2407.144) * (-2405.335) (-2406.805) (-2408.027) [-2400.632] -- 0:04:52 Average standard deviation of split frequencies: 0.004419 170500 -- (-2402.407) [-2400.017] (-2400.116) (-2403.528) * (-2408.455) (-2410.068) (-2408.401) [-2404.529] -- 0:04:51 171000 -- [-2397.459] (-2406.820) (-2405.294) (-2409.592) * (-2407.476) (-2414.939) (-2400.198) [-2399.045] -- 0:04:50 171500 -- (-2399.375) (-2402.281) [-2401.773] (-2408.351) * (-2409.913) [-2403.626] (-2411.618) (-2410.695) -- 0:04:49 172000 -- [-2397.503] (-2412.457) (-2406.767) (-2406.358) * [-2403.019] (-2402.214) (-2394.878) (-2406.778) -- 0:04:53 172500 -- (-2414.219) (-2399.812) [-2399.252] (-2401.747) * (-2414.182) (-2403.006) (-2398.143) [-2407.513] -- 0:04:52 173000 -- [-2407.781] (-2402.232) (-2403.890) (-2410.691) * (-2413.746) (-2399.048) [-2406.081] (-2407.050) -- 0:04:51 173500 -- (-2412.774) (-2403.395) [-2402.758] (-2404.219) * (-2407.571) [-2401.317] (-2402.371) (-2407.365) -- 0:04:50 174000 -- (-2404.514) [-2403.016] (-2401.114) (-2410.891) * (-2408.554) [-2401.855] (-2401.987) (-2406.206) -- 0:04:49 174500 -- (-2402.947) [-2402.358] (-2404.615) (-2400.059) * (-2407.408) (-2394.556) (-2408.979) [-2399.987] -- 0:04:53 175000 -- (-2406.434) (-2401.437) (-2411.404) [-2401.531] * (-2408.230) (-2404.377) (-2408.353) [-2401.939] -- 0:04:52 Average standard deviation of split frequencies: 0.005357 175500 -- [-2408.502] (-2411.258) (-2398.667) (-2400.207) * (-2402.572) (-2407.206) (-2404.788) [-2405.701] -- 0:04:51 176000 -- (-2401.477) (-2411.756) (-2408.316) [-2410.430] * (-2419.433) (-2402.813) (-2404.293) [-2409.167] -- 0:04:50 176500 -- (-2409.258) (-2404.803) (-2399.446) [-2399.883] * (-2401.655) (-2403.881) (-2409.677) [-2411.400] -- 0:04:49 177000 -- (-2411.814) (-2410.011) (-2403.415) [-2402.775] * (-2413.296) (-2409.331) [-2398.424] (-2403.387) -- 0:04:48 177500 -- (-2404.548) (-2409.586) (-2397.172) [-2399.030] * [-2402.479] (-2408.717) (-2406.834) (-2403.143) -- 0:04:51 178000 -- [-2398.780] (-2416.853) (-2403.586) (-2404.892) * (-2402.789) (-2404.236) [-2407.205] (-2410.115) -- 0:04:50 178500 -- [-2402.506] (-2404.092) (-2397.936) (-2400.598) * (-2408.761) (-2412.116) (-2407.975) [-2413.970] -- 0:04:49 179000 -- (-2401.743) (-2407.207) (-2406.523) [-2408.540] * (-2396.870) (-2412.257) (-2412.972) [-2401.235] -- 0:04:48 179500 -- (-2407.469) (-2404.494) [-2405.997] (-2403.430) * (-2406.520) [-2412.596] (-2405.022) (-2396.987) -- 0:04:47 180000 -- (-2398.298) (-2404.427) [-2409.102] (-2399.666) * (-2400.421) [-2401.116] (-2403.277) (-2400.741) -- 0:04:47 Average standard deviation of split frequencies: 0.008350 180500 -- (-2399.904) [-2397.061] (-2401.536) (-2415.463) * (-2399.575) (-2402.906) [-2398.051] (-2402.981) -- 0:04:50 181000 -- (-2404.149) (-2404.931) [-2401.826] (-2405.153) * (-2401.557) (-2398.539) (-2403.966) [-2397.625] -- 0:04:49 181500 -- [-2400.735] (-2404.945) (-2404.453) (-2402.488) * (-2400.408) (-2406.750) (-2403.351) [-2399.814] -- 0:04:48 182000 -- (-2410.599) (-2406.941) [-2397.770] (-2405.345) * (-2407.173) (-2401.836) (-2407.393) [-2399.376] -- 0:04:47 182500 -- (-2400.750) [-2409.416] (-2401.309) (-2404.591) * (-2403.616) (-2399.218) [-2400.104] (-2400.761) -- 0:04:46 183000 -- (-2400.478) [-2403.140] (-2402.688) (-2402.997) * (-2405.491) [-2403.297] (-2412.678) (-2400.137) -- 0:04:50 183500 -- (-2401.940) (-2401.779) (-2394.460) [-2403.326] * (-2398.765) [-2403.548] (-2404.061) (-2401.163) -- 0:04:49 184000 -- (-2399.290) (-2407.013) [-2402.687] (-2412.461) * [-2400.680] (-2403.867) (-2406.621) (-2405.869) -- 0:04:48 184500 -- (-2398.669) (-2405.371) (-2402.609) [-2397.126] * (-2411.859) (-2398.538) (-2407.495) [-2408.677] -- 0:04:47 185000 -- [-2402.138] (-2406.431) (-2413.818) (-2405.575) * (-2411.045) (-2403.424) [-2403.006] (-2407.002) -- 0:04:46 Average standard deviation of split frequencies: 0.013179 185500 -- [-2399.440] (-2406.052) (-2406.663) (-2401.058) * (-2410.639) (-2402.470) (-2409.561) [-2402.398] -- 0:04:45 186000 -- [-2400.144] (-2402.519) (-2405.211) (-2407.065) * (-2408.763) [-2406.763] (-2408.646) (-2400.018) -- 0:04:48 186500 -- (-2403.544) (-2399.886) (-2405.959) [-2402.678] * (-2401.035) [-2411.141] (-2403.212) (-2403.408) -- 0:04:47 187000 -- (-2409.490) (-2401.408) (-2404.440) [-2402.427] * (-2402.187) (-2407.114) [-2400.945] (-2403.640) -- 0:04:46 187500 -- [-2402.085] (-2402.637) (-2413.791) (-2408.895) * (-2403.734) (-2401.041) (-2403.236) [-2403.993] -- 0:04:46 188000 -- (-2409.541) [-2406.931] (-2403.350) (-2399.128) * (-2409.550) (-2400.619) [-2401.532] (-2400.291) -- 0:04:45 188500 -- [-2408.692] (-2401.118) (-2402.658) (-2407.700) * (-2417.858) [-2398.012] (-2400.965) (-2398.722) -- 0:04:44 189000 -- (-2399.871) [-2395.546] (-2408.920) (-2414.178) * (-2402.549) [-2403.083] (-2405.361) (-2410.769) -- 0:04:47 189500 -- (-2408.085) (-2403.624) [-2401.616] (-2401.116) * [-2410.260] (-2402.351) (-2402.984) (-2404.102) -- 0:04:46 190000 -- (-2409.382) [-2404.201] (-2400.094) (-2398.600) * (-2409.604) [-2398.511] (-2406.053) (-2401.857) -- 0:04:45 Average standard deviation of split frequencies: 0.014834 190500 -- (-2402.008) (-2405.920) (-2405.033) [-2400.041] * (-2408.265) (-2403.198) [-2398.870] (-2399.068) -- 0:04:44 191000 -- (-2404.907) (-2405.447) [-2404.942] (-2401.217) * [-2402.296] (-2402.981) (-2405.422) (-2400.999) -- 0:04:43 191500 -- (-2406.367) [-2405.360] (-2412.008) (-2405.879) * (-2402.579) [-2401.408] (-2408.154) (-2402.156) -- 0:04:47 192000 -- [-2401.567] (-2402.844) (-2404.889) (-2399.298) * (-2406.020) [-2411.386] (-2407.431) (-2420.137) -- 0:04:46 192500 -- [-2398.683] (-2414.369) (-2403.530) (-2401.716) * (-2396.639) (-2401.419) (-2407.042) [-2407.898] -- 0:04:45 193000 -- [-2399.674] (-2409.713) (-2401.490) (-2410.218) * (-2401.532) [-2399.824] (-2398.558) (-2401.905) -- 0:04:44 193500 -- (-2398.702) (-2398.230) (-2408.693) [-2406.140] * (-2406.022) (-2406.190) (-2403.345) [-2399.380] -- 0:04:43 194000 -- (-2400.119) (-2401.390) [-2404.506] (-2405.655) * (-2402.079) [-2402.603] (-2405.467) (-2400.937) -- 0:04:42 194500 -- (-2406.876) (-2406.202) [-2403.333] (-2401.667) * (-2401.619) (-2404.465) [-2404.540] (-2397.685) -- 0:04:45 195000 -- [-2397.697] (-2403.281) (-2403.367) (-2401.166) * (-2402.181) (-2408.649) (-2405.443) [-2400.159] -- 0:04:44 Average standard deviation of split frequencies: 0.012507 195500 -- (-2412.490) (-2402.709) [-2399.627] (-2401.857) * (-2402.564) [-2407.315] (-2405.973) (-2406.674) -- 0:04:43 196000 -- (-2402.365) (-2406.214) [-2400.993] (-2405.012) * (-2409.741) (-2409.783) [-2402.271] (-2408.504) -- 0:04:43 196500 -- (-2401.477) (-2403.408) (-2405.050) [-2404.336] * (-2402.895) [-2405.667] (-2411.743) (-2408.752) -- 0:04:42 197000 -- [-2407.696] (-2404.298) (-2407.714) (-2404.770) * (-2412.517) (-2408.671) (-2401.495) [-2410.632] -- 0:04:45 197500 -- (-2403.188) (-2405.984) [-2399.348] (-2401.980) * [-2407.340] (-2404.742) (-2405.193) (-2405.289) -- 0:04:44 198000 -- (-2404.125) (-2401.602) (-2414.780) [-2404.357] * [-2405.286] (-2405.242) (-2401.569) (-2403.494) -- 0:04:43 198500 -- (-2400.977) [-2405.754] (-2400.129) (-2405.196) * (-2409.619) (-2403.098) (-2405.508) [-2399.379] -- 0:04:42 199000 -- (-2411.640) (-2400.202) [-2399.219] (-2405.122) * (-2418.571) (-2410.885) (-2395.803) [-2399.345] -- 0:04:41 199500 -- (-2407.965) [-2402.522] (-2404.627) (-2405.157) * (-2402.046) [-2403.889] (-2398.151) (-2406.837) -- 0:04:40 200000 -- (-2403.559) (-2406.507) [-2405.814] (-2402.454) * (-2400.271) (-2409.275) (-2404.102) [-2406.949] -- 0:04:44 Average standard deviation of split frequencies: 0.016914 200500 -- (-2400.328) (-2409.961) [-2406.074] (-2404.744) * (-2409.448) [-2403.551] (-2406.445) (-2413.285) -- 0:04:43 201000 -- (-2403.600) (-2401.314) (-2407.992) [-2399.202] * [-2401.230] (-2403.731) (-2403.946) (-2416.256) -- 0:04:42 201500 -- (-2409.865) (-2414.138) [-2400.538] (-2399.758) * [-2402.560] (-2402.453) (-2409.468) (-2407.249) -- 0:04:41 202000 -- (-2400.406) [-2405.534] (-2409.991) (-2401.384) * [-2398.185] (-2400.967) (-2407.543) (-2409.509) -- 0:04:40 202500 -- (-2407.882) (-2408.221) [-2402.161] (-2402.426) * (-2404.814) [-2400.738] (-2407.790) (-2408.178) -- 0:04:39 203000 -- (-2404.721) (-2407.071) [-2405.164] (-2403.228) * (-2408.051) [-2398.455] (-2400.590) (-2399.117) -- 0:04:42 203500 -- (-2411.096) (-2410.890) (-2409.651) [-2401.422] * (-2404.214) [-2400.243] (-2398.511) (-2400.730) -- 0:04:41 204000 -- (-2403.452) (-2402.276) (-2403.866) [-2402.754] * (-2403.124) (-2401.108) [-2406.258] (-2399.824) -- 0:04:40 204500 -- [-2402.890] (-2405.528) (-2404.859) (-2403.817) * (-2400.323) [-2397.438] (-2405.971) (-2404.543) -- 0:04:40 205000 -- (-2416.409) [-2399.051] (-2402.528) (-2403.618) * (-2402.829) (-2406.019) [-2398.899] (-2413.021) -- 0:04:39 Average standard deviation of split frequencies: 0.014646 205500 -- (-2401.917) [-2403.679] (-2409.152) (-2403.949) * (-2409.788) (-2401.679) (-2402.073) [-2400.665] -- 0:04:42 206000 -- (-2401.822) (-2401.849) [-2402.973] (-2415.547) * (-2412.152) (-2404.052) [-2400.390] (-2406.399) -- 0:04:41 206500 -- (-2404.145) [-2408.632] (-2400.852) (-2404.971) * (-2403.175) (-2400.616) (-2405.368) [-2403.348] -- 0:04:40 207000 -- (-2419.378) [-2401.390] (-2398.100) (-2402.062) * (-2401.564) (-2400.180) [-2407.359] (-2404.322) -- 0:04:39 207500 -- (-2398.635) (-2400.194) (-2406.136) [-2405.063] * (-2411.920) (-2406.722) (-2411.603) [-2407.326] -- 0:04:38 208000 -- (-2403.095) (-2402.491) [-2402.594] (-2416.564) * (-2412.787) (-2405.061) (-2403.639) [-2403.338] -- 0:04:37 208500 -- (-2403.562) (-2412.697) (-2409.421) [-2407.194] * (-2410.756) (-2404.126) [-2398.493] (-2409.063) -- 0:04:40 209000 -- (-2405.183) (-2402.308) [-2403.462] (-2402.234) * (-2402.720) (-2401.953) [-2406.449] (-2408.615) -- 0:04:40 209500 -- [-2404.505] (-2404.506) (-2400.625) (-2400.967) * [-2397.658] (-2400.039) (-2399.953) (-2403.319) -- 0:04:39 210000 -- (-2403.990) (-2407.236) [-2408.633] (-2416.647) * (-2405.402) [-2405.605] (-2399.918) (-2410.148) -- 0:04:38 Average standard deviation of split frequencies: 0.015216 210500 -- (-2413.689) (-2410.114) (-2409.128) [-2410.041] * (-2408.634) (-2398.557) [-2398.045] (-2406.887) -- 0:04:37 211000 -- (-2401.027) (-2399.444) [-2400.736] (-2405.870) * (-2411.040) (-2401.237) (-2399.792) [-2402.994] -- 0:04:36 211500 -- (-2399.746) (-2398.210) (-2394.916) [-2404.580] * (-2403.566) (-2411.394) [-2401.758] (-2401.163) -- 0:04:39 212000 -- (-2408.276) (-2395.942) [-2400.465] (-2403.917) * (-2409.620) (-2406.072) [-2402.533] (-2406.667) -- 0:04:38 212500 -- (-2400.511) (-2405.534) (-2399.573) [-2394.353] * [-2412.916] (-2403.706) (-2401.889) (-2402.874) -- 0:04:37 213000 -- (-2405.287) (-2402.682) (-2405.570) [-2403.699] * [-2404.743] (-2407.035) (-2401.052) (-2401.901) -- 0:04:37 213500 -- (-2399.674) [-2401.992] (-2401.471) (-2403.736) * (-2402.707) (-2412.093) (-2404.775) [-2403.490] -- 0:04:36 214000 -- (-2401.517) [-2402.701] (-2403.643) (-2406.958) * (-2405.927) (-2414.258) (-2406.970) [-2396.482] -- 0:04:39 214500 -- [-2402.783] (-2407.235) (-2405.975) (-2400.964) * [-2410.878] (-2408.279) (-2402.997) (-2405.567) -- 0:04:38 215000 -- (-2397.931) (-2412.577) (-2399.365) [-2401.051] * (-2403.721) [-2403.631] (-2400.965) (-2403.321) -- 0:04:37 Average standard deviation of split frequencies: 0.016586 215500 -- (-2406.889) (-2402.579) (-2406.865) [-2406.264] * (-2397.056) (-2404.198) (-2410.912) [-2399.113] -- 0:04:36 216000 -- (-2398.051) (-2410.212) [-2401.668] (-2399.700) * (-2402.399) (-2403.102) (-2400.584) [-2404.066] -- 0:04:35 216500 -- (-2397.615) (-2403.192) (-2401.227) [-2402.478] * (-2402.820) (-2407.167) [-2405.212] (-2403.888) -- 0:04:35 217000 -- (-2404.762) [-2399.879] (-2403.827) (-2400.739) * (-2404.490) (-2403.503) (-2402.518) [-2399.984] -- 0:04:37 217500 -- (-2407.883) (-2411.488) (-2404.933) [-2402.101] * (-2411.123) (-2404.758) (-2404.651) [-2402.424] -- 0:04:37 218000 -- [-2399.711] (-2407.871) (-2400.882) (-2413.440) * (-2410.911) [-2403.840] (-2408.279) (-2407.030) -- 0:04:36 218500 -- (-2413.066) [-2401.572] (-2399.556) (-2404.384) * (-2415.463) [-2400.917] (-2403.272) (-2407.180) -- 0:04:35 219000 -- (-2400.098) (-2408.463) (-2410.203) [-2396.845] * (-2412.331) (-2399.629) (-2413.184) [-2408.883] -- 0:04:34 219500 -- (-2402.836) [-2400.677] (-2407.892) (-2397.905) * (-2407.275) (-2405.780) (-2405.724) [-2403.018] -- 0:04:33 220000 -- (-2400.826) [-2398.069] (-2397.267) (-2400.978) * (-2405.764) [-2406.330] (-2404.722) (-2401.991) -- 0:04:36 Average standard deviation of split frequencies: 0.018799 220500 -- (-2405.348) (-2402.292) [-2399.778] (-2398.990) * (-2404.040) (-2411.843) (-2413.456) [-2404.194] -- 0:04:35 221000 -- (-2412.155) (-2398.665) [-2402.700] (-2400.302) * (-2398.057) (-2402.514) [-2411.985] (-2405.772) -- 0:04:34 221500 -- [-2400.780] (-2400.991) (-2406.169) (-2409.363) * (-2409.410) (-2402.560) (-2410.871) [-2403.120] -- 0:04:34 222000 -- (-2401.093) [-2408.729] (-2403.580) (-2400.938) * (-2400.044) (-2402.169) (-2410.210) [-2404.382] -- 0:04:33 222500 -- [-2403.008] (-2402.899) (-2408.010) (-2408.332) * (-2411.817) (-2400.794) (-2400.574) [-2410.842] -- 0:04:36 223000 -- (-2404.396) (-2404.276) (-2403.446) [-2403.134] * (-2403.807) (-2400.531) (-2403.939) [-2407.877] -- 0:04:35 223500 -- (-2404.676) (-2404.705) (-2400.514) [-2400.826] * (-2401.866) (-2405.768) [-2402.392] (-2415.750) -- 0:04:34 224000 -- (-2402.530) (-2403.031) (-2401.985) [-2406.405] * [-2400.616] (-2414.874) (-2407.028) (-2400.673) -- 0:04:33 224500 -- (-2403.736) [-2402.009] (-2407.157) (-2408.079) * [-2403.424] (-2401.232) (-2402.355) (-2399.810) -- 0:04:32 225000 -- (-2404.758) (-2399.738) [-2406.969] (-2402.412) * [-2407.511] (-2400.566) (-2404.075) (-2409.254) -- 0:04:32 Average standard deviation of split frequencies: 0.020024 225500 -- (-2403.541) (-2408.918) (-2405.041) [-2399.378] * (-2409.413) (-2405.827) [-2411.001] (-2406.682) -- 0:04:34 226000 -- [-2402.020] (-2405.841) (-2407.387) (-2404.573) * (-2410.005) [-2398.627] (-2402.977) (-2403.355) -- 0:04:33 226500 -- (-2409.743) (-2404.663) (-2401.710) [-2401.685] * (-2419.413) [-2410.194] (-2398.928) (-2399.522) -- 0:04:33 227000 -- (-2407.074) (-2402.215) [-2401.484] (-2405.545) * [-2402.127] (-2408.686) (-2409.698) (-2404.299) -- 0:04:32 227500 -- [-2395.301] (-2401.537) (-2406.170) (-2402.962) * (-2403.796) [-2405.622] (-2402.337) (-2404.749) -- 0:04:31 228000 -- (-2403.310) [-2405.525] (-2404.611) (-2405.797) * (-2400.074) (-2405.504) (-2408.869) [-2394.893] -- 0:04:30 228500 -- (-2402.209) (-2405.837) (-2404.627) [-2409.457] * (-2403.217) (-2413.378) [-2402.267] (-2407.313) -- 0:04:33 229000 -- (-2402.952) (-2403.103) [-2408.010] (-2403.390) * [-2400.097] (-2411.006) (-2408.086) (-2405.057) -- 0:04:32 229500 -- [-2401.014] (-2408.827) (-2416.631) (-2403.613) * (-2397.467) (-2414.481) (-2404.733) [-2400.880] -- 0:04:31 230000 -- (-2405.450) [-2406.258] (-2407.833) (-2403.539) * (-2399.678) (-2413.277) (-2406.326) [-2405.135] -- 0:04:31 Average standard deviation of split frequencies: 0.014714 230500 -- [-2401.058] (-2408.244) (-2405.329) (-2403.071) * (-2404.300) [-2402.046] (-2405.913) (-2403.513) -- 0:04:30 231000 -- (-2404.578) [-2402.885] (-2400.162) (-2407.011) * (-2409.194) [-2401.571] (-2411.255) (-2409.077) -- 0:04:29 231500 -- (-2404.517) (-2399.777) (-2402.717) [-2408.940] * [-2401.695] (-2399.759) (-2409.114) (-2399.001) -- 0:04:32 232000 -- (-2415.771) (-2407.156) (-2404.923) [-2399.681] * (-2403.391) [-2404.967] (-2409.098) (-2402.898) -- 0:04:31 232500 -- [-2400.974] (-2404.305) (-2397.861) (-2402.196) * (-2407.580) (-2405.337) (-2408.645) [-2400.725] -- 0:04:30 233000 -- [-2407.022] (-2412.274) (-2399.178) (-2395.200) * (-2413.551) [-2400.463] (-2414.024) (-2397.520) -- 0:04:29 233500 -- [-2405.090] (-2406.043) (-2403.072) (-2408.985) * (-2413.475) (-2405.354) (-2408.767) [-2405.246] -- 0:04:29 234000 -- (-2403.667) (-2401.045) (-2403.006) [-2404.678] * (-2412.956) (-2401.281) (-2404.579) [-2398.360] -- 0:04:31 234500 -- (-2409.249) (-2406.879) (-2407.006) [-2407.019] * (-2409.361) (-2406.496) [-2410.008] (-2400.254) -- 0:04:30 235000 -- (-2398.938) (-2411.306) (-2400.126) [-2402.524] * [-2407.171] (-2399.437) (-2399.167) (-2410.179) -- 0:04:30 Average standard deviation of split frequencies: 0.011186 235500 -- (-2405.829) (-2403.470) (-2405.093) [-2401.261] * (-2412.152) [-2397.957] (-2398.094) (-2400.345) -- 0:04:29 236000 -- (-2402.083) (-2402.768) [-2404.166] (-2412.170) * (-2407.004) (-2393.400) [-2399.762] (-2403.333) -- 0:04:28 236500 -- (-2401.175) (-2400.023) (-2407.471) [-2406.163] * (-2404.492) (-2408.725) [-2409.344] (-2403.611) -- 0:04:27 237000 -- [-2399.697] (-2404.965) (-2405.662) (-2408.514) * (-2401.425) [-2406.936] (-2407.054) (-2406.832) -- 0:04:30 237500 -- (-2399.669) (-2404.443) (-2404.480) [-2402.446] * [-2402.524] (-2405.969) (-2407.947) (-2406.758) -- 0:04:29 238000 -- [-2404.183] (-2403.468) (-2405.526) (-2404.550) * (-2399.760) (-2401.438) (-2401.652) [-2399.464] -- 0:04:28 238500 -- [-2406.712] (-2402.615) (-2412.881) (-2401.092) * (-2407.175) (-2404.918) [-2402.481] (-2404.766) -- 0:04:28 239000 -- [-2411.988] (-2409.776) (-2404.844) (-2402.372) * (-2409.392) (-2400.508) [-2403.297] (-2404.995) -- 0:04:27 239500 -- (-2400.827) (-2404.465) (-2406.384) [-2400.985] * (-2398.202) [-2399.016] (-2402.790) (-2404.607) -- 0:04:26 240000 -- (-2404.111) (-2401.509) (-2408.818) [-2405.193] * (-2408.737) (-2400.740) [-2402.245] (-2408.793) -- 0:04:29 Average standard deviation of split frequencies: 0.008618 240500 -- (-2400.591) (-2403.452) (-2412.585) [-2403.471] * (-2397.479) [-2400.582] (-2407.938) (-2403.235) -- 0:04:28 241000 -- [-2402.543] (-2402.468) (-2414.031) (-2411.133) * (-2406.184) [-2412.734] (-2399.737) (-2398.420) -- 0:04:27 241500 -- [-2404.279] (-2413.779) (-2400.904) (-2405.761) * (-2403.246) (-2405.243) [-2402.399] (-2413.218) -- 0:04:26 242000 -- (-2404.747) (-2398.915) (-2406.831) [-2400.018] * (-2401.233) [-2403.964] (-2400.879) (-2407.868) -- 0:04:29 242500 -- (-2408.115) (-2400.180) [-2404.510] (-2400.372) * (-2398.555) (-2414.969) [-2402.759] (-2406.445) -- 0:04:28 243000 -- (-2406.690) (-2398.641) (-2403.989) [-2406.147] * (-2404.459) (-2404.458) [-2401.976] (-2402.514) -- 0:04:27 243500 -- (-2417.566) (-2403.573) (-2407.402) [-2400.322] * (-2397.748) (-2408.560) (-2401.872) [-2405.843] -- 0:04:27 244000 -- [-2398.179] (-2407.104) (-2407.456) (-2401.135) * (-2403.546) (-2404.223) [-2399.230] (-2403.907) -- 0:04:26 244500 -- [-2403.520] (-2403.195) (-2410.674) (-2403.730) * (-2406.982) (-2414.407) (-2407.259) [-2402.777] -- 0:04:28 245000 -- (-2398.917) [-2407.638] (-2405.027) (-2399.875) * (-2404.495) (-2417.958) (-2403.131) [-2401.572] -- 0:04:28 Average standard deviation of split frequencies: 0.006899 245500 -- (-2406.521) [-2409.393] (-2411.173) (-2399.640) * (-2403.154) (-2407.820) [-2400.024] (-2401.271) -- 0:04:27 246000 -- [-2401.173] (-2406.120) (-2405.087) (-2400.626) * (-2399.927) (-2411.795) [-2398.549] (-2403.772) -- 0:04:26 246500 -- [-2398.843] (-2405.594) (-2399.016) (-2406.072) * (-2403.261) (-2407.455) (-2400.304) [-2401.899] -- 0:04:25 247000 -- (-2400.214) (-2397.603) (-2400.740) [-2404.913] * (-2407.999) [-2408.592] (-2399.109) (-2403.129) -- 0:04:25 247500 -- (-2398.012) (-2408.371) [-2399.226] (-2403.380) * (-2407.752) (-2409.267) (-2406.460) [-2403.752] -- 0:04:27 248000 -- [-2404.639] (-2406.597) (-2403.526) (-2413.525) * [-2403.563] (-2409.635) (-2402.952) (-2406.934) -- 0:04:26 248500 -- (-2407.104) (-2404.042) [-2400.824] (-2409.497) * (-2408.258) (-2407.212) (-2402.422) [-2400.701] -- 0:04:26 249000 -- (-2403.611) [-2405.840] (-2401.391) (-2407.711) * (-2404.949) (-2407.725) (-2398.884) [-2406.002] -- 0:04:25 249500 -- [-2400.845] (-2401.759) (-2405.936) (-2407.392) * (-2411.408) (-2409.647) [-2402.285] (-2418.153) -- 0:04:24 250000 -- (-2404.078) [-2402.104] (-2410.141) (-2401.568) * (-2402.855) [-2399.438] (-2412.135) (-2406.419) -- 0:04:24 Average standard deviation of split frequencies: 0.004513 250500 -- (-2404.173) (-2409.050) [-2399.350] (-2401.835) * (-2403.177) [-2396.188] (-2406.557) (-2410.246) -- 0:04:26 251000 -- [-2402.216] (-2400.884) (-2404.254) (-2403.276) * (-2401.811) [-2402.999] (-2406.525) (-2402.843) -- 0:04:25 251500 -- (-2401.111) [-2403.692] (-2394.107) (-2406.176) * [-2405.733] (-2407.777) (-2400.649) (-2409.133) -- 0:04:24 252000 -- (-2402.946) [-2404.112] (-2403.084) (-2405.611) * (-2406.240) [-2401.460] (-2404.848) (-2415.705) -- 0:04:24 252500 -- [-2399.858] (-2408.750) (-2404.216) (-2402.548) * [-2402.257] (-2403.653) (-2398.596) (-2410.415) -- 0:04:23 253000 -- (-2403.666) [-2408.760] (-2408.629) (-2403.328) * (-2402.894) (-2403.815) (-2398.851) [-2410.148] -- 0:04:22 253500 -- (-2397.477) [-2407.628] (-2409.971) (-2404.311) * (-2407.497) (-2415.513) [-2405.012] (-2406.364) -- 0:04:25 254000 -- (-2400.423) (-2410.577) (-2403.507) [-2403.703] * (-2403.651) (-2405.743) (-2398.433) [-2398.133] -- 0:04:24 254500 -- [-2400.119] (-2408.357) (-2412.946) (-2401.007) * [-2401.453] (-2413.801) (-2404.492) (-2403.642) -- 0:04:23 255000 -- [-2400.217] (-2406.089) (-2411.368) (-2411.323) * (-2402.677) (-2419.842) (-2398.810) [-2402.577] -- 0:04:22 Average standard deviation of split frequencies: 0.005893 255500 -- [-2401.022] (-2397.603) (-2398.542) (-2414.980) * (-2398.833) (-2401.086) (-2405.350) [-2401.474] -- 0:04:22 256000 -- (-2399.952) (-2407.902) [-2398.335] (-2405.595) * [-2404.586] (-2405.773) (-2404.404) (-2397.932) -- 0:04:21 256500 -- (-2413.343) [-2399.756] (-2400.944) (-2397.878) * (-2403.925) (-2399.651) (-2396.778) [-2405.342] -- 0:04:23 257000 -- [-2398.374] (-2398.933) (-2409.722) (-2413.040) * [-2404.622] (-2401.811) (-2405.589) (-2404.980) -- 0:04:23 257500 -- (-2402.989) (-2402.162) [-2404.260] (-2399.896) * [-2405.268] (-2397.919) (-2410.525) (-2414.090) -- 0:04:22 258000 -- (-2407.161) (-2400.380) (-2408.826) [-2401.300] * (-2407.282) (-2398.879) [-2398.905] (-2412.884) -- 0:04:21 258500 -- (-2402.284) (-2403.316) [-2402.960] (-2405.061) * (-2404.513) (-2408.830) [-2403.065] (-2405.757) -- 0:04:21 259000 -- (-2406.799) (-2405.617) [-2403.045] (-2406.584) * (-2407.827) (-2401.859) (-2400.641) [-2405.920] -- 0:04:23 259500 -- (-2402.343) (-2409.239) [-2401.647] (-2403.607) * (-2404.853) (-2400.686) [-2405.513] (-2408.542) -- 0:04:22 260000 -- (-2404.645) [-2401.978] (-2407.453) (-2402.351) * [-2411.667] (-2412.810) (-2407.433) (-2403.524) -- 0:04:21 Average standard deviation of split frequencies: 0.008681 260500 -- (-2411.286) [-2402.471] (-2406.707) (-2399.969) * (-2402.902) (-2402.516) [-2401.217] (-2411.740) -- 0:04:21 261000 -- (-2406.963) (-2407.845) [-2407.569] (-2400.887) * (-2409.690) (-2399.819) [-2403.359] (-2419.700) -- 0:04:20 261500 -- (-2404.296) (-2407.830) [-2403.841] (-2409.836) * (-2406.214) (-2398.271) [-2405.625] (-2404.179) -- 0:04:19 262000 -- (-2414.700) (-2404.262) [-2408.597] (-2405.147) * (-2405.688) (-2402.463) (-2407.408) [-2408.391] -- 0:04:21 262500 -- (-2408.407) [-2400.349] (-2404.611) (-2406.144) * (-2409.387) (-2413.452) (-2399.591) [-2401.797] -- 0:04:21 263000 -- [-2401.758] (-2400.744) (-2405.883) (-2411.885) * [-2408.282] (-2411.790) (-2406.811) (-2408.600) -- 0:04:20 263500 -- [-2401.629] (-2400.709) (-2399.413) (-2411.374) * [-2404.437] (-2410.757) (-2403.510) (-2405.864) -- 0:04:19 264000 -- [-2401.454] (-2403.710) (-2403.605) (-2405.387) * (-2401.864) (-2409.655) (-2398.433) [-2402.039] -- 0:04:19 264500 -- [-2403.058] (-2407.023) (-2412.615) (-2408.498) * (-2403.087) [-2403.173] (-2410.494) (-2402.604) -- 0:04:18 265000 -- (-2402.406) (-2408.311) [-2405.022] (-2409.041) * (-2404.244) [-2399.744] (-2402.573) (-2401.700) -- 0:04:20 Average standard deviation of split frequencies: 0.010633 265500 -- (-2401.799) [-2410.396] (-2399.453) (-2413.353) * (-2404.158) (-2403.155) [-2409.684] (-2408.927) -- 0:04:20 266000 -- (-2405.297) (-2409.039) [-2404.288] (-2409.356) * (-2407.746) [-2402.850] (-2407.537) (-2416.609) -- 0:04:19 266500 -- (-2402.527) (-2407.146) [-2410.715] (-2415.169) * (-2402.515) [-2399.129] (-2403.472) (-2403.710) -- 0:04:18 267000 -- (-2407.066) (-2403.530) (-2406.743) [-2403.195] * (-2406.533) (-2408.986) [-2401.467] (-2399.430) -- 0:04:18 267500 -- (-2400.603) (-2405.606) (-2408.414) [-2404.638] * (-2408.791) [-2401.759] (-2402.544) (-2402.572) -- 0:04:17 268000 -- (-2398.608) [-2402.151] (-2402.187) (-2404.203) * (-2403.739) (-2406.175) [-2400.286] (-2400.435) -- 0:04:19 268500 -- (-2414.137) (-2408.773) [-2406.489] (-2402.900) * (-2407.502) [-2400.088] (-2403.774) (-2403.287) -- 0:04:18 269000 -- (-2407.481) (-2403.727) (-2402.318) [-2410.205] * [-2405.642] (-2400.342) (-2399.785) (-2407.855) -- 0:04:18 269500 -- [-2403.511] (-2407.339) (-2401.577) (-2417.166) * (-2401.918) [-2402.117] (-2403.533) (-2395.456) -- 0:04:17 270000 -- (-2403.845) (-2405.702) [-2408.552] (-2412.237) * [-2401.231] (-2397.224) (-2400.981) (-2408.511) -- 0:04:16 Average standard deviation of split frequencies: 0.009753 270500 -- (-2402.941) (-2403.742) [-2402.358] (-2407.495) * [-2404.582] (-2409.832) (-2401.604) (-2412.843) -- 0:04:18 271000 -- (-2400.721) (-2400.224) [-2403.395] (-2408.679) * (-2402.395) (-2401.549) (-2397.765) [-2405.754] -- 0:04:18 271500 -- [-2404.884] (-2405.531) (-2406.205) (-2404.779) * (-2404.272) (-2402.351) (-2404.869) [-2399.403] -- 0:04:17 272000 -- (-2401.510) (-2410.709) (-2402.045) [-2404.031] * (-2404.088) (-2407.848) [-2401.222] (-2402.593) -- 0:04:16 272500 -- [-2407.938] (-2406.789) (-2407.542) (-2401.292) * [-2406.901] (-2403.629) (-2410.505) (-2403.797) -- 0:04:16 273000 -- (-2411.314) (-2399.540) (-2410.737) [-2404.835] * [-2407.571] (-2408.645) (-2404.608) (-2409.391) -- 0:04:15 273500 -- (-2402.015) (-2402.608) [-2397.979] (-2405.302) * (-2405.802) [-2404.703] (-2406.431) (-2404.498) -- 0:04:17 274000 -- (-2407.587) [-2397.606] (-2402.997) (-2413.903) * (-2404.528) (-2410.606) [-2399.856] (-2401.041) -- 0:04:17 274500 -- (-2401.503) (-2399.619) (-2412.135) [-2404.705] * (-2403.686) [-2404.393] (-2400.420) (-2410.539) -- 0:04:16 275000 -- (-2398.317) [-2397.039] (-2400.267) (-2402.993) * (-2403.057) (-2400.651) (-2401.626) [-2395.061] -- 0:04:15 Average standard deviation of split frequencies: 0.009906 275500 -- (-2401.530) [-2409.497] (-2400.502) (-2402.161) * (-2400.620) (-2402.022) [-2404.528] (-2407.091) -- 0:04:15 276000 -- (-2401.179) [-2409.249] (-2401.369) (-2407.757) * [-2398.612] (-2401.436) (-2402.480) (-2401.492) -- 0:04:14 276500 -- (-2402.298) (-2405.453) [-2405.513] (-2404.606) * (-2404.714) [-2404.355] (-2401.912) (-2411.675) -- 0:04:16 277000 -- (-2402.284) (-2400.049) (-2406.142) [-2402.927] * (-2403.386) (-2399.232) (-2409.966) [-2402.602] -- 0:04:15 277500 -- [-2402.794] (-2398.432) (-2400.774) (-2396.939) * (-2407.318) (-2401.908) (-2408.279) [-2400.805] -- 0:04:15 278000 -- (-2407.129) (-2405.660) [-2402.463] (-2398.580) * (-2398.136) (-2401.826) [-2410.057] (-2405.188) -- 0:04:14 278500 -- (-2405.076) [-2402.721] (-2406.811) (-2402.935) * (-2403.477) (-2410.170) (-2403.921) [-2398.750] -- 0:04:13 279000 -- (-2398.046) (-2401.115) [-2401.158] (-2404.360) * [-2398.982] (-2411.482) (-2409.752) (-2400.339) -- 0:04:13 279500 -- (-2399.922) [-2402.813] (-2399.553) (-2401.188) * (-2398.449) (-2405.945) (-2403.219) [-2399.108] -- 0:04:15 280000 -- (-2411.157) (-2407.948) [-2404.239] (-2395.479) * (-2408.044) (-2400.658) (-2418.462) [-2400.416] -- 0:04:14 Average standard deviation of split frequencies: 0.009742 280500 -- (-2401.954) [-2402.383] (-2405.900) (-2401.865) * (-2403.583) [-2399.660] (-2410.086) (-2407.390) -- 0:04:13 281000 -- (-2409.799) (-2403.202) (-2413.085) [-2401.527] * [-2399.375] (-2402.266) (-2403.043) (-2404.044) -- 0:04:13 281500 -- (-2404.371) (-2398.403) [-2402.229] (-2408.537) * (-2399.862) (-2402.521) [-2403.692] (-2405.177) -- 0:04:12 282000 -- (-2401.141) (-2402.278) [-2409.014] (-2407.674) * (-2401.907) (-2401.772) [-2398.910] (-2411.022) -- 0:04:14 282500 -- (-2409.449) (-2405.826) [-2405.543] (-2411.616) * (-2403.695) (-2406.856) (-2406.389) [-2400.192] -- 0:04:13 283000 -- (-2411.517) [-2401.142] (-2411.091) (-2418.156) * (-2412.009) [-2403.115] (-2399.373) (-2408.594) -- 0:04:13 283500 -- [-2397.767] (-2402.284) (-2404.286) (-2403.939) * (-2402.617) (-2402.525) [-2401.143] (-2405.660) -- 0:04:12 284000 -- [-2399.665] (-2401.853) (-2410.052) (-2405.234) * (-2404.501) (-2404.243) (-2400.755) [-2408.673] -- 0:04:12 284500 -- [-2401.064] (-2408.968) (-2406.478) (-2405.044) * (-2399.406) (-2398.321) [-2403.629] (-2404.246) -- 0:04:11 285000 -- (-2406.420) [-2395.804] (-2404.850) (-2402.284) * (-2405.384) [-2400.021] (-2403.322) (-2410.392) -- 0:04:13 Average standard deviation of split frequencies: 0.012197 285500 -- [-2402.454] (-2401.836) (-2402.125) (-2402.556) * (-2401.086) [-2405.898] (-2402.280) (-2407.657) -- 0:04:12 286000 -- (-2404.556) (-2404.517) [-2404.696] (-2404.111) * (-2401.218) (-2407.282) (-2404.869) [-2405.323] -- 0:04:12 286500 -- (-2403.467) (-2401.993) [-2400.482] (-2401.077) * (-2408.295) [-2411.369] (-2408.957) (-2412.377) -- 0:04:11 287000 -- (-2399.343) (-2407.670) (-2398.067) [-2402.021] * [-2407.721] (-2402.869) (-2402.466) (-2404.107) -- 0:04:10 287500 -- [-2394.976] (-2408.977) (-2403.685) (-2407.007) * [-2409.788] (-2402.427) (-2406.358) (-2415.768) -- 0:04:10 288000 -- [-2407.772] (-2412.797) (-2405.539) (-2406.233) * [-2404.064] (-2404.668) (-2403.692) (-2403.837) -- 0:04:12 288500 -- (-2398.746) (-2413.082) [-2398.792] (-2402.731) * (-2401.624) (-2400.542) [-2398.125] (-2402.924) -- 0:04:11 289000 -- [-2396.280] (-2403.315) (-2403.412) (-2406.978) * (-2404.878) (-2412.607) (-2400.373) [-2408.516] -- 0:04:10 289500 -- [-2404.898] (-2404.432) (-2407.433) (-2400.656) * [-2398.416] (-2406.240) (-2398.503) (-2402.937) -- 0:04:10 290000 -- [-2400.431] (-2413.692) (-2411.581) (-2402.834) * [-2403.320] (-2406.142) (-2405.084) (-2403.467) -- 0:04:09 Average standard deviation of split frequencies: 0.010055 290500 -- (-2408.756) (-2408.969) [-2402.106] (-2395.832) * (-2403.059) (-2398.151) (-2398.839) [-2412.310] -- 0:04:09 291000 -- (-2409.433) (-2397.547) (-2402.482) [-2401.957] * (-2401.438) (-2403.567) [-2400.424] (-2402.916) -- 0:04:10 291500 -- (-2406.941) (-2403.559) (-2405.279) [-2410.393] * (-2404.778) [-2395.965] (-2405.476) (-2403.645) -- 0:04:10 292000 -- (-2407.417) [-2403.387] (-2397.328) (-2407.832) * (-2409.099) (-2398.188) [-2402.378] (-2402.344) -- 0:04:09 292500 -- (-2403.704) (-2407.640) [-2406.341] (-2409.131) * (-2422.666) (-2399.987) (-2401.684) [-2401.178] -- 0:04:09 293000 -- [-2398.256] (-2407.415) (-2401.062) (-2401.188) * (-2402.326) [-2401.173] (-2406.203) (-2401.939) -- 0:04:08 293500 -- (-2405.456) (-2404.490) [-2396.690] (-2404.536) * [-2397.382] (-2398.209) (-2414.244) (-2407.761) -- 0:04:07 294000 -- (-2403.925) [-2400.408] (-2401.552) (-2406.929) * [-2402.812] (-2406.211) (-2402.657) (-2402.251) -- 0:04:09 294500 -- (-2403.661) (-2403.092) (-2400.071) [-2399.906] * (-2405.666) [-2405.323] (-2408.444) (-2406.942) -- 0:04:09 295000 -- (-2400.533) (-2408.239) [-2400.011] (-2399.314) * [-2411.404] (-2409.702) (-2409.405) (-2409.039) -- 0:04:08 Average standard deviation of split frequencies: 0.009874 295500 -- (-2401.316) (-2402.868) (-2402.515) [-2401.525] * (-2416.279) (-2406.764) (-2405.858) [-2402.387] -- 0:04:07 296000 -- (-2410.045) (-2403.365) [-2401.493] (-2411.051) * (-2406.964) (-2408.108) [-2402.922] (-2402.345) -- 0:04:07 296500 -- [-2399.669] (-2408.472) (-2399.974) (-2408.884) * (-2404.477) (-2408.871) (-2404.869) [-2405.300] -- 0:04:09 297000 -- (-2399.152) (-2400.976) [-2401.518] (-2402.131) * (-2404.180) [-2405.731] (-2406.192) (-2401.447) -- 0:04:08 297500 -- (-2407.953) (-2406.145) (-2403.698) [-2400.086] * (-2414.196) (-2401.579) [-2404.014] (-2405.717) -- 0:04:07 298000 -- (-2414.484) (-2396.523) (-2409.449) [-2398.072] * (-2404.195) [-2403.474] (-2400.684) (-2416.258) -- 0:04:07 298500 -- (-2408.445) [-2394.667] (-2404.765) (-2406.031) * (-2405.754) (-2405.344) (-2404.902) [-2403.525] -- 0:04:06 299000 -- (-2404.730) [-2400.996] (-2406.605) (-2402.458) * (-2407.867) (-2399.327) (-2404.483) [-2400.749] -- 0:04:06 299500 -- (-2401.855) (-2402.402) [-2401.011] (-2408.249) * (-2402.193) (-2407.251) (-2400.730) [-2404.444] -- 0:04:07 300000 -- [-2402.924] (-2398.148) (-2406.357) (-2407.761) * (-2398.464) (-2397.083) [-2403.179] (-2408.417) -- 0:04:07 Average standard deviation of split frequencies: 0.008466 300500 -- (-2402.752) (-2410.700) [-2400.546] (-2399.902) * [-2408.587] (-2408.819) (-2403.456) (-2407.659) -- 0:04:06 301000 -- (-2408.624) (-2408.516) [-2400.722] (-2398.775) * [-2406.901] (-2399.811) (-2402.292) (-2406.923) -- 0:04:06 301500 -- [-2399.760] (-2406.167) (-2401.182) (-2408.222) * (-2407.148) (-2403.218) [-2405.519] (-2411.142) -- 0:04:05 302000 -- (-2400.400) [-2415.854] (-2404.119) (-2411.258) * [-2403.755] (-2415.121) (-2406.954) (-2404.524) -- 0:04:04 302500 -- (-2405.286) (-2403.736) [-2403.814] (-2397.659) * (-2399.260) (-2400.760) (-2414.709) [-2399.544] -- 0:04:06 303000 -- (-2405.222) (-2407.343) (-2403.483) [-2401.140] * (-2398.436) (-2400.908) [-2404.808] (-2403.901) -- 0:04:06 303500 -- (-2399.324) (-2398.015) [-2407.890] (-2405.209) * (-2403.128) [-2407.060] (-2407.782) (-2406.069) -- 0:04:05 304000 -- (-2407.192) [-2396.212] (-2399.847) (-2403.725) * (-2400.724) (-2412.854) (-2402.059) [-2399.095] -- 0:04:04 304500 -- (-2415.681) [-2403.569] (-2405.735) (-2402.753) * (-2407.842) (-2400.503) (-2410.046) [-2401.940] -- 0:04:04 305000 -- (-2402.178) (-2403.816) (-2409.870) [-2400.550] * (-2411.121) (-2404.227) [-2400.847] (-2404.456) -- 0:04:03 Average standard deviation of split frequencies: 0.008935 305500 -- (-2411.654) (-2410.576) (-2408.347) [-2402.015] * [-2398.366] (-2413.652) (-2403.637) (-2400.382) -- 0:04:05 306000 -- [-2403.142] (-2410.322) (-2413.439) (-2404.794) * (-2406.783) [-2399.697] (-2410.783) (-2406.434) -- 0:04:04 306500 -- (-2405.398) (-2406.491) (-2401.613) [-2402.168] * (-2407.616) (-2408.372) [-2407.848] (-2405.207) -- 0:04:04 307000 -- [-2409.679] (-2402.707) (-2407.194) (-2400.474) * (-2400.785) (-2411.179) [-2403.697] (-2406.950) -- 0:04:03 307500 -- (-2403.618) [-2407.301] (-2413.421) (-2408.008) * [-2410.068] (-2401.144) (-2403.322) (-2405.717) -- 0:04:03 308000 -- [-2400.316] (-2405.537) (-2402.366) (-2400.836) * (-2412.259) (-2403.427) [-2404.769] (-2404.188) -- 0:04:04 308500 -- (-2395.403) (-2406.750) [-2398.487] (-2412.173) * (-2402.674) [-2402.636] (-2409.684) (-2400.589) -- 0:04:04 309000 -- (-2406.286) (-2427.047) (-2400.370) [-2405.614] * (-2402.072) [-2401.723] (-2406.946) (-2406.479) -- 0:04:03 309500 -- (-2408.862) (-2404.101) (-2411.339) [-2403.627] * [-2401.640] (-2402.810) (-2407.423) (-2397.468) -- 0:04:03 310000 -- [-2400.313] (-2405.407) (-2407.767) (-2408.103) * (-2400.841) (-2407.766) (-2401.710) [-2404.653] -- 0:04:02 Average standard deviation of split frequencies: 0.009408 310500 -- [-2403.934] (-2414.543) (-2408.263) (-2401.028) * (-2398.803) (-2400.977) [-2400.618] (-2406.781) -- 0:04:02 311000 -- (-2405.577) (-2404.848) (-2409.964) [-2399.855] * (-2399.257) (-2404.024) (-2404.235) [-2403.281] -- 0:04:03 311500 -- (-2402.301) (-2411.719) (-2403.122) [-2402.683] * (-2402.471) [-2406.206] (-2401.834) (-2408.404) -- 0:04:03 312000 -- (-2407.147) [-2402.162] (-2405.746) (-2407.873) * (-2405.453) [-2404.194] (-2402.591) (-2408.326) -- 0:04:02 312500 -- (-2410.015) [-2402.140] (-2406.686) (-2407.374) * (-2406.043) (-2405.278) (-2413.358) [-2401.652] -- 0:04:02 313000 -- (-2405.449) (-2408.324) [-2410.217] (-2404.065) * (-2406.121) (-2408.424) (-2406.349) [-2402.918] -- 0:04:01 313500 -- (-2401.124) [-2399.791] (-2405.748) (-2408.244) * (-2405.064) (-2404.641) [-2398.756] (-2403.436) -- 0:04:00 314000 -- (-2398.782) [-2399.202] (-2410.491) (-2401.049) * [-2403.667] (-2399.838) (-2398.173) (-2405.417) -- 0:04:02 314500 -- [-2406.249] (-2403.487) (-2408.378) (-2401.487) * [-2404.835] (-2405.965) (-2406.945) (-2401.457) -- 0:04:01 315000 -- (-2407.922) (-2399.843) [-2406.652] (-2402.509) * (-2411.791) [-2399.643] (-2412.313) (-2403.221) -- 0:04:01 Average standard deviation of split frequencies: 0.007459 315500 -- (-2404.484) [-2397.039] (-2404.013) (-2407.056) * [-2404.323] (-2405.611) (-2402.546) (-2409.517) -- 0:04:00 316000 -- (-2411.508) [-2399.745] (-2408.195) (-2399.198) * (-2405.114) [-2400.341] (-2401.939) (-2398.552) -- 0:04:00 316500 -- [-2402.534] (-2400.772) (-2407.742) (-2405.412) * (-2410.205) (-2401.507) (-2405.764) [-2397.139] -- 0:03:59 317000 -- (-2411.922) [-2406.828] (-2406.877) (-2399.575) * (-2401.201) (-2403.465) [-2408.775] (-2404.258) -- 0:04:01 317500 -- (-2400.483) (-2395.986) (-2410.284) [-2404.322] * (-2399.429) (-2402.254) (-2409.814) [-2398.582] -- 0:04:00 318000 -- (-2404.893) (-2402.470) (-2411.286) [-2406.033] * [-2405.705] (-2399.115) (-2398.158) (-2402.998) -- 0:04:00 318500 -- (-2410.725) (-2408.375) [-2397.474] (-2397.406) * (-2405.975) [-2398.050] (-2407.029) (-2407.542) -- 0:03:59 319000 -- (-2407.537) (-2414.771) [-2403.973] (-2401.138) * [-2411.157] (-2402.992) (-2403.836) (-2403.280) -- 0:03:59 319500 -- (-2400.160) [-2408.327] (-2405.694) (-2403.544) * (-2407.317) [-2401.012] (-2403.336) (-2403.373) -- 0:04:00 320000 -- [-2400.693] (-2398.337) (-2410.335) (-2399.702) * [-2401.830] (-2404.212) (-2402.853) (-2407.683) -- 0:04:00 Average standard deviation of split frequencies: 0.009114 320500 -- [-2399.541] (-2409.142) (-2407.025) (-2403.585) * [-2404.174] (-2400.988) (-2402.051) (-2402.215) -- 0:03:59 321000 -- (-2401.519) (-2403.037) [-2404.362] (-2399.512) * (-2401.585) [-2405.459] (-2401.558) (-2401.262) -- 0:03:59 321500 -- (-2404.442) (-2409.504) [-2403.628] (-2407.912) * (-2400.412) (-2402.927) (-2405.500) [-2395.613] -- 0:03:58 322000 -- [-2408.328] (-2406.520) (-2402.145) (-2412.394) * (-2407.735) [-2401.157] (-2402.829) (-2399.918) -- 0:03:57 322500 -- (-2400.441) (-2400.429) (-2407.783) [-2400.294] * [-2396.660] (-2404.443) (-2398.804) (-2404.951) -- 0:03:59 323000 -- [-2400.748] (-2403.933) (-2404.327) (-2403.744) * (-2407.054) (-2409.231) [-2401.135] (-2404.539) -- 0:03:58 323500 -- (-2399.039) [-2408.619] (-2399.411) (-2402.467) * [-2400.751] (-2408.232) (-2403.894) (-2400.491) -- 0:03:58 324000 -- (-2405.596) [-2397.074] (-2407.104) (-2405.659) * [-2407.032] (-2402.268) (-2398.661) (-2407.636) -- 0:03:57 324500 -- (-2401.318) (-2405.524) (-2403.129) [-2406.709] * (-2399.904) (-2407.034) [-2400.112] (-2412.991) -- 0:03:57 325000 -- (-2405.370) (-2400.456) [-2404.714] (-2406.108) * [-2406.274] (-2413.120) (-2404.240) (-2414.046) -- 0:03:56 Average standard deviation of split frequencies: 0.009544 325500 -- (-2412.406) [-2400.438] (-2410.119) (-2405.551) * (-2408.327) (-2404.968) (-2402.471) [-2405.195] -- 0:03:58 326000 -- (-2408.741) (-2403.984) (-2396.912) [-2396.992] * (-2401.939) [-2401.023] (-2401.016) (-2400.949) -- 0:03:57 326500 -- (-2406.331) (-2400.394) [-2405.953] (-2403.815) * [-2400.924] (-2404.806) (-2397.251) (-2404.111) -- 0:03:57 327000 -- [-2405.025] (-2403.252) (-2399.956) (-2412.888) * (-2401.137) (-2407.617) (-2402.028) [-2393.924] -- 0:03:56 327500 -- (-2400.834) (-2409.535) (-2403.038) [-2399.196] * (-2400.336) (-2402.530) [-2403.597] (-2408.847) -- 0:03:56 328000 -- [-2400.614] (-2406.841) (-2409.311) (-2409.655) * (-2403.730) [-2398.561] (-2398.970) (-2405.741) -- 0:03:55 328500 -- (-2398.228) [-2403.904] (-2411.687) (-2398.766) * (-2407.200) (-2403.482) (-2410.988) [-2400.393] -- 0:03:57 329000 -- (-2405.336) [-2400.388] (-2409.326) (-2404.437) * (-2412.172) [-2405.560] (-2409.690) (-2407.197) -- 0:03:56 329500 -- (-2405.081) (-2405.733) [-2407.087] (-2406.325) * (-2404.174) [-2405.234] (-2414.062) (-2399.739) -- 0:03:56 330000 -- (-2403.741) (-2398.813) [-2402.562] (-2406.811) * (-2401.219) (-2404.647) (-2406.599) [-2403.017] -- 0:03:55 Average standard deviation of split frequencies: 0.011690 330500 -- (-2401.024) [-2397.300] (-2404.007) (-2409.696) * [-2399.389] (-2411.858) (-2405.100) (-2405.980) -- 0:03:54 331000 -- [-2404.277] (-2411.938) (-2410.206) (-2400.798) * (-2406.408) (-2396.279) (-2401.405) [-2399.818] -- 0:03:56 331500 -- [-2404.818] (-2414.065) (-2409.512) (-2409.853) * (-2402.260) [-2400.445] (-2406.058) (-2400.100) -- 0:03:55 332000 -- (-2398.966) [-2405.873] (-2411.159) (-2406.819) * (-2402.647) [-2399.548] (-2400.357) (-2405.333) -- 0:03:55 332500 -- (-2403.339) (-2406.695) [-2412.305] (-2410.247) * [-2403.647] (-2404.125) (-2401.071) (-2409.178) -- 0:03:54 333000 -- (-2399.077) [-2402.061] (-2405.197) (-2403.593) * (-2404.182) (-2401.987) [-2406.564] (-2404.609) -- 0:03:54 333500 -- (-2407.083) [-2404.911] (-2404.907) (-2405.845) * [-2402.828] (-2404.646) (-2401.157) (-2405.950) -- 0:03:53 334000 -- (-2398.773) [-2401.595] (-2408.061) (-2410.704) * (-2405.951) [-2400.208] (-2405.159) (-2413.011) -- 0:03:55 334500 -- [-2402.259] (-2405.298) (-2409.003) (-2410.616) * (-2405.451) (-2407.509) [-2406.973] (-2411.136) -- 0:03:54 335000 -- (-2404.767) (-2406.289) (-2413.964) [-2407.985] * (-2400.578) (-2414.125) (-2408.081) [-2410.937] -- 0:03:54 Average standard deviation of split frequencies: 0.011505 335500 -- (-2405.087) (-2404.207) [-2400.805] (-2405.097) * [-2409.231] (-2403.661) (-2400.985) (-2406.397) -- 0:03:53 336000 -- (-2405.044) (-2406.577) (-2411.877) [-2406.243] * (-2405.992) [-2395.887] (-2401.929) (-2406.112) -- 0:03:53 336500 -- (-2396.861) (-2406.034) [-2398.351] (-2408.438) * (-2403.537) (-2402.905) [-2407.237] (-2401.588) -- 0:03:52 337000 -- (-2408.445) (-2402.490) [-2401.205] (-2398.224) * (-2409.526) (-2409.584) (-2403.487) [-2403.118] -- 0:03:54 337500 -- (-2402.402) (-2400.521) (-2408.926) [-2400.537] * [-2398.725] (-2407.564) (-2403.040) (-2413.693) -- 0:03:53 338000 -- (-2400.692) (-2407.949) (-2406.089) [-2398.588] * (-2409.000) (-2401.899) [-2407.413] (-2401.811) -- 0:03:53 338500 -- [-2398.928] (-2404.046) (-2412.541) (-2403.285) * (-2410.838) (-2400.280) [-2400.457] (-2402.537) -- 0:03:52 339000 -- (-2402.981) (-2406.977) [-2408.386] (-2402.122) * [-2400.137] (-2400.013) (-2406.973) (-2403.586) -- 0:03:52 339500 -- (-2404.746) [-2397.438] (-2414.904) (-2403.589) * [-2399.020] (-2399.719) (-2397.737) (-2406.727) -- 0:03:51 340000 -- (-2401.894) (-2407.008) (-2419.673) [-2399.240] * (-2401.296) (-2403.901) (-2399.942) [-2409.884] -- 0:03:52 Average standard deviation of split frequencies: 0.015221 340500 -- [-2402.032] (-2400.352) (-2406.615) (-2404.570) * [-2395.856] (-2403.880) (-2402.872) (-2408.895) -- 0:03:52 341000 -- (-2405.238) (-2407.497) [-2401.703] (-2410.338) * [-2398.052] (-2409.997) (-2402.839) (-2404.546) -- 0:03:51 341500 -- (-2410.713) [-2404.330] (-2401.698) (-2403.996) * (-2407.617) (-2403.746) [-2403.901] (-2407.380) -- 0:03:51 342000 -- (-2403.867) (-2411.223) [-2402.852] (-2401.236) * (-2407.630) (-2404.419) [-2404.264] (-2400.776) -- 0:03:50 342500 -- (-2406.420) (-2401.223) (-2401.974) [-2401.885] * (-2398.911) (-2404.835) [-2403.187] (-2396.912) -- 0:03:52 343000 -- (-2402.699) [-2399.160] (-2401.576) (-2405.529) * (-2403.876) (-2409.392) [-2413.107] (-2396.939) -- 0:03:51 343500 -- [-2405.577] (-2399.053) (-2402.628) (-2407.484) * (-2410.605) (-2401.871) (-2399.769) [-2400.312] -- 0:03:51 344000 -- (-2400.256) (-2401.251) (-2405.721) [-2408.203] * (-2402.135) (-2402.423) (-2407.151) [-2401.689] -- 0:03:50 344500 -- (-2399.121) [-2398.337] (-2402.553) (-2404.462) * [-2405.681] (-2400.174) (-2403.966) (-2406.707) -- 0:03:50 345000 -- (-2406.263) [-2399.954] (-2405.593) (-2407.682) * (-2405.786) [-2405.782] (-2408.178) (-2407.562) -- 0:03:49 Average standard deviation of split frequencies: 0.016077 345500 -- (-2402.434) [-2403.677] (-2406.419) (-2405.866) * (-2405.691) [-2398.780] (-2404.677) (-2402.985) -- 0:03:51 346000 -- (-2406.600) [-2397.595] (-2409.503) (-2399.136) * [-2396.627] (-2399.754) (-2407.535) (-2414.744) -- 0:03:50 346500 -- (-2404.380) (-2399.102) (-2402.145) [-2400.706] * (-2413.649) (-2398.334) (-2397.975) [-2397.718] -- 0:03:50 347000 -- (-2403.693) (-2400.776) [-2402.022] (-2407.608) * (-2402.827) (-2401.209) (-2413.466) [-2403.015] -- 0:03:49 347500 -- [-2403.461] (-2404.567) (-2399.334) (-2406.790) * (-2406.051) [-2399.742] (-2398.167) (-2399.660) -- 0:03:49 348000 -- (-2402.282) [-2404.554] (-2401.122) (-2404.123) * [-2403.086] (-2402.806) (-2408.147) (-2403.916) -- 0:03:48 348500 -- (-2406.873) (-2401.075) (-2405.998) [-2402.293] * (-2408.994) (-2411.407) [-2402.755] (-2412.397) -- 0:03:49 349000 -- (-2408.505) (-2401.620) [-2399.357] (-2403.402) * [-2410.826] (-2405.006) (-2402.169) (-2403.880) -- 0:03:49 349500 -- [-2402.399] (-2401.611) (-2401.766) (-2399.126) * [-2403.959] (-2406.821) (-2404.830) (-2400.597) -- 0:03:48 350000 -- [-2397.067] (-2406.408) (-2401.193) (-2400.543) * (-2402.561) (-2405.912) (-2408.209) [-2397.434] -- 0:03:48 Average standard deviation of split frequencies: 0.016401 350500 -- (-2406.133) (-2409.906) (-2409.659) [-2405.972] * (-2403.057) (-2404.438) [-2403.402] (-2403.122) -- 0:03:47 351000 -- (-2406.571) (-2406.735) (-2408.524) [-2403.710] * [-2403.658] (-2406.232) (-2408.310) (-2403.742) -- 0:03:49 351500 -- [-2410.191] (-2409.480) (-2405.963) (-2404.209) * (-2410.121) (-2403.841) (-2407.108) [-2404.618] -- 0:03:48 352000 -- (-2401.412) [-2405.002] (-2403.802) (-2398.819) * (-2400.638) (-2410.121) (-2402.060) [-2400.320] -- 0:03:48 352500 -- [-2406.045] (-2408.255) (-2407.190) (-2400.505) * (-2404.491) (-2415.265) [-2406.047] (-2408.885) -- 0:03:47 353000 -- (-2408.470) (-2406.786) (-2404.748) [-2402.065] * (-2404.734) (-2402.475) [-2401.406] (-2399.280) -- 0:03:47 353500 -- (-2406.856) [-2398.116] (-2400.082) (-2399.703) * (-2399.334) [-2404.931] (-2398.386) (-2401.640) -- 0:03:46 354000 -- (-2416.114) (-2400.379) [-2402.056] (-2413.507) * (-2403.290) (-2409.115) [-2400.571] (-2406.185) -- 0:03:48 354500 -- [-2409.552] (-2408.132) (-2399.554) (-2399.224) * [-2399.934] (-2406.000) (-2404.449) (-2394.936) -- 0:03:47 355000 -- [-2397.817] (-2406.099) (-2408.346) (-2401.822) * (-2401.294) (-2403.827) (-2401.021) [-2402.375] -- 0:03:47 Average standard deviation of split frequencies: 0.016155 355500 -- (-2411.762) (-2401.679) [-2402.295] (-2409.967) * (-2404.493) (-2404.873) [-2401.243] (-2399.689) -- 0:03:46 356000 -- (-2401.160) [-2400.928] (-2403.353) (-2406.253) * (-2408.471) (-2404.450) [-2397.400] (-2400.993) -- 0:03:46 356500 -- (-2401.870) (-2407.076) [-2400.815] (-2401.868) * (-2409.117) (-2401.634) [-2402.469] (-2405.164) -- 0:03:45 357000 -- (-2404.749) [-2413.020] (-2399.600) (-2408.357) * (-2406.618) [-2406.367] (-2405.926) (-2403.166) -- 0:03:46 357500 -- (-2402.152) [-2399.773] (-2402.193) (-2406.778) * (-2405.922) (-2404.794) [-2402.886] (-2400.243) -- 0:03:46 358000 -- (-2404.842) [-2406.537] (-2409.281) (-2400.464) * [-2400.413] (-2411.555) (-2407.472) (-2406.342) -- 0:03:45 358500 -- (-2402.396) (-2420.971) (-2413.362) [-2400.954] * [-2400.908] (-2404.560) (-2400.502) (-2405.129) -- 0:03:45 359000 -- (-2415.510) [-2396.184] (-2398.374) (-2402.216) * [-2404.885] (-2409.928) (-2403.516) (-2404.484) -- 0:03:44 359500 -- (-2402.830) [-2408.551] (-2411.742) (-2408.382) * (-2401.707) [-2398.203] (-2407.575) (-2401.786) -- 0:03:44 360000 -- (-2410.152) (-2403.357) [-2411.164] (-2403.339) * (-2401.954) (-2410.410) [-2402.211] (-2405.501) -- 0:03:45 Average standard deviation of split frequencies: 0.015946 360500 -- (-2405.564) (-2407.698) (-2405.990) [-2401.687] * (-2404.934) (-2403.204) [-2400.300] (-2399.428) -- 0:03:45 361000 -- [-2401.667] (-2413.616) (-2404.784) (-2403.474) * (-2402.469) (-2405.316) [-2405.395] (-2405.795) -- 0:03:44 361500 -- (-2406.071) (-2403.109) (-2406.757) [-2397.419] * (-2404.351) [-2403.442] (-2402.215) (-2402.147) -- 0:03:44 362000 -- (-2402.651) (-2405.584) (-2403.950) [-2401.796] * [-2400.607] (-2412.426) (-2407.357) (-2401.693) -- 0:03:43 362500 -- (-2400.513) [-2410.814] (-2402.274) (-2414.479) * (-2406.452) [-2398.758] (-2398.660) (-2408.149) -- 0:03:43 363000 -- (-2412.209) [-2396.937] (-2405.195) (-2412.701) * [-2399.928] (-2401.170) (-2409.845) (-2422.145) -- 0:03:44 363500 -- [-2401.384] (-2403.883) (-2410.267) (-2405.057) * (-2405.956) [-2398.928] (-2404.535) (-2409.495) -- 0:03:44 364000 -- (-2406.516) (-2407.004) [-2401.683] (-2400.598) * (-2415.476) (-2409.640) [-2399.335] (-2412.034) -- 0:03:43 364500 -- (-2409.541) [-2408.832] (-2406.382) (-2401.622) * (-2402.689) (-2404.053) (-2397.054) [-2401.420] -- 0:03:43 365000 -- [-2404.625] (-2413.228) (-2404.199) (-2397.071) * [-2399.620] (-2412.910) (-2400.480) (-2401.295) -- 0:03:42 Average standard deviation of split frequencies: 0.018289 365500 -- (-2404.988) (-2408.919) (-2399.996) [-2402.657] * (-2410.107) (-2410.926) [-2396.928] (-2411.556) -- 0:03:43 366000 -- (-2405.430) (-2405.573) [-2405.620] (-2401.092) * [-2405.543] (-2418.200) (-2401.063) (-2398.543) -- 0:03:43 366500 -- (-2401.362) (-2403.589) [-2404.321] (-2399.995) * (-2398.551) (-2412.781) (-2404.911) [-2405.381] -- 0:03:42 367000 -- (-2409.042) (-2408.093) [-2410.653] (-2406.779) * [-2402.517] (-2411.747) (-2403.545) (-2400.384) -- 0:03:42 367500 -- [-2402.148] (-2411.792) (-2403.218) (-2406.434) * (-2408.236) (-2415.504) (-2403.787) [-2409.303] -- 0:03:42 368000 -- (-2400.297) (-2401.936) [-2401.483] (-2407.129) * (-2405.615) (-2403.786) (-2409.072) [-2407.105] -- 0:03:41 368500 -- (-2400.754) (-2403.630) (-2402.762) [-2401.882] * [-2401.456] (-2410.462) (-2409.885) (-2401.635) -- 0:03:42 369000 -- (-2401.631) [-2405.694] (-2404.406) (-2403.955) * (-2401.636) (-2403.599) (-2414.788) [-2408.094] -- 0:03:42 369500 -- (-2406.477) (-2408.764) (-2405.078) [-2401.278] * [-2403.109] (-2409.246) (-2413.113) (-2402.490) -- 0:03:41 370000 -- (-2406.429) [-2412.282] (-2403.083) (-2406.358) * (-2400.012) (-2403.396) [-2408.479] (-2405.221) -- 0:03:41 Average standard deviation of split frequencies: 0.018568 370500 -- (-2413.399) (-2405.516) (-2402.612) [-2402.012] * (-2404.484) [-2399.127] (-2412.940) (-2401.771) -- 0:03:40 371000 -- (-2404.973) [-2400.755] (-2400.796) (-2400.563) * (-2406.004) (-2404.932) [-2400.709] (-2402.446) -- 0:03:40 371500 -- (-2406.955) (-2402.742) (-2399.856) [-2402.320] * (-2414.726) [-2408.509] (-2397.005) (-2403.331) -- 0:03:41 372000 -- (-2395.602) (-2401.191) (-2403.657) [-2403.634] * (-2412.086) (-2414.100) (-2400.593) [-2400.722] -- 0:03:41 372500 -- [-2402.634] (-2404.175) (-2401.972) (-2399.902) * (-2407.504) (-2407.246) [-2403.461] (-2404.100) -- 0:03:40 373000 -- (-2399.467) (-2409.005) [-2407.240] (-2405.899) * [-2401.967] (-2402.904) (-2399.019) (-2401.624) -- 0:03:40 373500 -- (-2405.482) (-2404.605) [-2402.819] (-2408.030) * (-2396.914) (-2401.031) [-2398.912] (-2404.055) -- 0:03:39 374000 -- (-2410.471) (-2408.865) (-2404.779) [-2401.919] * (-2406.195) [-2402.645] (-2401.900) (-2402.248) -- 0:03:40 374500 -- [-2398.316] (-2408.857) (-2403.985) (-2405.832) * (-2401.558) (-2403.149) (-2409.978) [-2403.104] -- 0:03:40 375000 -- (-2401.259) [-2409.665] (-2402.678) (-2400.856) * [-2403.128] (-2404.893) (-2415.405) (-2395.430) -- 0:03:40 Average standard deviation of split frequencies: 0.018305 375500 -- (-2404.475) (-2408.039) (-2404.788) [-2402.432] * (-2400.348) (-2406.904) (-2412.262) [-2402.755] -- 0:03:39 376000 -- (-2402.343) (-2405.064) [-2399.828] (-2400.214) * (-2400.543) [-2402.434] (-2404.017) (-2408.246) -- 0:03:39 376500 -- (-2405.662) (-2409.286) [-2402.307] (-2401.670) * (-2400.290) [-2406.861] (-2399.355) (-2401.313) -- 0:03:38 377000 -- (-2402.947) (-2408.907) [-2404.288] (-2401.038) * (-2404.838) (-2406.593) [-2408.917] (-2400.631) -- 0:03:39 377500 -- [-2399.056] (-2404.466) (-2401.646) (-2407.978) * [-2400.422] (-2403.570) (-2404.590) (-2402.506) -- 0:03:39 378000 -- (-2412.896) (-2402.809) (-2403.956) [-2405.129] * (-2403.894) [-2404.475] (-2408.486) (-2410.986) -- 0:03:38 378500 -- (-2401.856) (-2411.274) [-2408.649] (-2421.165) * [-2408.179] (-2398.315) (-2404.736) (-2399.261) -- 0:03:38 379000 -- (-2403.686) (-2401.336) [-2406.330] (-2411.668) * (-2405.586) (-2403.725) (-2407.626) [-2401.240] -- 0:03:37 379500 -- (-2402.192) (-2407.384) (-2417.842) [-2407.942] * (-2403.780) [-2398.422] (-2404.810) (-2407.112) -- 0:03:37 380000 -- (-2404.322) [-2405.555] (-2407.805) (-2404.274) * [-2398.949] (-2409.488) (-2403.518) (-2404.290) -- 0:03:38 Average standard deviation of split frequencies: 0.017585 380500 -- (-2408.531) (-2412.337) [-2400.229] (-2404.633) * [-2403.567] (-2404.582) (-2405.144) (-2401.349) -- 0:03:38 381000 -- (-2405.100) (-2405.283) (-2399.245) [-2405.176] * [-2404.674] (-2402.015) (-2399.601) (-2401.556) -- 0:03:37 381500 -- (-2405.022) [-2405.512] (-2402.860) (-2405.506) * (-2402.225) (-2402.763) (-2407.738) [-2397.674] -- 0:03:37 382000 -- (-2401.570) (-2407.274) [-2404.675] (-2403.382) * (-2405.034) (-2403.608) [-2408.689] (-2405.139) -- 0:03:36 382500 -- (-2401.467) (-2402.449) [-2404.624] (-2408.661) * (-2407.555) (-2407.301) [-2415.488] (-2406.895) -- 0:03:36 383000 -- (-2406.782) (-2398.082) (-2407.742) [-2400.317] * (-2403.309) (-2401.404) [-2415.088] (-2402.592) -- 0:03:37 383500 -- (-2401.196) (-2401.217) [-2397.246] (-2402.756) * (-2402.901) (-2410.650) [-2400.058] (-2402.443) -- 0:03:37 384000 -- (-2404.216) (-2400.605) (-2409.089) [-2402.205] * (-2403.866) (-2405.483) (-2408.216) [-2402.896] -- 0:03:36 384500 -- (-2403.773) (-2405.411) [-2404.540] (-2399.125) * (-2412.742) [-2401.841] (-2402.672) (-2401.535) -- 0:03:36 385000 -- (-2405.006) (-2400.680) [-2403.675] (-2397.631) * [-2408.831] (-2414.754) (-2396.210) (-2404.023) -- 0:03:35 Average standard deviation of split frequencies: 0.020273 385500 -- [-2401.273] (-2422.487) (-2409.151) (-2402.582) * [-2407.697] (-2416.384) (-2408.953) (-2413.478) -- 0:03:35 386000 -- (-2402.408) (-2403.188) [-2404.185] (-2413.983) * [-2400.295] (-2409.344) (-2397.726) (-2405.495) -- 0:03:36 386500 -- [-2402.682] (-2401.704) (-2404.747) (-2404.174) * (-2406.713) [-2400.438] (-2404.164) (-2412.764) -- 0:03:35 387000 -- (-2404.175) [-2407.074] (-2404.885) (-2401.774) * (-2410.401) (-2397.233) [-2400.705] (-2416.169) -- 0:03:35 387500 -- [-2403.832] (-2404.060) (-2401.343) (-2409.363) * [-2410.717] (-2401.362) (-2398.552) (-2408.475) -- 0:03:34 388000 -- (-2404.285) [-2406.932] (-2414.764) (-2401.601) * (-2405.989) [-2403.727] (-2399.193) (-2403.171) -- 0:03:34 388500 -- (-2408.556) [-2400.666] (-2413.658) (-2405.709) * (-2400.557) [-2398.507] (-2405.193) (-2402.720) -- 0:03:35 389000 -- [-2407.262] (-2407.858) (-2404.898) (-2403.412) * (-2406.795) [-2407.800] (-2405.144) (-2405.220) -- 0:03:35 389500 -- [-2397.651] (-2401.764) (-2398.282) (-2409.513) * (-2411.161) [-2408.913] (-2406.750) (-2399.962) -- 0:03:34 390000 -- [-2403.408] (-2404.070) (-2408.419) (-2408.907) * (-2408.015) (-2408.445) (-2402.254) [-2403.603] -- 0:03:34 Average standard deviation of split frequencies: 0.020996 390500 -- [-2400.958] (-2410.059) (-2400.223) (-2400.886) * [-2405.696] (-2408.848) (-2403.405) (-2402.811) -- 0:03:33 391000 -- [-2398.287] (-2403.716) (-2403.600) (-2401.271) * (-2405.393) [-2405.701] (-2400.261) (-2407.605) -- 0:03:33 391500 -- (-2400.972) (-2399.546) (-2401.465) [-2405.746] * (-2406.584) (-2403.668) [-2407.887] (-2402.745) -- 0:03:34 392000 -- (-2409.061) (-2403.434) [-2401.507] (-2403.939) * (-2401.604) (-2407.187) (-2413.584) [-2396.658] -- 0:03:34 392500 -- (-2404.200) (-2399.418) (-2410.149) [-2401.663] * (-2403.725) (-2402.795) [-2403.285] (-2395.786) -- 0:03:33 393000 -- (-2404.518) [-2399.160] (-2403.579) (-2404.184) * (-2412.526) (-2402.559) [-2406.192] (-2407.794) -- 0:03:33 393500 -- (-2401.967) [-2400.300] (-2406.047) (-2408.146) * (-2404.023) (-2406.907) [-2407.996] (-2408.411) -- 0:03:32 394000 -- [-2406.474] (-2413.318) (-2407.259) (-2402.022) * (-2403.170) [-2402.016] (-2405.325) (-2408.700) -- 0:03:32 394500 -- (-2410.208) (-2401.076) [-2407.473] (-2403.458) * (-2401.875) [-2401.150] (-2406.008) (-2404.381) -- 0:03:33 395000 -- (-2404.150) (-2402.595) (-2399.585) [-2400.083] * (-2406.100) (-2401.909) [-2404.855] (-2405.662) -- 0:03:32 Average standard deviation of split frequencies: 0.021666 395500 -- (-2400.452) (-2396.099) [-2398.872] (-2411.317) * [-2394.982] (-2408.236) (-2399.020) (-2403.428) -- 0:03:32 396000 -- (-2402.078) [-2398.869] (-2412.397) (-2403.304) * (-2406.090) [-2408.600] (-2404.748) (-2404.579) -- 0:03:32 396500 -- [-2403.171] (-2410.025) (-2401.591) (-2405.205) * (-2409.491) [-2402.805] (-2406.996) (-2401.910) -- 0:03:31 397000 -- (-2405.945) [-2401.277] (-2404.598) (-2405.298) * (-2403.988) (-2408.498) (-2401.964) [-2401.501] -- 0:03:32 397500 -- (-2407.550) (-2401.811) (-2400.147) [-2402.148] * [-2405.878] (-2408.378) (-2399.626) (-2407.800) -- 0:03:32 398000 -- (-2406.001) (-2413.771) (-2398.698) [-2404.718] * (-2403.029) [-2399.889] (-2407.635) (-2405.229) -- 0:03:31 398500 -- [-2397.501] (-2404.400) (-2400.500) (-2411.847) * (-2412.251) [-2405.716] (-2405.473) (-2403.483) -- 0:03:31 399000 -- (-2412.385) (-2409.712) [-2398.193] (-2402.621) * (-2404.041) (-2399.429) (-2404.790) [-2401.919] -- 0:03:30 399500 -- [-2411.478] (-2413.252) (-2405.628) (-2405.095) * (-2405.469) (-2398.560) [-2400.531] (-2402.220) -- 0:03:30 400000 -- (-2411.440) (-2410.741) (-2400.417) [-2403.259] * [-2402.693] (-2409.615) (-2403.059) (-2406.082) -- 0:03:31 Average standard deviation of split frequencies: 0.021178 400500 -- (-2400.379) (-2405.162) [-2399.183] (-2403.401) * (-2404.287) (-2408.578) [-2405.127] (-2408.367) -- 0:03:31 401000 -- [-2403.008] (-2400.607) (-2404.266) (-2414.422) * (-2402.819) (-2405.152) [-2397.192] (-2403.972) -- 0:03:30 401500 -- [-2403.813] (-2405.085) (-2410.996) (-2410.255) * (-2405.028) [-2401.850] (-2404.701) (-2411.931) -- 0:03:30 402000 -- (-2402.833) [-2409.278] (-2408.886) (-2403.391) * [-2402.241] (-2402.047) (-2397.944) (-2411.153) -- 0:03:29 402500 -- (-2399.925) (-2400.489) (-2403.285) [-2400.550] * (-2409.063) (-2406.642) [-2402.096] (-2406.936) -- 0:03:29 403000 -- (-2412.952) (-2405.433) (-2401.780) [-2401.209] * (-2405.044) [-2404.490] (-2403.568) (-2402.250) -- 0:03:30 403500 -- (-2408.049) (-2404.363) [-2399.951] (-2419.254) * (-2414.126) (-2407.154) [-2406.979] (-2401.809) -- 0:03:29 404000 -- (-2404.763) [-2401.192] (-2402.978) (-2414.411) * (-2412.992) (-2408.528) (-2401.554) [-2405.719] -- 0:03:29 404500 -- (-2405.866) [-2401.464] (-2404.287) (-2397.825) * [-2403.519] (-2403.682) (-2402.758) (-2409.717) -- 0:03:29 405000 -- [-2398.837] (-2404.011) (-2404.896) (-2398.631) * (-2398.845) (-2402.368) [-2401.313] (-2404.467) -- 0:03:28 Average standard deviation of split frequencies: 0.022990 405500 -- [-2411.106] (-2402.246) (-2400.944) (-2405.952) * [-2398.462] (-2412.335) (-2397.531) (-2403.706) -- 0:03:29 406000 -- (-2398.976) (-2412.556) (-2406.829) [-2399.850] * (-2401.688) (-2407.543) [-2400.456] (-2407.246) -- 0:03:29 406500 -- (-2406.611) (-2404.457) [-2401.309] (-2399.719) * (-2403.173) [-2399.107] (-2400.263) (-2403.156) -- 0:03:28 407000 -- (-2402.729) (-2411.578) (-2404.493) [-2403.340] * [-2407.965] (-2403.239) (-2398.861) (-2406.285) -- 0:03:28 407500 -- (-2409.109) (-2405.944) (-2405.708) [-2401.718] * [-2401.315] (-2402.127) (-2403.379) (-2404.027) -- 0:03:27 408000 -- (-2404.657) (-2401.244) [-2401.153] (-2408.437) * (-2404.837) [-2401.265] (-2400.164) (-2411.635) -- 0:03:27 408500 -- (-2405.046) [-2404.623] (-2411.803) (-2407.257) * [-2405.331] (-2412.660) (-2399.829) (-2408.611) -- 0:03:28 409000 -- (-2408.386) (-2401.117) (-2405.751) [-2403.336] * [-2405.445] (-2414.693) (-2401.716) (-2402.647) -- 0:03:28 409500 -- (-2406.206) [-2404.935] (-2414.801) (-2409.082) * (-2405.577) (-2406.151) (-2406.932) [-2402.513] -- 0:03:27 410000 -- [-2404.878] (-2409.072) (-2405.768) (-2406.740) * [-2402.774] (-2413.596) (-2406.369) (-2408.544) -- 0:03:27 Average standard deviation of split frequencies: 0.022728 410500 -- [-2403.274] (-2407.602) (-2405.747) (-2404.425) * [-2403.062] (-2406.285) (-2403.526) (-2410.032) -- 0:03:26 411000 -- (-2402.165) [-2405.879] (-2400.998) (-2404.487) * (-2401.528) (-2408.097) [-2401.857] (-2402.464) -- 0:03:26 411500 -- [-2403.459] (-2405.004) (-2406.085) (-2407.883) * [-2401.347] (-2402.451) (-2404.331) (-2399.534) -- 0:03:27 412000 -- (-2401.203) [-2408.511] (-2406.151) (-2405.834) * (-2403.732) (-2410.525) [-2398.165] (-2399.527) -- 0:03:26 412500 -- (-2408.268) (-2407.274) [-2405.958] (-2405.019) * (-2403.506) [-2401.167] (-2407.085) (-2405.583) -- 0:03:26 413000 -- (-2405.783) (-2405.742) [-2405.101] (-2406.994) * (-2405.059) [-2404.081] (-2405.297) (-2401.690) -- 0:03:26 413500 -- (-2403.231) [-2403.157] (-2405.233) (-2403.814) * [-2407.498] (-2411.250) (-2403.402) (-2405.916) -- 0:03:25 414000 -- (-2412.954) (-2411.202) (-2400.987) [-2404.211] * (-2406.835) [-2409.587] (-2405.890) (-2406.602) -- 0:03:25 414500 -- (-2409.217) [-2406.074] (-2400.038) (-2411.103) * (-2405.054) (-2411.920) [-2405.323] (-2410.642) -- 0:03:26 415000 -- (-2400.606) (-2398.485) [-2397.431] (-2404.336) * (-2406.326) (-2410.536) (-2402.870) [-2408.605] -- 0:03:25 Average standard deviation of split frequencies: 0.022437 415500 -- (-2406.733) [-2404.484] (-2403.917) (-2404.473) * (-2404.002) [-2402.804] (-2410.700) (-2414.618) -- 0:03:25 416000 -- (-2405.329) (-2401.941) (-2406.933) [-2404.648] * (-2409.106) (-2401.288) [-2400.539] (-2406.305) -- 0:03:24 416500 -- [-2404.917] (-2400.090) (-2403.060) (-2408.006) * (-2402.372) (-2416.839) (-2404.985) [-2406.898] -- 0:03:24 417000 -- (-2403.615) (-2412.993) (-2398.939) [-2402.422] * (-2405.672) (-2397.389) (-2404.749) [-2404.569] -- 0:03:25 417500 -- (-2418.419) (-2407.632) (-2406.330) [-2401.730] * (-2407.644) (-2409.316) [-2405.288] (-2407.356) -- 0:03:25 418000 -- (-2415.421) [-2403.383] (-2399.166) (-2403.503) * [-2403.433] (-2401.662) (-2398.821) (-2395.476) -- 0:03:24 418500 -- (-2406.038) (-2407.228) [-2402.434] (-2401.869) * (-2404.294) (-2399.666) [-2395.632] (-2404.775) -- 0:03:24 419000 -- [-2404.868] (-2406.571) (-2403.022) (-2416.716) * [-2403.515] (-2403.853) (-2408.882) (-2404.205) -- 0:03:23 419500 -- (-2402.974) (-2405.573) [-2404.696] (-2412.729) * (-2411.697) [-2403.138] (-2403.259) (-2407.229) -- 0:03:23 420000 -- (-2409.911) (-2413.626) (-2404.614) [-2413.151] * [-2404.929] (-2406.842) (-2403.355) (-2403.607) -- 0:03:24 Average standard deviation of split frequencies: 0.020843 420500 -- (-2400.044) (-2400.180) (-2400.165) [-2414.436] * (-2407.221) [-2408.820] (-2401.833) (-2401.431) -- 0:03:23 421000 -- [-2402.592] (-2407.391) (-2401.842) (-2406.471) * (-2406.762) [-2400.217] (-2412.874) (-2404.026) -- 0:03:23 421500 -- (-2407.789) [-2401.157] (-2402.663) (-2404.365) * (-2402.522) (-2401.431) [-2405.801] (-2403.949) -- 0:03:23 422000 -- (-2406.460) (-2401.457) [-2396.907] (-2405.714) * (-2403.368) (-2402.009) [-2403.496] (-2401.995) -- 0:03:22 422500 -- (-2404.818) [-2404.680] (-2404.404) (-2405.506) * (-2410.081) (-2405.748) [-2402.480] (-2403.592) -- 0:03:22 423000 -- (-2401.547) (-2410.965) (-2408.882) [-2407.566] * (-2409.047) [-2409.365] (-2402.669) (-2403.855) -- 0:03:23 423500 -- [-2409.912] (-2417.458) (-2404.766) (-2408.512) * (-2408.282) [-2402.500] (-2401.875) (-2405.403) -- 0:03:22 424000 -- (-2405.309) (-2418.694) (-2405.097) [-2407.186] * [-2405.447] (-2401.945) (-2399.000) (-2408.647) -- 0:03:22 424500 -- (-2403.412) (-2405.916) (-2416.455) [-2398.963] * (-2404.370) [-2404.646] (-2401.426) (-2409.917) -- 0:03:22 425000 -- (-2404.637) (-2405.396) [-2405.064] (-2404.491) * (-2406.305) [-2402.688] (-2416.111) (-2403.626) -- 0:03:21 Average standard deviation of split frequencies: 0.020582 425500 -- (-2403.113) (-2409.477) (-2403.300) [-2408.673] * (-2407.472) [-2400.399] (-2405.632) (-2406.580) -- 0:03:21 426000 -- [-2404.516] (-2404.213) (-2399.820) (-2403.730) * (-2407.959) [-2405.642] (-2406.757) (-2405.294) -- 0:03:22 426500 -- (-2402.735) (-2406.485) [-2399.821] (-2405.061) * (-2404.026) (-2400.814) [-2403.406] (-2400.989) -- 0:03:21 427000 -- (-2401.210) [-2407.698] (-2397.837) (-2400.645) * (-2406.977) (-2411.189) (-2405.310) [-2402.286] -- 0:03:21 427500 -- [-2404.270] (-2407.048) (-2396.495) (-2403.727) * [-2404.548] (-2406.305) (-2407.442) (-2399.163) -- 0:03:20 428000 -- (-2404.637) (-2405.339) (-2406.321) [-2401.679] * (-2402.936) (-2399.918) (-2408.160) [-2400.237] -- 0:03:20 428500 -- (-2401.367) (-2398.486) [-2400.969] (-2403.711) * [-2407.452] (-2401.881) (-2402.313) (-2402.230) -- 0:03:21 429000 -- [-2406.751] (-2405.919) (-2401.802) (-2403.724) * (-2403.946) [-2400.660] (-2409.203) (-2405.543) -- 0:03:20 429500 -- (-2412.336) (-2415.927) (-2407.617) [-2399.552] * (-2405.198) (-2403.995) (-2406.341) [-2401.722] -- 0:03:20 430000 -- [-2395.231] (-2407.871) (-2405.968) (-2400.762) * (-2405.770) (-2401.320) [-2402.044] (-2400.138) -- 0:03:20 Average standard deviation of split frequencies: 0.019046 430500 -- [-2398.004] (-2408.154) (-2408.578) (-2413.397) * (-2400.976) [-2396.237] (-2419.823) (-2403.804) -- 0:03:19 431000 -- (-2406.998) (-2406.724) [-2399.318] (-2407.611) * (-2413.359) [-2403.826] (-2407.697) (-2411.034) -- 0:03:19 431500 -- (-2400.950) (-2408.970) (-2406.568) [-2401.275] * [-2399.368] (-2411.667) (-2404.636) (-2404.685) -- 0:03:20 432000 -- (-2401.360) (-2405.319) (-2405.149) [-2405.179] * (-2400.495) (-2404.125) [-2401.411] (-2408.356) -- 0:03:19 432500 -- [-2406.838] (-2407.541) (-2412.634) (-2404.940) * [-2403.612] (-2399.731) (-2404.933) (-2409.254) -- 0:03:19 433000 -- (-2409.455) [-2406.141] (-2410.276) (-2408.999) * (-2405.942) [-2397.892] (-2402.758) (-2403.132) -- 0:03:19 433500 -- (-2401.299) (-2404.457) (-2400.396) [-2401.728] * (-2401.828) [-2403.568] (-2411.389) (-2403.556) -- 0:03:18 434000 -- (-2412.477) (-2402.651) (-2404.975) [-2407.404] * (-2404.376) (-2409.532) (-2422.151) [-2410.655] -- 0:03:18 434500 -- (-2411.133) (-2403.378) (-2400.168) [-2408.044] * (-2411.296) (-2408.986) (-2399.514) [-2402.279] -- 0:03:19 435000 -- [-2402.291] (-2402.119) (-2403.853) (-2401.358) * (-2406.087) (-2401.194) (-2412.021) [-2402.444] -- 0:03:18 Average standard deviation of split frequencies: 0.017515 435500 -- (-2403.593) (-2409.411) [-2402.014] (-2406.879) * (-2402.872) (-2414.332) (-2398.261) [-2398.577] -- 0:03:18 436000 -- [-2400.254] (-2408.189) (-2404.553) (-2402.176) * (-2400.749) [-2403.167] (-2404.945) (-2401.502) -- 0:03:17 436500 -- [-2403.344] (-2410.682) (-2403.564) (-2403.418) * (-2401.555) (-2406.044) [-2406.393] (-2403.068) -- 0:03:17 437000 -- (-2402.764) (-2402.176) (-2402.754) [-2399.206] * (-2406.023) (-2406.693) (-2397.145) [-2405.763] -- 0:03:17 437500 -- (-2406.029) (-2406.120) [-2405.290] (-2401.138) * [-2397.918] (-2400.959) (-2409.408) (-2402.579) -- 0:03:18 438000 -- (-2399.578) (-2405.075) (-2398.318) [-2407.447] * (-2410.245) [-2401.112] (-2404.747) (-2396.282) -- 0:03:17 438500 -- [-2400.553] (-2396.686) (-2405.613) (-2401.055) * [-2400.975] (-2406.278) (-2406.997) (-2397.095) -- 0:03:17 439000 -- (-2403.494) (-2401.660) [-2403.835] (-2398.152) * (-2405.806) (-2404.164) (-2402.139) [-2403.727] -- 0:03:16 439500 -- (-2405.130) (-2403.634) [-2400.971] (-2404.952) * (-2405.498) (-2401.339) (-2398.472) [-2398.700] -- 0:03:16 440000 -- (-2404.250) [-2405.865] (-2402.060) (-2400.990) * (-2403.148) (-2397.564) [-2401.518] (-2408.548) -- 0:03:17 Average standard deviation of split frequencies: 0.016474 440500 -- (-2404.207) [-2398.347] (-2406.900) (-2405.223) * (-2400.133) (-2402.002) [-2403.374] (-2406.979) -- 0:03:16 441000 -- (-2410.193) (-2400.391) (-2407.276) [-2399.398] * (-2403.758) [-2411.760] (-2403.449) (-2406.971) -- 0:03:16 441500 -- (-2410.026) [-2401.428] (-2413.695) (-2399.747) * [-2405.493] (-2406.447) (-2410.724) (-2414.108) -- 0:03:16 442000 -- (-2405.417) (-2401.748) [-2405.025] (-2399.836) * (-2409.992) [-2397.145] (-2402.037) (-2411.617) -- 0:03:15 442500 -- [-2400.320] (-2403.697) (-2402.657) (-2401.036) * (-2410.800) [-2404.228] (-2404.248) (-2405.660) -- 0:03:15 443000 -- [-2400.780] (-2413.786) (-2409.898) (-2409.159) * (-2403.287) (-2406.182) [-2400.188] (-2408.191) -- 0:03:16 443500 -- [-2399.497] (-2409.181) (-2406.102) (-2401.421) * (-2405.562) [-2398.631] (-2405.379) (-2408.442) -- 0:03:15 444000 -- (-2400.521) (-2405.956) (-2405.748) [-2401.269] * (-2402.730) (-2400.248) (-2399.616) [-2402.326] -- 0:03:15 444500 -- (-2406.326) [-2404.321] (-2400.798) (-2404.618) * (-2403.248) [-2398.998] (-2403.629) (-2406.218) -- 0:03:14 445000 -- (-2406.391) [-2403.964] (-2401.725) (-2405.636) * (-2405.298) [-2403.375] (-2407.076) (-2402.282) -- 0:03:14 Average standard deviation of split frequencies: 0.015432 445500 -- (-2403.120) (-2405.695) [-2406.544] (-2415.262) * [-2398.527] (-2405.673) (-2408.559) (-2407.515) -- 0:03:14 446000 -- [-2399.146] (-2410.034) (-2405.918) (-2411.213) * (-2399.361) [-2404.544] (-2412.731) (-2408.247) -- 0:03:15 446500 -- [-2404.669] (-2401.489) (-2396.778) (-2401.004) * (-2400.355) [-2401.676] (-2412.390) (-2402.407) -- 0:03:14 447000 -- [-2401.677] (-2405.846) (-2397.653) (-2410.269) * (-2404.068) (-2413.807) (-2403.923) [-2400.654] -- 0:03:14 447500 -- (-2397.225) (-2406.710) (-2406.513) [-2401.952] * (-2400.901) (-2416.804) [-2407.927] (-2399.556) -- 0:03:13 448000 -- [-2404.070] (-2403.128) (-2400.556) (-2408.688) * (-2402.413) (-2409.141) (-2405.966) [-2400.714] -- 0:03:13 448500 -- (-2408.323) (-2406.431) [-2399.961] (-2407.881) * (-2408.854) [-2402.733] (-2401.698) (-2404.908) -- 0:03:14 449000 -- (-2406.359) (-2409.335) [-2398.399] (-2405.064) * [-2398.310] (-2405.385) (-2404.349) (-2407.343) -- 0:03:13 449500 -- (-2405.558) [-2403.151] (-2404.052) (-2405.455) * (-2399.162) [-2402.489] (-2406.043) (-2401.259) -- 0:03:13 450000 -- (-2402.823) (-2402.676) [-2403.277] (-2408.043) * [-2395.551] (-2405.207) (-2403.520) (-2406.929) -- 0:03:13 Average standard deviation of split frequencies: 0.014853 450500 -- (-2409.857) (-2409.539) (-2403.690) [-2405.520] * (-2410.955) (-2404.129) [-2404.487] (-2407.602) -- 0:03:12 451000 -- (-2401.509) [-2402.919] (-2402.480) (-2417.553) * (-2399.110) [-2402.114] (-2408.593) (-2402.032) -- 0:03:12 451500 -- (-2404.485) (-2403.942) (-2400.020) [-2406.204] * (-2407.036) (-2400.366) (-2400.234) [-2399.064] -- 0:03:13 452000 -- (-2409.914) (-2407.748) [-2405.478] (-2410.110) * [-2397.553] (-2413.401) (-2401.875) (-2400.473) -- 0:03:12 452500 -- (-2405.536) (-2409.281) (-2400.654) [-2406.252] * (-2401.881) [-2407.379] (-2404.000) (-2399.308) -- 0:03:12 453000 -- (-2397.546) [-2403.828] (-2410.764) (-2407.171) * [-2406.736] (-2402.905) (-2405.390) (-2401.413) -- 0:03:11 453500 -- (-2399.356) [-2403.255] (-2403.658) (-2406.375) * (-2400.217) (-2409.349) [-2402.527] (-2405.379) -- 0:03:11 454000 -- (-2406.626) (-2412.415) [-2404.986] (-2411.546) * (-2400.721) (-2404.821) (-2407.988) [-2399.846] -- 0:03:11 454500 -- (-2404.328) (-2403.680) [-2408.835] (-2406.801) * (-2402.282) (-2402.128) [-2403.116] (-2396.721) -- 0:03:12 455000 -- (-2400.418) [-2399.677] (-2405.375) (-2401.556) * [-2403.214] (-2404.863) (-2406.072) (-2400.457) -- 0:03:11 Average standard deviation of split frequencies: 0.015920 455500 -- (-2399.133) (-2405.727) (-2403.507) [-2402.963] * (-2409.589) (-2400.455) (-2410.073) [-2399.595] -- 0:03:11 456000 -- [-2398.470] (-2408.615) (-2406.968) (-2413.009) * (-2400.687) (-2400.851) (-2406.340) [-2398.585] -- 0:03:10 456500 -- (-2406.173) [-2404.044] (-2400.143) (-2408.729) * (-2404.351) [-2406.220] (-2407.332) (-2402.788) -- 0:03:10 457000 -- (-2400.041) (-2407.176) (-2400.746) [-2411.397] * [-2411.394] (-2399.855) (-2407.621) (-2398.162) -- 0:03:10 457500 -- (-2406.025) [-2401.293] (-2403.657) (-2411.986) * [-2399.911] (-2397.300) (-2409.742) (-2400.196) -- 0:03:10 458000 -- (-2405.788) (-2407.364) (-2398.066) [-2405.555] * (-2400.677) (-2403.977) (-2399.478) [-2404.560] -- 0:03:10 458500 -- [-2405.601] (-2402.191) (-2401.608) (-2402.542) * (-2404.215) (-2409.201) [-2402.843] (-2404.893) -- 0:03:10 459000 -- (-2405.888) (-2415.898) (-2406.732) [-2409.637] * (-2397.385) (-2409.517) (-2401.389) [-2401.479] -- 0:03:09 459500 -- (-2415.068) (-2414.398) [-2403.916] (-2397.909) * (-2403.391) [-2404.033] (-2402.869) (-2406.773) -- 0:03:09 460000 -- (-2412.663) (-2401.257) [-2412.484] (-2405.091) * (-2408.244) (-2400.653) [-2408.005] (-2399.944) -- 0:03:10 Average standard deviation of split frequencies: 0.016578 460500 -- (-2412.764) (-2401.229) [-2401.629] (-2407.293) * [-2400.609] (-2400.866) (-2408.591) (-2397.385) -- 0:03:09 461000 -- (-2403.092) [-2395.167] (-2396.678) (-2406.444) * (-2401.864) [-2404.464] (-2408.671) (-2410.353) -- 0:03:09 461500 -- (-2408.702) [-2406.099] (-2396.337) (-2408.555) * (-2404.009) (-2406.007) [-2404.836] (-2403.826) -- 0:03:09 462000 -- (-2413.633) (-2406.233) (-2402.514) [-2405.080] * (-2407.475) [-2399.413] (-2410.645) (-2409.637) -- 0:03:08 462500 -- (-2410.188) (-2409.964) (-2398.133) [-2404.420] * [-2404.457] (-2412.586) (-2407.210) (-2407.286) -- 0:03:08 463000 -- (-2405.540) (-2402.939) [-2399.606] (-2401.552) * [-2400.282] (-2415.969) (-2401.406) (-2401.486) -- 0:03:09 463500 -- [-2404.856] (-2403.290) (-2411.742) (-2399.031) * (-2410.803) (-2405.057) (-2402.828) [-2404.663] -- 0:03:08 464000 -- (-2400.208) (-2408.469) (-2409.889) [-2407.635] * (-2401.700) (-2399.299) (-2411.505) [-2399.791] -- 0:03:08 464500 -- (-2411.223) (-2414.163) [-2414.384] (-2412.780) * [-2406.554] (-2401.066) (-2408.749) (-2403.847) -- 0:03:07 465000 -- (-2401.997) (-2400.342) [-2401.056] (-2417.881) * [-2403.489] (-2405.117) (-2402.054) (-2409.473) -- 0:03:07 Average standard deviation of split frequencies: 0.016388 465500 -- (-2405.251) [-2401.345] (-2402.326) (-2405.571) * (-2397.841) (-2400.786) [-2401.877] (-2402.853) -- 0:03:07 466000 -- [-2399.078] (-2408.867) (-2402.557) (-2400.982) * (-2401.052) (-2408.312) [-2404.029] (-2400.188) -- 0:03:07 466500 -- (-2409.760) (-2404.766) (-2404.978) [-2403.855] * [-2403.349] (-2401.243) (-2398.800) (-2396.033) -- 0:03:07 467000 -- [-2401.522] (-2406.200) (-2404.790) (-2406.953) * (-2404.336) (-2399.145) [-2399.424] (-2404.920) -- 0:03:07 467500 -- [-2405.137] (-2416.296) (-2406.705) (-2406.879) * (-2407.308) [-2401.544] (-2400.339) (-2412.096) -- 0:03:06 468000 -- [-2407.275] (-2407.076) (-2404.415) (-2402.292) * (-2399.804) (-2401.755) [-2399.269] (-2406.239) -- 0:03:06 468500 -- (-2406.028) (-2404.595) [-2397.749] (-2401.554) * [-2405.307] (-2409.403) (-2400.210) (-2402.697) -- 0:03:06 469000 -- (-2401.532) (-2402.024) [-2399.239] (-2406.040) * [-2403.770] (-2405.990) (-2401.297) (-2400.637) -- 0:03:06 469500 -- (-2402.668) [-2395.907] (-2404.025) (-2404.060) * (-2409.216) (-2410.837) (-2406.794) [-2405.906] -- 0:03:06 470000 -- (-2404.072) (-2399.388) (-2408.044) [-2406.711] * [-2404.061] (-2398.247) (-2407.168) (-2403.380) -- 0:03:06 Average standard deviation of split frequencies: 0.015424 470500 -- (-2401.057) (-2398.050) [-2407.463] (-2410.157) * (-2407.664) (-2402.054) [-2406.798] (-2407.636) -- 0:03:05 471000 -- (-2403.458) (-2410.029) (-2401.067) [-2401.838] * (-2404.338) [-2398.543] (-2399.732) (-2410.251) -- 0:03:05 471500 -- (-2404.347) (-2399.307) [-2401.650] (-2403.990) * (-2400.552) [-2398.023] (-2404.398) (-2400.471) -- 0:03:06 472000 -- [-2400.212] (-2401.050) (-2412.051) (-2401.593) * (-2403.424) [-2406.227] (-2400.260) (-2402.109) -- 0:03:05 472500 -- (-2404.018) (-2402.406) (-2405.745) [-2400.091] * (-2407.286) (-2414.002) (-2408.544) [-2397.062] -- 0:03:05 473000 -- (-2410.090) [-2402.034] (-2399.974) (-2407.267) * (-2409.067) (-2405.851) (-2413.238) [-2401.766] -- 0:03:04 473500 -- (-2403.694) (-2405.587) [-2398.210] (-2406.466) * (-2408.364) (-2395.773) (-2400.380) [-2401.564] -- 0:03:04 474000 -- (-2402.388) (-2407.704) [-2400.020] (-2409.584) * [-2406.513] (-2401.756) (-2401.230) (-2397.487) -- 0:03:04 474500 -- (-2412.859) [-2407.872] (-2407.079) (-2408.048) * [-2401.588] (-2405.163) (-2402.716) (-2402.925) -- 0:03:04 475000 -- (-2409.434) (-2406.791) [-2402.133] (-2404.482) * (-2402.196) [-2399.734] (-2404.854) (-2403.516) -- 0:03:04 Average standard deviation of split frequencies: 0.015251 475500 -- (-2403.433) (-2406.756) [-2408.989] (-2408.118) * (-2398.586) (-2400.101) (-2404.682) [-2399.968] -- 0:03:04 476000 -- [-2402.089] (-2407.040) (-2407.324) (-2400.089) * [-2404.555] (-2400.141) (-2404.735) (-2403.688) -- 0:03:03 476500 -- (-2401.029) (-2402.544) (-2398.627) [-2408.403] * (-2404.115) [-2398.055] (-2411.651) (-2404.352) -- 0:03:03 477000 -- (-2411.770) (-2409.622) [-2401.670] (-2401.261) * (-2404.971) [-2403.681] (-2406.992) (-2408.373) -- 0:03:03 477500 -- (-2407.459) (-2399.443) (-2397.196) [-2405.192] * (-2403.393) [-2400.138] (-2400.933) (-2414.109) -- 0:03:03 478000 -- (-2405.972) (-2407.250) [-2395.606] (-2404.456) * [-2406.417] (-2401.878) (-2400.605) (-2400.488) -- 0:03:03 478500 -- (-2398.357) [-2404.418] (-2408.974) (-2407.164) * (-2398.411) (-2404.322) [-2403.736] (-2402.425) -- 0:03:03 479000 -- (-2399.607) [-2396.807] (-2403.427) (-2406.465) * [-2404.557] (-2408.403) (-2398.200) (-2406.767) -- 0:03:02 479500 -- [-2402.908] (-2407.674) (-2400.906) (-2400.697) * (-2411.433) [-2406.418] (-2405.028) (-2407.409) -- 0:03:02 480000 -- (-2405.989) (-2400.477) (-2402.910) [-2409.676] * (-2410.631) (-2404.643) [-2401.179] (-2404.527) -- 0:03:03 Average standard deviation of split frequencies: 0.015299 480500 -- (-2398.537) [-2401.982] (-2402.490) (-2403.900) * (-2410.336) (-2405.286) (-2408.316) [-2399.655] -- 0:03:02 481000 -- (-2404.849) (-2404.759) (-2407.392) [-2396.920] * (-2399.948) [-2402.254] (-2410.391) (-2406.165) -- 0:03:02 481500 -- (-2410.263) (-2414.077) [-2400.821] (-2404.505) * [-2405.563] (-2401.885) (-2410.425) (-2406.198) -- 0:03:01 482000 -- (-2404.356) (-2402.769) [-2400.184] (-2403.450) * (-2403.839) (-2408.242) [-2414.331] (-2404.234) -- 0:03:01 482500 -- (-2405.295) (-2398.200) [-2400.451] (-2404.482) * (-2401.290) (-2400.228) (-2402.586) [-2403.188] -- 0:03:01 483000 -- [-2405.416] (-2401.864) (-2411.790) (-2400.550) * (-2408.815) (-2407.064) [-2405.531] (-2410.734) -- 0:03:01 483500 -- (-2406.074) (-2400.935) (-2420.380) [-2403.819] * (-2409.225) (-2402.515) [-2401.653] (-2407.479) -- 0:03:01 484000 -- (-2410.270) [-2404.773] (-2408.383) (-2406.566) * [-2406.529] (-2399.631) (-2409.715) (-2401.406) -- 0:03:01 484500 -- (-2413.129) (-2404.164) (-2401.312) [-2400.304] * (-2400.396) (-2417.035) [-2399.445] (-2407.715) -- 0:03:00 485000 -- (-2411.216) (-2404.700) [-2403.361] (-2409.391) * (-2412.241) [-2401.801] (-2404.057) (-2400.949) -- 0:03:00 Average standard deviation of split frequencies: 0.013968 485500 -- (-2405.671) [-2403.777] (-2409.284) (-2401.184) * (-2405.294) (-2396.349) (-2403.079) [-2405.646] -- 0:03:00 486000 -- (-2407.284) (-2407.414) (-2403.884) [-2406.636] * (-2408.132) [-2400.203] (-2404.988) (-2404.636) -- 0:03:00 486500 -- [-2407.105] (-2399.750) (-2406.257) (-2400.106) * (-2401.080) (-2401.035) (-2403.325) [-2403.650] -- 0:03:00 487000 -- (-2406.695) (-2401.917) (-2404.155) [-2397.893] * (-2403.349) (-2410.062) (-2403.052) [-2405.937] -- 0:03:00 487500 -- (-2413.034) [-2398.500] (-2405.065) (-2399.024) * (-2403.973) [-2404.650] (-2401.675) (-2401.129) -- 0:02:59 488000 -- [-2407.702] (-2400.019) (-2401.354) (-2402.279) * (-2410.333) (-2406.223) [-2401.027] (-2401.431) -- 0:02:59 488500 -- (-2407.266) (-2408.916) (-2401.961) [-2402.759] * (-2404.925) (-2406.884) [-2408.654] (-2407.097) -- 0:03:00 489000 -- (-2405.901) [-2403.286] (-2409.636) (-2404.445) * [-2406.616] (-2401.350) (-2408.121) (-2407.683) -- 0:02:59 489500 -- (-2397.764) (-2400.399) (-2407.670) [-2403.381] * [-2400.891] (-2401.675) (-2409.395) (-2406.995) -- 0:02:59 490000 -- [-2403.656] (-2405.645) (-2412.690) (-2402.059) * [-2394.269] (-2399.282) (-2401.930) (-2402.379) -- 0:02:59 Average standard deviation of split frequencies: 0.012298 490500 -- [-2401.140] (-2411.612) (-2402.657) (-2407.500) * (-2406.855) [-2399.318] (-2404.060) (-2403.211) -- 0:02:58 491000 -- (-2407.835) (-2401.268) [-2395.813] (-2399.887) * (-2418.908) [-2403.125] (-2406.991) (-2399.760) -- 0:02:58 491500 -- (-2403.985) (-2401.773) [-2399.237] (-2399.531) * (-2404.033) (-2405.119) [-2400.178] (-2402.306) -- 0:02:58 492000 -- [-2409.114] (-2410.439) (-2406.030) (-2399.434) * (-2399.307) (-2407.201) (-2411.519) [-2406.201] -- 0:02:58 492500 -- [-2407.990] (-2403.047) (-2402.805) (-2402.925) * [-2399.409] (-2404.147) (-2407.576) (-2406.868) -- 0:02:58 493000 -- (-2414.663) [-2404.880] (-2407.337) (-2400.241) * (-2403.203) [-2402.023] (-2411.225) (-2403.019) -- 0:02:57 493500 -- (-2407.784) (-2414.397) (-2398.352) [-2397.858] * (-2400.371) [-2402.785] (-2407.432) (-2403.527) -- 0:02:57 494000 -- [-2395.986] (-2401.545) (-2399.810) (-2407.300) * (-2405.143) [-2403.583] (-2402.836) (-2405.603) -- 0:02:58 494500 -- (-2407.204) (-2410.030) [-2403.207] (-2411.343) * (-2400.272) (-2400.364) [-2404.992] (-2406.401) -- 0:02:57 495000 -- (-2405.162) (-2403.967) (-2412.407) [-2405.484] * (-2404.205) (-2396.110) (-2408.991) [-2401.026] -- 0:02:57 Average standard deviation of split frequencies: 0.010264 495500 -- (-2401.007) (-2402.769) [-2405.402] (-2402.399) * (-2412.472) (-2399.727) [-2408.127] (-2398.481) -- 0:02:57 496000 -- (-2411.057) [-2403.477] (-2403.259) (-2408.383) * (-2401.875) (-2403.120) (-2403.079) [-2408.590] -- 0:02:56 496500 -- (-2401.780) [-2401.560] (-2402.959) (-2409.283) * (-2408.171) (-2407.587) (-2405.503) [-2405.627] -- 0:02:56 497000 -- (-2402.476) (-2396.961) [-2401.722] (-2405.195) * (-2406.283) [-2400.906] (-2411.847) (-2403.715) -- 0:02:57 497500 -- (-2412.714) (-2406.558) [-2402.749] (-2400.863) * (-2420.697) (-2404.824) (-2404.709) [-2402.813] -- 0:02:56 498000 -- (-2407.809) [-2400.271] (-2405.579) (-2413.468) * [-2404.681] (-2405.558) (-2408.538) (-2399.231) -- 0:02:56 498500 -- (-2401.432) (-2402.547) (-2402.949) [-2403.533] * (-2403.924) (-2398.673) [-2401.686] (-2401.057) -- 0:02:56 499000 -- (-2401.942) [-2399.130] (-2405.923) (-2400.905) * (-2408.116) (-2401.208) (-2404.355) [-2402.687] -- 0:02:55 499500 -- (-2403.183) [-2402.421] (-2406.165) (-2407.313) * (-2405.659) (-2401.950) [-2396.902] (-2400.924) -- 0:02:55 500000 -- (-2409.132) (-2399.247) (-2411.872) [-2397.284] * (-2403.807) (-2402.748) (-2401.242) [-2401.318] -- 0:02:56 Average standard deviation of split frequencies: 0.008662 500500 -- [-2400.368] (-2399.335) (-2414.840) (-2405.452) * (-2398.447) (-2400.728) (-2409.348) [-2404.360] -- 0:02:55 501000 -- [-2403.473] (-2401.899) (-2404.334) (-2409.705) * (-2403.204) (-2404.506) [-2400.344] (-2399.338) -- 0:02:55 501500 -- [-2400.185] (-2401.023) (-2400.848) (-2406.544) * (-2403.765) (-2401.964) (-2406.850) [-2399.359] -- 0:02:54 502000 -- (-2403.889) (-2405.926) [-2401.713] (-2409.036) * (-2402.166) [-2400.179] (-2410.797) (-2406.033) -- 0:02:54 502500 -- [-2401.241] (-2401.680) (-2402.696) (-2402.903) * (-2408.933) [-2394.879] (-2408.408) (-2403.384) -- 0:02:54 503000 -- (-2413.183) (-2405.127) (-2412.909) [-2403.244] * (-2409.327) [-2402.705] (-2402.938) (-2402.936) -- 0:02:54 503500 -- (-2399.687) (-2403.118) [-2408.640] (-2398.815) * (-2414.076) (-2402.827) (-2401.651) [-2397.993] -- 0:02:54 504000 -- (-2403.578) (-2404.819) [-2407.411] (-2404.410) * (-2405.555) (-2405.915) (-2405.220) [-2406.550] -- 0:02:54 504500 -- (-2400.659) (-2405.776) (-2405.712) [-2404.391] * (-2397.320) (-2407.241) [-2406.475] (-2406.904) -- 0:02:53 505000 -- [-2403.680] (-2402.734) (-2404.947) (-2400.631) * [-2411.656] (-2399.959) (-2403.357) (-2414.889) -- 0:02:53 Average standard deviation of split frequencies: 0.008944 505500 -- (-2402.654) [-2400.756] (-2409.457) (-2404.742) * [-2409.890] (-2406.157) (-2403.889) (-2399.778) -- 0:02:54 506000 -- (-2402.954) (-2397.604) [-2405.804] (-2416.183) * (-2404.010) (-2399.391) (-2405.288) [-2403.508] -- 0:02:53 506500 -- (-2401.748) [-2401.619] (-2401.336) (-2405.517) * (-2396.663) [-2405.900] (-2399.207) (-2400.887) -- 0:02:53 507000 -- (-2398.272) (-2404.390) [-2404.027] (-2405.950) * (-2403.975) (-2406.992) [-2398.490] (-2405.605) -- 0:02:53 507500 -- (-2406.995) (-2401.340) [-2397.627] (-2406.184) * (-2403.646) [-2418.732] (-2401.580) (-2407.310) -- 0:02:52 508000 -- (-2400.536) (-2405.074) [-2403.878] (-2408.351) * (-2407.704) (-2402.274) [-2403.275] (-2406.684) -- 0:02:52 508500 -- (-2410.723) (-2409.104) (-2405.439) [-2404.860] * (-2408.875) [-2402.043] (-2402.193) (-2401.188) -- 0:02:53 509000 -- (-2408.016) [-2405.724] (-2408.546) (-2412.702) * [-2400.679] (-2403.454) (-2402.648) (-2404.225) -- 0:02:52 509500 -- [-2397.715] (-2400.025) (-2408.055) (-2395.437) * [-2404.488] (-2404.507) (-2402.540) (-2406.425) -- 0:02:52 510000 -- (-2407.205) [-2407.871] (-2401.706) (-2401.817) * (-2414.672) (-2414.816) (-2402.014) [-2402.399] -- 0:02:51 Average standard deviation of split frequencies: 0.008493 510500 -- (-2402.311) (-2397.175) (-2398.252) [-2403.394] * [-2402.148] (-2403.041) (-2401.960) (-2400.519) -- 0:02:51 511000 -- (-2409.817) (-2400.489) [-2400.283] (-2409.665) * (-2401.192) (-2406.354) [-2406.686] (-2406.943) -- 0:02:51 511500 -- (-2397.745) [-2407.338] (-2407.099) (-2400.125) * (-2399.826) (-2407.433) [-2399.675] (-2402.148) -- 0:02:51 512000 -- (-2406.691) [-2408.843] (-2404.500) (-2407.462) * (-2404.690) (-2404.609) [-2404.233] (-2402.502) -- 0:02:51 512500 -- (-2404.542) [-2405.029] (-2401.715) (-2403.777) * [-2404.645] (-2406.660) (-2395.346) (-2406.518) -- 0:02:51 513000 -- (-2407.942) (-2408.838) [-2409.624] (-2406.228) * (-2413.260) (-2399.941) [-2407.075] (-2407.875) -- 0:02:50 513500 -- [-2408.151] (-2405.412) (-2402.259) (-2404.270) * (-2403.035) (-2403.868) (-2409.554) [-2402.670] -- 0:02:50 514000 -- (-2398.416) [-2405.241] (-2403.431) (-2399.586) * (-2401.401) (-2406.055) [-2406.775] (-2402.070) -- 0:02:50 514500 -- (-2403.965) (-2426.226) [-2405.089] (-2410.116) * (-2405.530) (-2413.644) [-2408.868] (-2405.760) -- 0:02:50 515000 -- (-2403.207) (-2409.727) [-2403.300] (-2406.761) * (-2401.197) (-2407.432) [-2400.971] (-2407.120) -- 0:02:50 Average standard deviation of split frequencies: 0.008405 515500 -- [-2410.302] (-2403.766) (-2404.042) (-2411.978) * (-2400.448) (-2408.431) (-2404.720) [-2407.912] -- 0:02:50 516000 -- (-2419.898) (-2403.564) [-2401.077] (-2406.635) * (-2403.381) (-2406.573) (-2399.637) [-2399.832] -- 0:02:49 516500 -- (-2411.928) [-2409.811] (-2404.172) (-2407.483) * (-2401.789) (-2406.630) (-2409.850) [-2398.072] -- 0:02:49 517000 -- (-2404.596) [-2401.996] (-2403.527) (-2412.867) * (-2399.842) (-2412.905) (-2408.475) [-2402.742] -- 0:02:50 517500 -- (-2405.146) [-2397.287] (-2409.961) (-2401.583) * (-2401.730) [-2406.080] (-2399.611) (-2403.914) -- 0:02:49 518000 -- [-2404.858] (-2412.483) (-2405.037) (-2406.987) * (-2402.297) [-2409.799] (-2405.704) (-2401.797) -- 0:02:49 518500 -- (-2404.222) (-2402.822) (-2405.625) [-2403.964] * (-2400.597) (-2411.807) [-2400.783] (-2405.488) -- 0:02:49 519000 -- (-2402.115) [-2411.240] (-2404.655) (-2397.820) * (-2404.928) (-2403.007) (-2403.621) [-2404.094] -- 0:02:48 519500 -- (-2407.587) (-2408.254) [-2401.575] (-2413.622) * [-2405.045] (-2402.499) (-2402.828) (-2406.054) -- 0:02:48 520000 -- (-2402.030) (-2406.412) [-2411.015] (-2407.770) * [-2401.301] (-2402.682) (-2404.260) (-2407.461) -- 0:02:48 Average standard deviation of split frequencies: 0.009416 520500 -- (-2410.670) [-2400.141] (-2403.929) (-2410.495) * (-2398.682) (-2403.400) [-2396.881] (-2406.265) -- 0:02:48 521000 -- (-2413.504) (-2407.982) (-2400.197) [-2408.626] * (-2401.086) (-2400.658) [-2400.688] (-2407.834) -- 0:02:48 521500 -- (-2404.009) (-2411.482) (-2399.506) [-2400.222] * (-2401.990) [-2403.741] (-2408.626) (-2398.170) -- 0:02:47 522000 -- (-2409.224) (-2402.414) [-2405.344] (-2404.886) * [-2400.369] (-2406.750) (-2399.297) (-2399.055) -- 0:02:47 522500 -- (-2416.682) (-2414.576) (-2406.062) [-2397.469] * (-2406.935) [-2399.406] (-2403.156) (-2407.410) -- 0:02:47 523000 -- (-2413.956) [-2403.903] (-2400.646) (-2405.713) * (-2405.673) (-2410.004) [-2404.750] (-2406.616) -- 0:02:47 523500 -- (-2411.955) (-2413.181) (-2399.698) [-2399.364] * (-2412.337) (-2406.880) [-2397.724] (-2406.086) -- 0:02:47 524000 -- (-2413.140) (-2400.429) (-2404.473) [-2401.805] * [-2411.637] (-2412.112) (-2397.992) (-2404.372) -- 0:02:47 524500 -- (-2411.825) (-2412.822) (-2398.620) [-2400.400] * (-2409.772) (-2410.250) (-2401.729) [-2402.843] -- 0:02:46 525000 -- (-2410.580) [-2401.698] (-2401.591) (-2401.828) * [-2406.408] (-2401.540) (-2407.580) (-2402.424) -- 0:02:46 Average standard deviation of split frequencies: 0.008245 525500 -- (-2406.184) (-2401.656) [-2410.586] (-2399.716) * (-2401.588) (-2399.656) [-2404.273] (-2405.303) -- 0:02:46 526000 -- [-2406.752] (-2398.457) (-2411.248) (-2407.458) * (-2409.337) (-2407.571) [-2406.128] (-2407.045) -- 0:02:46 526500 -- (-2402.819) [-2404.918] (-2415.189) (-2407.465) * (-2404.948) (-2399.087) [-2402.731] (-2409.270) -- 0:02:46 527000 -- (-2401.853) [-2399.836] (-2397.079) (-2408.800) * (-2409.155) (-2407.496) (-2405.211) [-2399.567] -- 0:02:46 527500 -- (-2401.688) [-2400.485] (-2401.815) (-2401.489) * (-2409.325) [-2400.879] (-2399.660) (-2415.219) -- 0:02:45 528000 -- [-2408.158] (-2402.198) (-2400.383) (-2399.575) * [-2406.452] (-2397.713) (-2403.718) (-2398.613) -- 0:02:45 528500 -- (-2406.673) (-2410.040) (-2415.375) [-2400.545] * (-2407.614) (-2403.499) (-2414.572) [-2403.957] -- 0:02:45 529000 -- (-2407.954) (-2406.459) (-2406.875) [-2398.633] * (-2399.624) [-2409.516] (-2399.123) (-2408.795) -- 0:02:45 529500 -- [-2400.845] (-2403.252) (-2403.466) (-2402.323) * (-2406.937) (-2405.139) [-2405.301] (-2411.740) -- 0:02:45 530000 -- (-2405.749) (-2407.634) [-2402.774] (-2402.887) * (-2410.992) [-2399.809] (-2399.612) (-2411.801) -- 0:02:44 Average standard deviation of split frequencies: 0.008528 530500 -- (-2399.006) (-2415.935) [-2399.563] (-2398.540) * [-2399.176] (-2409.026) (-2407.048) (-2404.262) -- 0:02:44 531000 -- (-2399.636) (-2402.822) (-2403.823) [-2408.522] * (-2402.919) (-2400.940) [-2412.967] (-2406.456) -- 0:02:44 531500 -- (-2402.069) [-2402.952] (-2405.294) (-2405.542) * (-2407.128) (-2426.590) (-2411.491) [-2408.451] -- 0:02:44 532000 -- [-2396.850] (-2400.168) (-2408.471) (-2401.862) * (-2401.649) (-2404.300) (-2399.769) [-2400.781] -- 0:02:44 532500 -- [-2402.881] (-2406.115) (-2400.644) (-2410.341) * [-2404.086] (-2408.729) (-2399.181) (-2407.600) -- 0:02:44 533000 -- (-2407.002) (-2402.372) (-2406.617) [-2405.147] * (-2408.724) (-2405.367) [-2404.497] (-2401.335) -- 0:02:43 533500 -- (-2406.165) (-2399.314) [-2403.827] (-2404.027) * (-2409.196) [-2405.161] (-2403.476) (-2404.352) -- 0:02:43 534000 -- (-2403.729) (-2408.319) (-2397.966) [-2403.680] * (-2406.879) (-2403.955) (-2400.957) [-2405.545] -- 0:02:43 534500 -- (-2405.513) (-2403.019) [-2405.971] (-2401.292) * (-2402.115) [-2402.763] (-2402.177) (-2404.911) -- 0:02:43 535000 -- (-2412.298) (-2400.544) [-2408.962] (-2403.345) * (-2406.352) [-2399.043] (-2412.922) (-2405.069) -- 0:02:43 Average standard deviation of split frequencies: 0.008443 535500 -- (-2403.604) [-2400.326] (-2413.174) (-2406.005) * (-2399.394) (-2402.040) [-2395.976] (-2405.183) -- 0:02:43 536000 -- (-2406.910) (-2402.311) (-2398.894) [-2403.732] * (-2395.686) (-2407.848) [-2399.779] (-2408.675) -- 0:02:42 536500 -- (-2402.683) [-2401.097] (-2398.127) (-2404.268) * (-2403.349) (-2402.643) [-2401.486] (-2407.412) -- 0:02:42 537000 -- (-2407.889) [-2401.905] (-2407.602) (-2405.434) * [-2405.639] (-2402.242) (-2406.607) (-2405.028) -- 0:02:42 537500 -- (-2401.127) (-2402.397) [-2402.643] (-2403.347) * (-2414.390) (-2414.109) [-2401.615] (-2403.131) -- 0:02:42 538000 -- [-2399.957] (-2401.545) (-2395.719) (-2400.658) * (-2409.002) (-2408.852) [-2404.748] (-2400.060) -- 0:02:42 538500 -- (-2404.084) (-2400.378) (-2404.530) [-2400.551] * (-2414.996) (-2406.032) [-2404.290] (-2398.896) -- 0:02:41 539000 -- (-2396.916) (-2403.973) (-2400.852) [-2406.679] * (-2401.046) (-2409.798) [-2398.927] (-2400.473) -- 0:02:41 539500 -- (-2408.847) (-2401.395) [-2400.939] (-2408.621) * [-2404.427] (-2408.833) (-2401.483) (-2404.500) -- 0:02:41 540000 -- (-2411.890) (-2405.880) (-2404.239) [-2405.004] * (-2400.977) (-2404.476) (-2409.438) [-2401.524] -- 0:02:41 Average standard deviation of split frequencies: 0.008021 540500 -- (-2406.939) [-2400.344] (-2404.885) (-2405.234) * [-2401.720] (-2409.236) (-2400.251) (-2399.372) -- 0:02:41 541000 -- (-2406.962) (-2407.075) (-2399.674) [-2400.033] * (-2405.094) (-2407.014) [-2408.242] (-2402.355) -- 0:02:41 541500 -- (-2396.069) (-2398.630) (-2403.626) [-2405.359] * (-2402.868) [-2410.019] (-2406.810) (-2411.477) -- 0:02:40 542000 -- (-2398.060) [-2405.630] (-2401.747) (-2402.981) * (-2401.332) (-2407.176) [-2402.289] (-2407.406) -- 0:02:40 542500 -- (-2405.684) (-2408.878) [-2399.421] (-2396.259) * [-2410.653] (-2403.366) (-2403.254) (-2396.618) -- 0:02:40 543000 -- [-2400.768] (-2403.432) (-2397.534) (-2403.280) * [-2406.144] (-2405.466) (-2401.024) (-2402.231) -- 0:02:40 543500 -- (-2399.666) [-2401.044] (-2402.877) (-2408.797) * [-2406.717] (-2406.419) (-2409.896) (-2406.215) -- 0:02:40 544000 -- (-2408.796) (-2403.071) [-2400.225] (-2405.388) * (-2411.426) (-2405.536) (-2406.300) [-2409.014] -- 0:02:40 544500 -- (-2402.347) [-2397.691] (-2410.403) (-2407.798) * (-2405.685) [-2404.067] (-2404.546) (-2407.520) -- 0:02:39 545000 -- (-2409.563) [-2400.663] (-2405.800) (-2418.795) * (-2411.018) (-2400.172) [-2405.963] (-2398.693) -- 0:02:39 Average standard deviation of split frequencies: 0.008288 545500 -- (-2412.056) [-2404.302] (-2405.638) (-2408.968) * (-2407.517) [-2403.311] (-2412.678) (-2402.566) -- 0:02:39 546000 -- [-2408.131] (-2401.289) (-2400.874) (-2413.971) * (-2402.377) (-2404.659) (-2414.665) [-2402.798] -- 0:02:39 546500 -- [-2405.689] (-2407.192) (-2406.605) (-2409.124) * (-2407.634) [-2406.193] (-2399.521) (-2405.460) -- 0:02:39 547000 -- (-2401.915) [-2399.221] (-2414.177) (-2409.911) * (-2413.086) [-2399.098] (-2407.428) (-2401.628) -- 0:02:39 547500 -- (-2402.244) (-2407.707) (-2412.129) [-2400.073] * (-2405.116) (-2403.537) [-2405.350] (-2401.861) -- 0:02:38 548000 -- [-2403.856] (-2404.466) (-2402.455) (-2406.845) * (-2411.069) (-2400.039) [-2400.062] (-2404.221) -- 0:02:38 548500 -- (-2406.393) (-2407.740) (-2404.834) [-2410.007] * (-2409.371) (-2409.426) (-2404.287) [-2408.292] -- 0:02:38 549000 -- (-2403.115) (-2410.818) (-2405.658) [-2408.112] * [-2411.262] (-2403.157) (-2402.917) (-2404.665) -- 0:02:38 549500 -- (-2403.200) [-2405.798] (-2403.389) (-2401.844) * (-2402.447) (-2410.753) (-2406.134) [-2403.829] -- 0:02:38 550000 -- (-2402.788) (-2404.464) [-2401.424] (-2407.371) * (-2404.160) (-2403.960) (-2401.111) [-2404.397] -- 0:02:37 Average standard deviation of split frequencies: 0.008561 550500 -- (-2399.139) (-2403.483) (-2399.987) [-2399.886] * (-2408.072) (-2412.539) (-2402.878) [-2400.868] -- 0:02:37 551000 -- [-2397.034] (-2404.259) (-2402.823) (-2400.167) * [-2402.057] (-2399.683) (-2405.115) (-2406.641) -- 0:02:37 551500 -- (-2403.742) (-2400.119) (-2399.553) [-2405.991] * (-2404.448) (-2406.425) (-2402.985) [-2399.775] -- 0:02:36 552000 -- [-2401.817] (-2400.675) (-2404.236) (-2398.887) * [-2399.334] (-2404.923) (-2405.042) (-2400.262) -- 0:02:37 552500 -- (-2407.279) [-2396.672] (-2404.751) (-2403.857) * [-2398.926] (-2408.504) (-2404.384) (-2401.920) -- 0:02:37 553000 -- (-2412.235) [-2401.568] (-2402.409) (-2405.488) * [-2400.187] (-2398.267) (-2419.952) (-2402.083) -- 0:02:36 553500 -- (-2405.791) [-2409.317] (-2398.209) (-2402.173) * (-2406.980) (-2409.224) [-2401.683] (-2401.569) -- 0:02:36 554000 -- (-2404.216) (-2413.804) [-2398.865] (-2397.722) * (-2406.215) (-2399.487) [-2408.637] (-2405.857) -- 0:02:36 554500 -- (-2407.520) (-2403.965) (-2409.376) [-2404.141] * (-2404.050) [-2404.672] (-2402.524) (-2409.047) -- 0:02:36 555000 -- (-2413.336) (-2402.887) (-2404.669) [-2404.290] * [-2395.882] (-2405.206) (-2406.329) (-2409.889) -- 0:02:36 Average standard deviation of split frequencies: 0.009496 555500 -- (-2408.954) (-2405.713) (-2401.885) [-2398.465] * (-2404.770) (-2406.234) (-2401.288) [-2406.036] -- 0:02:36 556000 -- [-2403.014] (-2398.652) (-2407.233) (-2401.322) * [-2401.792] (-2401.680) (-2397.024) (-2409.905) -- 0:02:35 556500 -- (-2408.455) (-2404.953) (-2404.943) [-2407.841] * [-2402.178] (-2410.094) (-2411.063) (-2401.603) -- 0:02:35 557000 -- (-2406.381) (-2399.647) (-2409.047) [-2404.548] * [-2402.005] (-2404.027) (-2409.191) (-2412.947) -- 0:02:35 557500 -- (-2404.801) (-2400.107) (-2410.689) [-2399.740] * (-2401.331) (-2402.430) [-2411.273] (-2401.441) -- 0:02:35 558000 -- (-2405.311) (-2404.586) [-2402.236] (-2402.690) * [-2404.675] (-2406.213) (-2406.546) (-2401.340) -- 0:02:35 558500 -- (-2410.525) (-2398.029) [-2403.583] (-2402.390) * (-2405.400) (-2407.540) [-2403.959] (-2404.347) -- 0:02:34 559000 -- (-2409.040) [-2398.603] (-2402.127) (-2404.965) * (-2409.368) (-2406.357) [-2403.460] (-2404.831) -- 0:02:34 559500 -- (-2407.310) (-2404.516) [-2409.213] (-2409.123) * (-2408.453) [-2401.791] (-2405.995) (-2402.441) -- 0:02:34 560000 -- (-2399.189) [-2402.699] (-2404.147) (-2399.345) * (-2404.615) (-2400.442) (-2403.737) [-2403.880] -- 0:02:34 Average standard deviation of split frequencies: 0.009417 560500 -- (-2403.996) (-2400.404) (-2415.468) [-2403.012] * (-2400.560) (-2403.371) [-2399.047] (-2402.206) -- 0:02:34 561000 -- [-2401.620] (-2411.578) (-2412.988) (-2402.386) * (-2409.584) [-2400.586] (-2399.018) (-2415.061) -- 0:02:34 561500 -- [-2401.170] (-2402.220) (-2404.969) (-2404.191) * (-2405.833) (-2404.229) (-2397.876) [-2403.724] -- 0:02:33 562000 -- (-2404.961) (-2400.938) [-2409.849] (-2404.394) * (-2409.799) (-2412.617) [-2395.789] (-2408.470) -- 0:02:33 562500 -- (-2407.722) (-2404.085) (-2406.829) [-2399.953] * (-2407.536) (-2400.403) [-2402.969] (-2406.748) -- 0:02:33 563000 -- (-2400.088) (-2405.696) [-2404.613] (-2397.346) * (-2403.400) (-2403.623) (-2402.512) [-2402.212] -- 0:02:32 563500 -- (-2402.960) (-2402.399) (-2400.084) [-2405.864] * (-2408.374) (-2402.599) [-2402.326] (-2399.946) -- 0:02:33 564000 -- (-2408.809) (-2404.396) (-2403.475) [-2400.298] * (-2407.154) (-2401.989) (-2407.180) [-2404.704] -- 0:02:33 564500 -- (-2402.472) (-2401.845) (-2400.278) [-2404.394] * [-2400.439] (-2397.843) (-2405.139) (-2399.571) -- 0:02:32 565000 -- [-2396.929] (-2403.995) (-2402.760) (-2397.845) * (-2406.605) (-2405.358) [-2406.420] (-2404.249) -- 0:02:32 Average standard deviation of split frequencies: 0.010328 565500 -- (-2402.388) [-2399.094] (-2413.703) (-2400.538) * (-2405.537) (-2407.927) (-2398.187) [-2402.560] -- 0:02:32 566000 -- (-2397.966) [-2402.453] (-2405.124) (-2403.938) * [-2398.491] (-2409.134) (-2405.453) (-2400.962) -- 0:02:32 566500 -- (-2403.052) (-2414.498) [-2401.898] (-2405.670) * (-2403.017) [-2398.114] (-2404.266) (-2403.786) -- 0:02:32 567000 -- (-2404.907) (-2404.581) [-2409.078] (-2404.680) * (-2399.013) (-2410.576) (-2399.674) [-2405.658] -- 0:02:31 567500 -- (-2404.578) (-2407.747) [-2406.429] (-2409.781) * (-2401.958) (-2410.322) (-2409.837) [-2403.461] -- 0:02:31 568000 -- [-2400.642] (-2404.437) (-2401.002) (-2400.512) * (-2405.856) (-2406.767) [-2403.475] (-2405.028) -- 0:02:31 568500 -- (-2407.012) (-2409.275) [-2410.587] (-2403.023) * (-2406.923) (-2412.759) [-2398.058] (-2406.596) -- 0:02:31 569000 -- (-2408.162) [-2401.651] (-2399.688) (-2400.816) * [-2402.443] (-2401.353) (-2407.245) (-2409.246) -- 0:02:31 569500 -- (-2399.413) [-2404.286] (-2409.169) (-2402.630) * (-2412.864) (-2402.874) [-2398.729] (-2402.334) -- 0:02:31 570000 -- [-2404.911] (-2397.721) (-2405.268) (-2403.047) * (-2409.604) [-2396.833] (-2404.801) (-2403.379) -- 0:02:30 Average standard deviation of split frequencies: 0.009252 570500 -- (-2408.372) [-2398.847] (-2413.729) (-2407.297) * (-2406.523) [-2401.367] (-2403.198) (-2404.150) -- 0:02:30 571000 -- (-2404.158) [-2398.965] (-2399.530) (-2403.812) * [-2396.301] (-2404.139) (-2401.752) (-2408.218) -- 0:02:30 571500 -- (-2401.115) [-2402.448] (-2407.654) (-2410.268) * (-2411.249) (-2406.423) [-2403.346] (-2414.655) -- 0:02:29 572000 -- (-2397.850) (-2402.656) (-2405.239) [-2401.327] * (-2398.259) (-2400.013) [-2402.509] (-2407.329) -- 0:02:30 572500 -- [-2405.723] (-2399.630) (-2397.351) (-2405.019) * (-2404.711) (-2399.738) [-2401.593] (-2404.439) -- 0:02:30 573000 -- (-2407.701) (-2400.846) [-2402.920] (-2405.266) * (-2399.872) [-2399.142] (-2402.383) (-2407.528) -- 0:02:29 573500 -- [-2404.660] (-2399.526) (-2402.998) (-2406.176) * (-2402.477) [-2404.049] (-2403.707) (-2411.509) -- 0:02:29 574000 -- (-2406.601) (-2403.599) [-2403.792] (-2414.919) * (-2398.039) (-2410.031) [-2410.663] (-2409.071) -- 0:02:29 574500 -- [-2404.271] (-2403.529) (-2403.665) (-2406.504) * (-2406.593) (-2400.457) (-2406.523) [-2401.423] -- 0:02:28 575000 -- [-2404.936] (-2412.366) (-2405.146) (-2405.552) * (-2406.768) [-2404.588] (-2403.472) (-2398.628) -- 0:02:29 Average standard deviation of split frequencies: 0.007857 575500 -- (-2398.551) [-2412.542] (-2407.623) (-2413.210) * (-2409.215) [-2403.620] (-2399.511) (-2408.310) -- 0:02:28 576000 -- (-2406.991) (-2396.565) [-2397.913] (-2400.331) * (-2401.163) [-2399.749] (-2401.420) (-2409.648) -- 0:02:28 576500 -- (-2404.136) [-2407.931] (-2415.383) (-2397.511) * (-2401.567) (-2412.931) (-2401.014) [-2402.820] -- 0:02:28 577000 -- [-2394.711] (-2404.460) (-2405.932) (-2412.942) * (-2404.480) [-2401.137] (-2407.609) (-2407.011) -- 0:02:28 577500 -- (-2398.844) [-2402.215] (-2403.549) (-2410.101) * (-2402.578) (-2403.513) (-2404.976) [-2401.215] -- 0:02:27 578000 -- (-2400.503) (-2401.501) (-2410.097) [-2403.518] * (-2398.566) [-2400.759] (-2405.873) (-2399.840) -- 0:02:28 578500 -- [-2399.442] (-2398.002) (-2400.850) (-2406.627) * (-2405.771) (-2397.129) (-2402.819) [-2404.300] -- 0:02:27 579000 -- [-2396.759] (-2403.455) (-2410.189) (-2406.762) * (-2412.116) (-2408.298) [-2397.959] (-2401.784) -- 0:02:27 579500 -- (-2411.693) (-2399.737) [-2408.623] (-2412.567) * [-2406.822] (-2401.310) (-2404.219) (-2414.861) -- 0:02:27 580000 -- (-2401.891) [-2404.113] (-2410.625) (-2407.875) * (-2408.003) (-2405.099) [-2404.264] (-2412.184) -- 0:02:27 Average standard deviation of split frequencies: 0.008768 580500 -- (-2399.774) (-2403.077) [-2407.917] (-2413.447) * (-2406.243) (-2400.738) (-2399.319) [-2406.256] -- 0:02:27 581000 -- (-2405.124) [-2402.661] (-2415.714) (-2410.291) * (-2402.300) (-2402.337) (-2402.115) [-2412.395] -- 0:02:27 581500 -- [-2398.911] (-2400.303) (-2404.944) (-2404.640) * (-2399.940) (-2406.091) (-2405.360) [-2411.769] -- 0:02:26 582000 -- (-2405.343) (-2404.621) [-2402.498] (-2399.492) * (-2410.725) (-2403.592) [-2400.962] (-2404.251) -- 0:02:26 582500 -- (-2413.175) [-2406.076] (-2403.241) (-2405.116) * (-2406.577) [-2403.134] (-2408.143) (-2409.457) -- 0:02:26 583000 -- (-2403.295) (-2403.170) [-2400.354] (-2401.223) * [-2404.153] (-2401.241) (-2405.603) (-2403.816) -- 0:02:25 583500 -- [-2401.722] (-2412.241) (-2402.031) (-2401.851) * (-2409.942) (-2407.118) [-2402.203] (-2404.817) -- 0:02:26 584000 -- [-2411.283] (-2404.082) (-2401.276) (-2401.595) * (-2404.486) (-2406.991) [-2399.937] (-2405.874) -- 0:02:26 584500 -- (-2405.742) (-2415.089) (-2399.566) [-2402.121] * (-2407.355) [-2406.879] (-2413.363) (-2412.517) -- 0:02:25 585000 -- (-2405.592) [-2407.252] (-2401.022) (-2402.406) * [-2403.551] (-2401.161) (-2406.683) (-2407.006) -- 0:02:25 Average standard deviation of split frequencies: 0.009332 585500 -- (-2407.073) (-2415.086) (-2402.911) [-2406.942] * [-2401.276] (-2403.144) (-2406.427) (-2403.329) -- 0:02:25 586000 -- (-2405.489) (-2402.121) [-2404.001] (-2409.531) * (-2420.725) (-2395.382) [-2402.961] (-2401.082) -- 0:02:24 586500 -- (-2409.330) (-2401.349) (-2410.010) [-2402.089] * (-2419.018) (-2408.013) (-2402.602) [-2399.227] -- 0:02:25 587000 -- (-2401.721) [-2400.067] (-2401.419) (-2405.077) * [-2407.739] (-2402.172) (-2404.156) (-2403.417) -- 0:02:24 587500 -- (-2403.885) (-2411.266) [-2399.048] (-2398.775) * [-2410.839] (-2402.473) (-2405.856) (-2408.927) -- 0:02:24 588000 -- (-2397.347) [-2402.664] (-2404.701) (-2401.411) * (-2410.483) (-2401.073) (-2405.756) [-2400.970] -- 0:02:24 588500 -- (-2409.531) (-2401.298) [-2404.877] (-2409.895) * (-2399.736) (-2407.336) (-2400.383) [-2400.553] -- 0:02:24 589000 -- [-2398.855] (-2407.110) (-2402.723) (-2404.352) * (-2405.488) [-2407.477] (-2400.328) (-2402.811) -- 0:02:24 589500 -- (-2408.307) [-2398.108] (-2402.962) (-2416.294) * (-2401.667) (-2409.636) [-2397.925] (-2400.852) -- 0:02:24 590000 -- (-2405.434) (-2404.015) [-2407.353] (-2407.500) * [-2402.773] (-2399.742) (-2410.752) (-2399.449) -- 0:02:23 Average standard deviation of split frequencies: 0.008619 590500 -- (-2409.938) [-2403.752] (-2399.147) (-2408.148) * (-2404.534) (-2404.644) [-2403.011] (-2408.560) -- 0:02:23 591000 -- (-2405.313) (-2402.500) (-2399.583) [-2409.641] * (-2403.543) [-2400.853] (-2409.140) (-2410.331) -- 0:02:23 591500 -- [-2396.085] (-2403.450) (-2405.103) (-2404.048) * [-2403.242] (-2403.281) (-2402.544) (-2413.714) -- 0:02:22 592000 -- [-2398.881] (-2407.854) (-2404.075) (-2404.896) * (-2401.937) [-2399.267] (-2407.422) (-2400.059) -- 0:02:23 592500 -- (-2410.768) (-2404.830) (-2413.542) [-2405.152] * (-2403.422) [-2411.125] (-2404.407) (-2407.815) -- 0:02:23 593000 -- (-2401.003) (-2407.431) (-2405.294) [-2402.608] * (-2399.891) [-2395.327] (-2404.700) (-2408.361) -- 0:02:22 593500 -- [-2402.739] (-2411.624) (-2403.014) (-2403.643) * (-2403.411) [-2407.338] (-2405.522) (-2412.758) -- 0:02:22 594000 -- (-2417.184) (-2398.706) (-2403.415) [-2398.916] * (-2404.285) (-2401.526) [-2405.291] (-2401.988) -- 0:02:22 594500 -- (-2397.909) [-2399.201] (-2401.946) (-2396.829) * (-2403.504) [-2410.135] (-2406.424) (-2400.790) -- 0:02:21 595000 -- (-2405.583) (-2404.958) (-2407.055) [-2400.875] * (-2406.667) [-2406.979] (-2405.582) (-2399.934) -- 0:02:22 Average standard deviation of split frequencies: 0.007277 595500 -- (-2400.678) (-2408.370) [-2400.291] (-2404.490) * (-2413.224) [-2401.400] (-2407.821) (-2403.799) -- 0:02:21 596000 -- (-2408.501) [-2413.409] (-2403.764) (-2401.625) * [-2407.623] (-2402.156) (-2404.456) (-2401.485) -- 0:02:21 596500 -- (-2415.926) (-2411.122) (-2400.199) [-2396.860] * (-2403.330) (-2404.210) (-2403.377) [-2402.543] -- 0:02:21 597000 -- [-2403.632] (-2406.177) (-2407.512) (-2401.606) * (-2402.437) [-2406.152] (-2400.134) (-2402.306) -- 0:02:21 597500 -- (-2408.072) [-2402.266] (-2408.984) (-2402.657) * (-2409.288) (-2403.683) [-2401.486] (-2399.667) -- 0:02:21 598000 -- [-2399.679] (-2402.317) (-2405.634) (-2402.759) * [-2400.176] (-2412.244) (-2396.660) (-2407.744) -- 0:02:21 598500 -- (-2411.184) (-2406.103) (-2404.880) [-2400.490] * (-2408.324) (-2402.829) [-2406.423] (-2407.059) -- 0:02:20 599000 -- (-2402.900) (-2397.592) [-2400.238] (-2403.277) * (-2398.984) (-2403.439) [-2404.774] (-2407.631) -- 0:02:20 599500 -- [-2402.789] (-2403.720) (-2402.492) (-2410.957) * (-2401.044) (-2402.390) (-2407.693) [-2406.759] -- 0:02:20 600000 -- (-2403.552) [-2404.460] (-2401.910) (-2401.002) * (-2406.197) [-2405.206] (-2406.319) (-2407.084) -- 0:02:20 Average standard deviation of split frequencies: 0.006592 600500 -- (-2405.096) (-2408.248) [-2408.628] (-2396.388) * (-2405.617) [-2409.872] (-2403.447) (-2402.199) -- 0:02:20 601000 -- (-2412.914) (-2404.475) (-2405.206) [-2393.856] * (-2401.838) (-2400.799) [-2400.113] (-2401.610) -- 0:02:20 601500 -- (-2404.562) (-2410.147) (-2401.702) [-2405.171] * (-2405.952) (-2408.937) [-2406.407] (-2403.487) -- 0:02:19 602000 -- (-2405.924) (-2408.562) (-2397.006) [-2401.375] * (-2409.945) (-2398.768) [-2401.274] (-2399.604) -- 0:02:19 602500 -- (-2409.644) (-2401.287) [-2400.227] (-2408.927) * (-2404.135) (-2400.827) (-2402.360) [-2403.310] -- 0:02:19 603000 -- (-2402.633) (-2401.389) [-2399.947] (-2410.182) * (-2405.945) [-2395.962] (-2408.317) (-2404.295) -- 0:02:18 603500 -- (-2405.969) (-2401.738) [-2408.863] (-2414.219) * (-2402.233) (-2405.503) (-2406.121) [-2399.957] -- 0:02:19 604000 -- (-2401.229) (-2404.138) [-2407.796] (-2413.043) * (-2400.932) (-2400.621) [-2397.773] (-2404.074) -- 0:02:18 604500 -- (-2401.388) (-2406.504) [-2402.350] (-2416.457) * (-2402.196) (-2399.264) (-2403.102) [-2406.731] -- 0:02:18 605000 -- (-2401.077) (-2403.902) (-2400.903) [-2399.777] * (-2399.043) (-2400.872) [-2401.222] (-2408.398) -- 0:02:18 Average standard deviation of split frequencies: 0.007779 605500 -- (-2403.378) [-2400.270] (-2411.161) (-2407.796) * (-2404.527) (-2399.400) [-2406.661] (-2404.948) -- 0:02:18 606000 -- (-2404.530) (-2403.291) [-2400.299] (-2404.523) * (-2405.879) (-2402.179) (-2412.724) [-2400.110] -- 0:02:17 606500 -- [-2402.957] (-2400.928) (-2403.379) (-2408.926) * (-2402.177) (-2403.229) [-2401.400] (-2408.025) -- 0:02:18 607000 -- (-2409.140) [-2403.053] (-2401.917) (-2409.590) * (-2409.281) [-2405.374] (-2405.741) (-2403.271) -- 0:02:17 607500 -- (-2400.410) (-2403.094) (-2407.455) [-2397.540] * (-2408.296) (-2397.854) [-2406.788] (-2405.968) -- 0:02:17 608000 -- (-2403.046) (-2405.386) (-2405.218) [-2405.625] * (-2406.730) (-2403.675) [-2406.049] (-2401.697) -- 0:02:17 608500 -- (-2399.983) [-2400.478] (-2408.700) (-2400.428) * (-2400.779) (-2404.081) (-2405.858) [-2403.518] -- 0:02:17 609000 -- [-2397.901] (-2404.048) (-2407.777) (-2408.801) * (-2402.751) (-2401.986) (-2407.327) [-2399.569] -- 0:02:17 609500 -- (-2400.966) (-2406.822) (-2402.946) [-2403.821] * [-2402.653] (-2401.130) (-2402.110) (-2401.639) -- 0:02:17 610000 -- (-2404.013) (-2411.331) [-2402.711] (-2406.029) * (-2409.789) (-2406.081) [-2399.342] (-2402.594) -- 0:02:16 Average standard deviation of split frequencies: 0.006793 610500 -- [-2403.615] (-2408.574) (-2406.667) (-2404.091) * (-2406.667) [-2399.633] (-2405.219) (-2401.140) -- 0:02:16 611000 -- (-2412.489) (-2404.404) (-2405.813) [-2403.353] * [-2406.757] (-2401.632) (-2402.327) (-2411.631) -- 0:02:16 611500 -- [-2398.591] (-2409.985) (-2405.261) (-2404.150) * (-2401.097) [-2405.600] (-2398.124) (-2399.983) -- 0:02:15 612000 -- [-2402.644] (-2405.096) (-2406.236) (-2405.667) * [-2399.814] (-2405.987) (-2403.258) (-2407.797) -- 0:02:16 612500 -- (-2401.321) [-2409.215] (-2407.334) (-2403.416) * (-2401.258) (-2410.404) (-2405.530) [-2401.254] -- 0:02:16 613000 -- [-2399.993] (-2400.623) (-2394.817) (-2413.557) * [-2400.684] (-2402.210) (-2401.491) (-2403.323) -- 0:02:15 613500 -- [-2400.867] (-2396.675) (-2412.816) (-2401.116) * (-2413.543) [-2401.355] (-2408.054) (-2402.434) -- 0:02:15 614000 -- (-2403.669) [-2402.314] (-2415.035) (-2402.576) * [-2409.261] (-2406.771) (-2409.071) (-2404.213) -- 0:02:15 614500 -- [-2407.686] (-2400.591) (-2405.095) (-2401.023) * [-2404.955] (-2402.539) (-2402.985) (-2406.251) -- 0:02:14 615000 -- (-2399.742) (-2408.430) (-2400.391) [-2405.334] * [-2400.438] (-2398.290) (-2417.648) (-2406.553) -- 0:02:15 Average standard deviation of split frequencies: 0.006734 615500 -- (-2407.527) (-2414.073) [-2398.058] (-2404.793) * [-2403.755] (-2407.642) (-2415.286) (-2402.293) -- 0:02:14 616000 -- (-2411.013) (-2400.354) [-2404.551] (-2400.339) * (-2400.508) (-2405.074) (-2407.130) [-2406.367] -- 0:02:14 616500 -- (-2415.812) (-2404.966) (-2399.485) [-2398.602] * (-2405.723) [-2402.942] (-2406.392) (-2409.605) -- 0:02:14 617000 -- (-2413.504) (-2410.501) (-2406.491) [-2402.481] * (-2402.161) [-2398.508] (-2406.588) (-2402.029) -- 0:02:14 617500 -- [-2402.370] (-2405.475) (-2405.480) (-2405.709) * (-2403.664) [-2399.180] (-2406.226) (-2404.727) -- 0:02:13 618000 -- (-2401.853) (-2405.666) (-2403.222) [-2400.632] * (-2400.205) (-2415.914) (-2408.831) [-2402.243] -- 0:02:14 618500 -- (-2405.836) (-2407.760) (-2401.806) [-2401.182] * (-2396.861) [-2410.594] (-2406.767) (-2404.304) -- 0:02:13 619000 -- (-2403.840) [-2404.417] (-2407.028) (-2404.866) * (-2403.019) [-2402.097] (-2399.811) (-2409.802) -- 0:02:13 619500 -- (-2399.981) (-2421.999) [-2402.797] (-2410.334) * [-2400.862] (-2408.028) (-2402.096) (-2411.930) -- 0:02:13 620000 -- (-2401.541) [-2406.087] (-2414.198) (-2407.668) * (-2400.061) (-2408.958) [-2403.729] (-2399.601) -- 0:02:13 Average standard deviation of split frequencies: 0.006076 620500 -- (-2403.743) [-2409.209] (-2406.560) (-2400.980) * (-2407.550) (-2406.684) (-2403.580) [-2405.463] -- 0:02:13 621000 -- (-2402.788) (-2405.815) [-2405.600] (-2408.478) * (-2400.099) (-2406.932) (-2401.816) [-2399.881] -- 0:02:13 621500 -- (-2402.871) (-2404.812) (-2404.639) [-2400.824] * [-2400.916] (-2409.160) (-2404.049) (-2406.860) -- 0:02:12 622000 -- (-2401.906) (-2403.188) (-2406.478) [-2403.506] * (-2403.227) [-2400.946] (-2404.438) (-2404.168) -- 0:02:12 622500 -- (-2405.620) [-2405.066] (-2409.830) (-2405.050) * (-2399.920) [-2399.080] (-2402.585) (-2400.010) -- 0:02:12 623000 -- (-2406.178) [-2403.367] (-2408.136) (-2404.316) * [-2400.692] (-2402.487) (-2400.550) (-2395.092) -- 0:02:11 623500 -- (-2409.700) [-2405.443] (-2403.919) (-2402.286) * (-2404.828) [-2401.164] (-2412.766) (-2399.429) -- 0:02:12 624000 -- (-2414.581) (-2411.552) (-2403.324) [-2399.942] * (-2409.057) (-2406.482) [-2403.956] (-2398.851) -- 0:02:11 624500 -- (-2400.995) (-2408.517) [-2403.470] (-2399.256) * [-2407.346] (-2407.848) (-2406.698) (-2400.968) -- 0:02:11 625000 -- (-2405.619) (-2409.548) [-2408.777] (-2405.222) * [-2404.336] (-2401.615) (-2405.023) (-2403.862) -- 0:02:11 Average standard deviation of split frequencies: 0.006024 625500 -- (-2405.644) (-2407.658) (-2405.886) [-2398.176] * (-2403.224) (-2400.171) [-2406.339] (-2405.403) -- 0:02:11 626000 -- [-2406.665] (-2406.176) (-2407.554) (-2395.572) * (-2402.036) [-2401.234] (-2409.048) (-2403.384) -- 0:02:10 626500 -- (-2419.691) [-2413.898] (-2405.537) (-2402.354) * [-2400.954] (-2402.258) (-2405.603) (-2405.683) -- 0:02:11 627000 -- (-2400.874) (-2415.114) (-2401.299) [-2401.937] * (-2399.647) (-2397.839) (-2402.620) [-2406.373] -- 0:02:10 627500 -- (-2403.135) (-2413.710) (-2408.743) [-2401.584] * (-2400.167) (-2403.621) [-2407.516] (-2402.383) -- 0:02:10 628000 -- (-2399.241) [-2410.132] (-2411.128) (-2409.478) * (-2408.939) (-2402.764) [-2406.989] (-2404.009) -- 0:02:10 628500 -- [-2399.945] (-2400.618) (-2407.757) (-2408.742) * (-2411.268) [-2403.679] (-2402.254) (-2406.148) -- 0:02:10 629000 -- (-2400.343) (-2404.274) [-2403.396] (-2409.097) * (-2401.900) (-2411.980) (-2408.842) [-2395.431] -- 0:02:10 629500 -- (-2399.551) (-2404.715) [-2408.090] (-2405.085) * [-2404.377] (-2405.955) (-2416.161) (-2401.885) -- 0:02:10 630000 -- (-2400.115) (-2401.433) [-2405.636] (-2404.239) * (-2420.018) (-2405.037) (-2407.994) [-2401.826] -- 0:02:09 Average standard deviation of split frequencies: 0.005083 630500 -- (-2400.471) (-2406.958) [-2401.187] (-2404.653) * (-2402.877) (-2402.843) (-2407.160) [-2402.223] -- 0:02:09 631000 -- [-2401.787] (-2403.277) (-2410.994) (-2405.745) * (-2406.178) [-2400.468] (-2411.905) (-2398.759) -- 0:02:09 631500 -- (-2403.667) (-2401.917) (-2402.102) [-2408.856] * (-2410.298) (-2402.786) [-2409.111] (-2399.622) -- 0:02:08 632000 -- (-2403.224) (-2401.252) (-2400.329) [-2402.173] * (-2409.615) (-2400.936) (-2399.711) [-2404.343] -- 0:02:09 632500 -- (-2402.881) [-2402.745] (-2406.576) (-2401.462) * (-2410.499) (-2406.777) [-2400.960] (-2413.411) -- 0:02:08 633000 -- [-2396.890] (-2402.743) (-2408.117) (-2405.356) * (-2406.821) (-2406.083) (-2403.361) [-2404.095] -- 0:02:08 633500 -- (-2401.042) (-2411.794) (-2408.763) [-2403.281] * (-2414.606) (-2405.337) (-2412.982) [-2398.675] -- 0:02:08 634000 -- (-2404.394) [-2404.016] (-2399.089) (-2412.173) * (-2405.896) (-2410.424) [-2405.494] (-2412.093) -- 0:02:08 634500 -- (-2411.394) (-2401.281) (-2400.020) [-2406.203] * (-2400.362) (-2405.797) [-2409.098] (-2406.805) -- 0:02:07 635000 -- (-2401.614) (-2404.690) (-2403.820) [-2406.181] * (-2408.463) [-2403.251] (-2405.320) (-2401.462) -- 0:02:08 Average standard deviation of split frequencies: 0.004744 635500 -- (-2400.163) (-2404.858) [-2403.719] (-2404.927) * (-2400.689) (-2404.475) [-2398.409] (-2408.556) -- 0:02:07 636000 -- (-2402.182) (-2408.095) [-2403.798] (-2411.963) * [-2405.668] (-2396.597) (-2404.514) (-2412.096) -- 0:02:07 636500 -- (-2407.323) [-2412.635] (-2403.454) (-2401.810) * (-2408.330) (-2399.164) (-2400.686) [-2403.281] -- 0:02:07 637000 -- (-2410.031) (-2401.733) (-2402.760) [-2402.043] * (-2408.497) [-2407.942] (-2401.767) (-2412.893) -- 0:02:07 637500 -- [-2402.296] (-2395.623) (-2408.774) (-2410.465) * (-2400.897) (-2410.266) [-2401.382] (-2400.023) -- 0:02:06 638000 -- (-2408.821) [-2398.038] (-2402.255) (-2404.935) * (-2400.820) (-2399.965) [-2406.893] (-2400.172) -- 0:02:07 638500 -- [-2402.365] (-2397.625) (-2403.271) (-2408.807) * (-2410.695) (-2400.830) (-2401.055) [-2400.472] -- 0:02:06 639000 -- (-2404.218) [-2402.272] (-2400.940) (-2400.337) * (-2401.830) [-2401.167] (-2414.977) (-2404.259) -- 0:02:06 639500 -- (-2396.267) [-2406.956] (-2407.751) (-2407.484) * (-2409.122) [-2405.122] (-2410.362) (-2405.941) -- 0:02:06 640000 -- [-2399.132] (-2406.386) (-2401.923) (-2403.459) * (-2400.748) (-2402.069) (-2402.546) [-2404.589] -- 0:02:06 Average standard deviation of split frequencies: 0.005003 640500 -- (-2402.037) (-2407.128) [-2402.938] (-2404.793) * (-2404.843) (-2407.220) [-2398.799] (-2408.754) -- 0:02:06 641000 -- (-2399.976) [-2405.204] (-2396.617) (-2401.039) * (-2401.083) [-2398.803] (-2407.659) (-2414.290) -- 0:02:06 641500 -- [-2402.328] (-2411.517) (-2400.631) (-2400.771) * [-2399.770] (-2405.830) (-2404.343) (-2403.035) -- 0:02:05 642000 -- [-2399.251] (-2408.677) (-2396.360) (-2412.791) * [-2398.970] (-2399.654) (-2402.656) (-2400.529) -- 0:02:05 642500 -- (-2400.651) (-2402.781) (-2405.199) [-2403.251] * (-2401.780) [-2401.057] (-2402.008) (-2402.648) -- 0:02:05 643000 -- [-2408.737] (-2400.546) (-2408.325) (-2406.942) * (-2404.140) [-2404.141] (-2406.807) (-2399.050) -- 0:02:04 643500 -- (-2406.480) (-2401.489) (-2410.741) [-2399.910] * [-2405.073] (-2416.112) (-2407.026) (-2404.610) -- 0:02:05 644000 -- (-2402.173) (-2401.561) (-2408.555) [-2401.287] * (-2408.793) (-2408.326) [-2403.152] (-2402.040) -- 0:02:04 644500 -- (-2399.537) (-2403.199) [-2400.182] (-2409.440) * (-2401.566) [-2403.954] (-2409.751) (-2404.279) -- 0:02:04 645000 -- (-2406.505) (-2403.307) (-2400.601) [-2406.711] * (-2404.235) [-2404.080] (-2408.377) (-2406.087) -- 0:02:04 Average standard deviation of split frequencies: 0.006714 645500 -- (-2400.580) (-2401.734) (-2406.010) [-2405.607] * (-2406.497) (-2402.565) (-2414.382) [-2397.582] -- 0:02:04 646000 -- [-2400.611] (-2411.468) (-2401.967) (-2405.540) * [-2404.517] (-2395.766) (-2410.097) (-2405.089) -- 0:02:03 646500 -- (-2417.723) [-2400.292] (-2412.210) (-2408.414) * [-2401.017] (-2402.167) (-2405.323) (-2409.786) -- 0:02:04 647000 -- [-2408.165] (-2405.496) (-2408.954) (-2405.947) * [-2404.487] (-2404.758) (-2399.684) (-2396.186) -- 0:02:03 647500 -- (-2403.218) (-2399.495) [-2403.410] (-2402.337) * [-2403.323] (-2404.468) (-2405.028) (-2410.476) -- 0:02:03 648000 -- (-2403.744) [-2402.485] (-2418.438) (-2403.278) * (-2409.941) (-2404.783) (-2406.563) [-2402.861] -- 0:02:03 648500 -- (-2409.776) (-2403.164) (-2403.269) [-2406.284] * (-2406.913) [-2402.534] (-2406.381) (-2402.939) -- 0:02:03 649000 -- (-2403.310) (-2406.847) [-2402.035] (-2403.618) * (-2405.988) (-2404.313) (-2403.427) [-2400.760] -- 0:02:02 649500 -- [-2402.965] (-2407.188) (-2406.853) (-2411.396) * (-2406.951) (-2395.811) [-2404.469] (-2406.561) -- 0:02:03 650000 -- (-2398.402) (-2407.758) [-2396.412] (-2408.295) * [-2406.682] (-2401.500) (-2414.132) (-2398.552) -- 0:02:02 Average standard deviation of split frequencies: 0.006955 650500 -- (-2405.346) [-2408.679] (-2401.010) (-2410.119) * (-2405.053) (-2404.043) (-2402.690) [-2405.979] -- 0:02:02 651000 -- [-2394.454] (-2414.357) (-2401.756) (-2407.314) * [-2402.630] (-2404.482) (-2403.589) (-2401.943) -- 0:02:02 651500 -- (-2399.764) (-2405.091) [-2404.063] (-2403.570) * (-2401.326) (-2399.027) (-2400.355) [-2398.184] -- 0:02:01 652000 -- (-2408.094) [-2414.463] (-2404.840) (-2401.506) * [-2402.378] (-2401.714) (-2404.487) (-2401.531) -- 0:02:01 652500 -- [-2407.466] (-2412.714) (-2404.911) (-2402.057) * (-2401.953) [-2399.919] (-2414.434) (-2399.452) -- 0:02:01 653000 -- (-2408.452) (-2402.185) [-2404.033] (-2405.565) * (-2404.575) [-2395.954] (-2401.157) (-2405.805) -- 0:02:01 653500 -- (-2404.751) (-2403.265) [-2402.806] (-2405.250) * (-2408.663) (-2402.396) (-2405.195) [-2400.749] -- 0:02:01 654000 -- (-2405.555) [-2402.527] (-2396.410) (-2407.947) * (-2402.471) (-2405.243) [-2402.162] (-2406.336) -- 0:02:01 654500 -- (-2400.747) [-2402.990] (-2411.947) (-2408.996) * [-2403.999] (-2401.735) (-2400.775) (-2410.800) -- 0:02:00 655000 -- (-2402.818) (-2400.844) [-2400.097] (-2409.577) * [-2412.553] (-2401.038) (-2403.517) (-2400.257) -- 0:02:01 Average standard deviation of split frequencies: 0.006611 655500 -- [-2401.297] (-2411.745) (-2401.096) (-2408.530) * (-2408.936) (-2397.331) (-2404.024) [-2405.160] -- 0:02:00 656000 -- (-2400.516) [-2402.218] (-2404.119) (-2408.856) * (-2415.059) (-2404.057) [-2405.870] (-2408.340) -- 0:02:00 656500 -- [-2400.831] (-2407.413) (-2401.429) (-2404.433) * [-2404.244] (-2413.035) (-2401.833) (-2397.475) -- 0:02:00 657000 -- (-2401.354) (-2404.495) (-2398.949) [-2398.971] * (-2404.701) (-2399.771) (-2400.563) [-2405.364] -- 0:02:00 657500 -- (-2405.690) (-2406.480) (-2398.312) [-2405.335] * (-2407.360) (-2401.778) (-2407.046) [-2400.676] -- 0:01:59 658000 -- (-2410.565) (-2400.574) (-2409.806) [-2399.490] * (-2407.886) (-2407.456) [-2399.646] (-2404.439) -- 0:02:00 658500 -- (-2400.372) [-2400.783] (-2404.056) (-2403.826) * (-2397.194) (-2411.233) [-2406.666] (-2408.017) -- 0:01:59 659000 -- (-2404.724) (-2406.197) [-2403.291] (-2407.686) * (-2402.794) (-2415.185) [-2394.700] (-2402.526) -- 0:01:59 659500 -- (-2408.186) (-2401.183) [-2401.548] (-2403.720) * (-2408.878) (-2412.370) [-2401.476] (-2399.870) -- 0:01:59 660000 -- (-2404.153) (-2402.366) [-2401.091] (-2403.964) * [-2404.862] (-2405.669) (-2403.547) (-2401.618) -- 0:01:59 Average standard deviation of split frequencies: 0.006279 660500 -- (-2400.744) (-2399.511) [-2413.512] (-2401.214) * (-2410.673) [-2404.465] (-2409.477) (-2400.034) -- 0:01:58 661000 -- (-2400.779) [-2398.254] (-2397.714) (-2404.416) * [-2398.011] (-2402.984) (-2411.335) (-2402.931) -- 0:01:58 661500 -- (-2399.759) (-2403.215) (-2402.559) [-2399.023] * [-2400.954] (-2401.950) (-2406.097) (-2416.730) -- 0:01:58 662000 -- [-2402.445] (-2403.888) (-2404.996) (-2406.635) * (-2403.138) [-2399.894] (-2398.325) (-2404.517) -- 0:01:58 662500 -- (-2398.961) (-2405.642) [-2402.221] (-2399.298) * (-2400.669) [-2401.261] (-2410.509) (-2406.453) -- 0:01:58 663000 -- (-2402.433) (-2399.246) [-2404.716] (-2398.896) * (-2407.752) (-2402.851) (-2410.018) [-2396.309] -- 0:01:57 663500 -- (-2406.593) (-2395.485) (-2404.524) [-2394.881] * (-2413.119) (-2408.905) (-2405.681) [-2401.225] -- 0:01:57 664000 -- (-2410.244) (-2405.313) (-2403.995) [-2402.597] * (-2401.468) (-2411.534) (-2403.885) [-2402.500] -- 0:01:57 664500 -- (-2414.931) (-2398.067) (-2400.297) [-2402.379] * (-2410.534) (-2404.703) [-2404.868] (-2404.912) -- 0:01:57 665000 -- (-2396.855) (-2401.476) [-2399.249] (-2399.283) * [-2398.700] (-2402.141) (-2407.572) (-2403.612) -- 0:01:57 Average standard deviation of split frequencies: 0.005096 665500 -- (-2406.352) [-2403.394] (-2409.306) (-2401.835) * (-2408.139) [-2411.504] (-2401.571) (-2406.337) -- 0:01:57 666000 -- (-2406.462) (-2407.264) (-2400.120) [-2402.702] * [-2407.016] (-2403.705) (-2409.778) (-2404.991) -- 0:01:56 666500 -- (-2408.675) [-2404.628] (-2412.586) (-2403.486) * (-2399.230) (-2401.076) (-2406.388) [-2404.306] -- 0:01:57 667000 -- [-2399.918] (-2405.625) (-2406.494) (-2408.457) * (-2403.368) (-2397.873) (-2401.400) [-2404.779] -- 0:01:56 667500 -- (-2399.637) [-2407.123] (-2404.228) (-2406.375) * (-2398.793) (-2398.939) [-2400.186] (-2397.569) -- 0:01:56 668000 -- (-2400.045) (-2399.296) [-2398.532] (-2398.599) * (-2400.066) [-2403.231] (-2404.497) (-2404.306) -- 0:01:56 668500 -- [-2402.985] (-2399.482) (-2401.724) (-2408.134) * (-2401.220) (-2411.137) [-2406.685] (-2405.004) -- 0:01:56 669000 -- (-2412.330) (-2405.573) (-2401.118) [-2402.418] * [-2400.091] (-2402.973) (-2406.003) (-2409.561) -- 0:01:55 669500 -- (-2411.550) (-2406.952) (-2400.438) [-2409.361] * (-2402.491) (-2409.691) [-2406.847] (-2402.662) -- 0:01:56 670000 -- (-2402.065) [-2405.047] (-2400.025) (-2410.693) * (-2399.403) (-2399.701) (-2414.507) [-2404.477] -- 0:01:55 Average standard deviation of split frequencies: 0.004639 670500 -- [-2400.274] (-2399.556) (-2401.740) (-2405.919) * (-2400.930) [-2403.305] (-2403.107) (-2396.237) -- 0:01:55 671000 -- [-2403.063] (-2398.295) (-2405.683) (-2404.188) * (-2409.941) (-2396.874) [-2403.859] (-2402.398) -- 0:01:55 671500 -- (-2405.128) [-2401.468] (-2406.490) (-2408.116) * [-2402.192] (-2403.844) (-2413.142) (-2401.722) -- 0:01:54 672000 -- (-2400.279) [-2406.728] (-2404.794) (-2402.408) * (-2402.421) [-2404.083] (-2408.402) (-2404.590) -- 0:01:54 672500 -- (-2407.001) (-2404.344) (-2400.929) [-2400.655] * (-2407.804) (-2399.700) [-2398.798] (-2401.513) -- 0:01:54 673000 -- (-2404.432) [-2404.219] (-2401.917) (-2399.541) * [-2401.065] (-2399.897) (-2401.573) (-2406.591) -- 0:01:54 673500 -- (-2401.994) (-2406.912) [-2411.073] (-2407.726) * (-2411.658) [-2404.197] (-2406.101) (-2403.858) -- 0:01:54 674000 -- (-2411.237) [-2404.796] (-2401.231) (-2405.601) * [-2398.295] (-2404.069) (-2404.952) (-2404.847) -- 0:01:54 674500 -- (-2411.028) (-2403.253) [-2405.514] (-2405.594) * (-2402.050) (-2402.991) [-2402.814] (-2404.703) -- 0:01:53 675000 -- [-2408.305] (-2400.984) (-2398.853) (-2403.981) * (-2409.304) (-2410.406) [-2403.731] (-2409.957) -- 0:01:53 Average standard deviation of split frequencies: 0.004045 675500 -- (-2405.107) (-2407.825) (-2404.754) [-2407.851] * (-2412.918) (-2407.386) (-2401.651) [-2406.809] -- 0:01:53 676000 -- (-2405.735) (-2402.449) [-2406.673] (-2408.185) * [-2406.203] (-2405.068) (-2414.608) (-2417.047) -- 0:01:53 676500 -- (-2401.607) [-2405.449] (-2403.513) (-2412.315) * (-2401.678) [-2408.345] (-2404.122) (-2409.269) -- 0:01:53 677000 -- [-2405.345] (-2404.534) (-2403.229) (-2396.184) * [-2400.769] (-2406.832) (-2405.799) (-2409.442) -- 0:01:53 677500 -- (-2404.564) (-2403.031) [-2400.925] (-2406.722) * (-2401.618) (-2402.059) [-2403.852] (-2396.668) -- 0:01:52 678000 -- (-2402.301) [-2398.853] (-2407.018) (-2406.485) * (-2400.084) [-2399.626] (-2399.352) (-2413.603) -- 0:01:52 678500 -- [-2398.920] (-2400.711) (-2408.255) (-2402.076) * [-2403.440] (-2401.639) (-2409.954) (-2408.591) -- 0:01:52 679000 -- [-2399.012] (-2402.550) (-2405.346) (-2411.423) * (-2399.926) [-2402.726] (-2411.569) (-2399.969) -- 0:01:52 679500 -- (-2404.313) (-2403.001) (-2412.152) [-2402.606] * (-2401.958) [-2399.215] (-2417.960) (-2402.986) -- 0:01:52 680000 -- (-2399.713) [-2402.687] (-2401.468) (-2402.658) * (-2403.831) [-2399.822] (-2408.026) (-2401.943) -- 0:01:52 Average standard deviation of split frequencies: 0.003186 680500 -- (-2408.274) [-2404.506] (-2394.693) (-2410.830) * (-2406.023) (-2406.752) (-2402.365) [-2401.193] -- 0:01:51 681000 -- [-2403.598] (-2409.111) (-2407.537) (-2401.007) * (-2413.129) (-2403.800) [-2401.588] (-2408.510) -- 0:01:51 681500 -- [-2401.866] (-2407.539) (-2409.758) (-2405.185) * (-2414.459) (-2397.539) [-2403.389] (-2403.357) -- 0:01:51 682000 -- (-2401.423) (-2401.784) (-2408.325) [-2401.101] * (-2409.138) [-2399.321] (-2401.400) (-2401.642) -- 0:01:51 682500 -- (-2403.261) [-2402.717] (-2406.100) (-2403.340) * (-2406.839) (-2401.347) [-2402.007] (-2409.746) -- 0:01:51 683000 -- (-2397.741) (-2398.866) (-2404.671) [-2402.338] * [-2405.750] (-2409.978) (-2404.978) (-2406.036) -- 0:01:50 683500 -- [-2401.186] (-2401.063) (-2405.662) (-2401.674) * (-2400.706) [-2406.774] (-2402.572) (-2401.900) -- 0:01:50 684000 -- [-2398.770] (-2410.169) (-2415.762) (-2399.915) * (-2401.651) (-2404.665) [-2400.512] (-2404.711) -- 0:01:50 684500 -- (-2404.325) [-2402.598] (-2404.576) (-2404.514) * (-2405.554) (-2407.284) [-2402.030] (-2400.362) -- 0:01:50 685000 -- (-2406.314) [-2398.553] (-2395.431) (-2410.483) * (-2408.712) (-2405.301) [-2402.615] (-2404.218) -- 0:01:50 Average standard deviation of split frequencies: 0.004535 685500 -- (-2408.246) (-2403.871) [-2399.843] (-2403.956) * (-2407.406) (-2406.322) (-2399.822) [-2403.037] -- 0:01:50 686000 -- [-2405.362] (-2402.261) (-2404.954) (-2405.651) * (-2404.621) (-2406.705) [-2395.207] (-2409.113) -- 0:01:49 686500 -- [-2407.165] (-2401.854) (-2404.864) (-2409.291) * (-2399.137) (-2411.712) [-2400.756] (-2397.064) -- 0:01:49 687000 -- (-2404.354) [-2412.940] (-2407.005) (-2405.897) * (-2406.217) (-2410.832) (-2401.195) [-2405.345] -- 0:01:49 687500 -- [-2402.074] (-2407.442) (-2404.483) (-2401.144) * (-2403.644) (-2403.513) (-2398.831) [-2405.611] -- 0:01:49 688000 -- [-2404.615] (-2407.964) (-2401.214) (-2399.431) * (-2401.242) (-2399.676) (-2402.064) [-2404.866] -- 0:01:49 688500 -- [-2402.079] (-2405.380) (-2402.386) (-2407.293) * (-2403.154) (-2399.596) (-2402.926) [-2398.115] -- 0:01:49 689000 -- [-2400.228] (-2409.135) (-2403.250) (-2399.706) * (-2409.164) [-2399.873] (-2400.875) (-2401.660) -- 0:01:48 689500 -- (-2402.325) (-2419.014) [-2406.356] (-2404.310) * (-2408.266) (-2405.679) [-2399.478] (-2397.731) -- 0:01:48 690000 -- [-2401.319] (-2407.214) (-2407.854) (-2417.767) * (-2402.321) (-2402.947) (-2400.258) [-2400.986] -- 0:01:48 Average standard deviation of split frequencies: 0.003959 690500 -- (-2402.888) (-2407.491) [-2406.952] (-2407.111) * (-2402.651) (-2404.050) [-2399.369] (-2405.749) -- 0:01:48 691000 -- (-2403.397) [-2407.765] (-2405.551) (-2406.803) * (-2405.866) (-2408.666) [-2403.597] (-2399.938) -- 0:01:48 691500 -- (-2404.268) [-2399.059] (-2403.555) (-2405.215) * (-2410.748) (-2396.088) [-2406.607] (-2401.581) -- 0:01:47 692000 -- (-2404.593) [-2407.845] (-2401.266) (-2400.988) * [-2409.098] (-2403.175) (-2403.653) (-2399.945) -- 0:01:47 692500 -- (-2402.190) [-2411.725] (-2404.982) (-2404.351) * (-2407.258) [-2403.391] (-2408.436) (-2401.861) -- 0:01:47 693000 -- (-2412.536) (-2404.759) (-2403.160) [-2399.207] * (-2413.806) [-2396.924] (-2403.219) (-2403.246) -- 0:01:47 693500 -- (-2406.144) [-2402.843] (-2403.321) (-2405.857) * (-2410.880) [-2401.526] (-2414.303) (-2401.257) -- 0:01:47 694000 -- (-2402.053) (-2400.910) (-2411.497) [-2402.417] * [-2406.117] (-2402.776) (-2410.069) (-2406.936) -- 0:01:47 694500 -- (-2400.201) (-2411.769) [-2402.847] (-2407.280) * (-2408.118) [-2408.925] (-2403.667) (-2410.026) -- 0:01:46 695000 -- (-2417.934) (-2418.209) [-2403.395] (-2403.024) * (-2402.962) (-2404.650) (-2408.177) [-2404.563] -- 0:01:46 Average standard deviation of split frequencies: 0.003657 695500 -- (-2403.243) (-2406.122) [-2406.671] (-2400.420) * (-2407.118) [-2411.018] (-2405.305) (-2403.296) -- 0:01:46 696000 -- (-2399.589) (-2403.816) (-2405.549) [-2401.278] * (-2402.777) [-2405.539] (-2403.128) (-2405.027) -- 0:01:46 696500 -- (-2401.886) (-2399.363) [-2401.532] (-2406.031) * (-2402.304) (-2400.477) (-2410.109) [-2404.432] -- 0:01:46 697000 -- (-2407.262) [-2410.160] (-2399.608) (-2412.120) * (-2409.632) (-2406.829) [-2401.299] (-2404.418) -- 0:01:46 697500 -- (-2402.991) (-2402.689) (-2401.832) [-2409.457] * [-2401.810] (-2409.421) (-2405.827) (-2401.680) -- 0:01:45 698000 -- (-2403.162) (-2405.063) (-2402.004) [-2405.541] * (-2404.857) (-2407.779) (-2401.962) [-2397.440] -- 0:01:45 698500 -- [-2404.850] (-2406.276) (-2408.451) (-2414.271) * (-2400.424) [-2402.519] (-2402.038) (-2411.583) -- 0:01:45 699000 -- [-2403.031] (-2406.987) (-2400.324) (-2408.464) * (-2399.493) (-2406.478) [-2397.799] (-2404.570) -- 0:01:45 699500 -- (-2399.231) (-2407.890) [-2401.995] (-2401.645) * (-2403.430) [-2403.496] (-2410.022) (-2402.860) -- 0:01:45 700000 -- (-2407.628) (-2403.334) [-2401.809] (-2405.824) * [-2405.044] (-2401.453) (-2406.910) (-2401.432) -- 0:01:45 Average standard deviation of split frequencies: 0.004171 700500 -- (-2402.937) (-2405.022) (-2407.813) [-2399.198] * [-2409.257] (-2402.845) (-2404.667) (-2403.136) -- 0:01:44 701000 -- (-2404.427) (-2401.906) (-2404.896) [-2404.245] * (-2413.542) [-2403.435] (-2404.923) (-2400.122) -- 0:01:44 701500 -- [-2401.881] (-2414.169) (-2402.994) (-2412.045) * (-2403.320) (-2409.412) (-2407.559) [-2402.651] -- 0:01:44 702000 -- (-2402.623) [-2403.839] (-2403.573) (-2408.488) * (-2398.505) [-2398.314] (-2407.129) (-2402.418) -- 0:01:44 702500 -- (-2401.864) (-2398.939) [-2399.775] (-2402.313) * (-2393.529) (-2398.101) (-2402.658) [-2399.350] -- 0:01:44 703000 -- (-2405.128) (-2412.575) (-2408.576) [-2395.615] * (-2405.548) [-2403.894] (-2401.473) (-2403.409) -- 0:01:43 703500 -- (-2408.847) [-2407.823] (-2408.234) (-2396.663) * (-2408.123) [-2404.861] (-2412.289) (-2405.896) -- 0:01:43 704000 -- (-2414.975) (-2404.817) [-2404.142] (-2400.888) * (-2410.141) [-2403.239] (-2399.755) (-2411.489) -- 0:01:43 704500 -- (-2401.139) (-2398.945) (-2401.612) [-2407.248] * (-2403.163) (-2401.565) (-2409.325) [-2402.573] -- 0:01:43 705000 -- [-2414.046] (-2404.220) (-2404.533) (-2405.009) * (-2403.101) (-2405.475) [-2400.066] (-2411.940) -- 0:01:43 Average standard deviation of split frequencies: 0.004140 705500 -- (-2406.878) [-2399.569] (-2404.188) (-2411.026) * (-2401.492) (-2404.603) [-2401.131] (-2408.861) -- 0:01:43 706000 -- (-2401.193) (-2397.961) [-2401.725] (-2412.718) * (-2404.505) [-2403.792] (-2404.612) (-2402.804) -- 0:01:42 706500 -- (-2406.518) [-2407.827] (-2414.472) (-2401.925) * (-2401.442) (-2399.647) [-2403.600] (-2411.386) -- 0:01:42 707000 -- [-2406.022] (-2400.239) (-2398.819) (-2402.004) * (-2408.320) (-2405.000) (-2408.489) [-2406.515] -- 0:01:42 707500 -- [-2398.162] (-2407.573) (-2404.343) (-2406.392) * (-2405.713) (-2405.780) [-2400.031] (-2398.952) -- 0:01:42 708000 -- (-2405.277) [-2399.621] (-2413.057) (-2400.586) * (-2408.758) (-2413.658) [-2399.801] (-2400.452) -- 0:01:42 708500 -- (-2407.745) (-2405.998) (-2408.519) [-2402.407] * (-2404.865) (-2401.432) [-2397.883] (-2401.427) -- 0:01:42 709000 -- (-2406.577) (-2409.765) (-2405.570) [-2410.556] * [-2410.104] (-2403.685) (-2402.850) (-2409.670) -- 0:01:41 709500 -- (-2414.162) [-2401.557] (-2409.478) (-2398.074) * (-2399.844) (-2403.246) (-2400.322) [-2399.731] -- 0:01:41 710000 -- (-2405.158) (-2403.168) [-2402.629] (-2399.407) * (-2402.317) (-2404.764) (-2411.562) [-2398.601] -- 0:01:41 Average standard deviation of split frequencies: 0.004378 710500 -- (-2400.586) (-2397.408) [-2404.890] (-2409.239) * (-2399.385) (-2409.007) (-2406.675) [-2406.223] -- 0:01:41 711000 -- (-2402.675) (-2401.087) (-2400.576) [-2400.453] * (-2400.267) (-2421.217) [-2402.626] (-2401.719) -- 0:01:41 711500 -- (-2406.666) [-2400.592] (-2398.241) (-2401.031) * [-2401.067] (-2412.163) (-2398.527) (-2399.594) -- 0:01:40 712000 -- (-2406.452) (-2403.166) (-2403.723) [-2399.993] * (-2398.833) (-2416.974) (-2399.661) [-2398.495] -- 0:01:40 712500 -- [-2406.732] (-2398.620) (-2398.504) (-2405.509) * (-2397.400) (-2406.780) (-2403.837) [-2402.465] -- 0:01:40 713000 -- (-2399.588) (-2403.130) (-2402.624) [-2403.971] * (-2403.986) (-2404.053) [-2402.474] (-2402.337) -- 0:01:40 713500 -- (-2398.515) (-2400.772) (-2412.438) [-2398.125] * (-2411.372) [-2404.923] (-2402.600) (-2402.980) -- 0:01:40 714000 -- (-2399.746) [-2401.631] (-2400.545) (-2405.159) * (-2402.483) (-2401.016) (-2405.998) [-2401.579] -- 0:01:40 714500 -- (-2400.922) [-2403.029] (-2401.444) (-2403.035) * [-2406.084] (-2407.542) (-2405.022) (-2402.964) -- 0:01:39 715000 -- (-2402.262) [-2402.180] (-2401.075) (-2400.826) * (-2401.385) (-2410.328) (-2407.369) [-2405.325] -- 0:01:39 Average standard deviation of split frequencies: 0.004082 715500 -- (-2407.782) (-2405.642) [-2407.255] (-2408.001) * [-2403.155] (-2405.416) (-2407.901) (-2402.487) -- 0:01:39 716000 -- [-2406.898] (-2409.776) (-2409.797) (-2405.074) * [-2403.498] (-2400.435) (-2413.261) (-2402.259) -- 0:01:39 716500 -- (-2408.503) [-2397.376] (-2403.098) (-2404.418) * [-2406.011] (-2412.600) (-2412.970) (-2411.288) -- 0:01:39 717000 -- (-2410.303) [-2401.056] (-2401.316) (-2402.892) * (-2400.959) (-2405.185) (-2424.097) [-2400.427] -- 0:01:39 717500 -- (-2401.489) (-2403.450) [-2403.533] (-2400.525) * [-2400.666] (-2411.233) (-2412.321) (-2404.845) -- 0:01:38 718000 -- [-2404.871] (-2403.926) (-2402.372) (-2412.098) * (-2403.251) (-2407.131) (-2413.239) [-2406.483] -- 0:01:38 718500 -- (-2402.525) (-2404.887) (-2407.724) [-2403.897] * (-2402.756) (-2408.922) [-2402.561] (-2403.413) -- 0:01:38 719000 -- (-2407.429) (-2403.122) [-2402.043] (-2402.635) * [-2402.789] (-2397.601) (-2405.894) (-2406.243) -- 0:01:38 719500 -- (-2409.835) [-2406.431] (-2400.968) (-2402.937) * [-2401.859] (-2400.962) (-2405.417) (-2406.959) -- 0:01:38 720000 -- (-2408.747) (-2403.293) (-2407.251) [-2401.594] * (-2399.829) (-2398.938) [-2403.430] (-2409.490) -- 0:01:38 Average standard deviation of split frequencies: 0.003532 720500 -- (-2413.824) (-2398.328) (-2403.773) [-2399.383] * (-2400.729) (-2404.262) (-2399.177) [-2403.719] -- 0:01:37 721000 -- (-2410.658) (-2394.456) (-2405.239) [-2409.812] * (-2409.584) [-2404.131] (-2404.805) (-2410.763) -- 0:01:37 721500 -- (-2414.667) (-2398.384) (-2413.665) [-2402.768] * [-2408.550] (-2403.506) (-2403.347) (-2413.523) -- 0:01:37 722000 -- (-2409.916) (-2403.369) [-2400.876] (-2403.223) * (-2403.164) (-2418.947) [-2402.698] (-2404.125) -- 0:01:37 722500 -- (-2402.640) (-2409.589) [-2402.645] (-2396.216) * (-2403.686) (-2411.947) [-2402.951] (-2408.117) -- 0:01:37 723000 -- [-2403.473] (-2409.655) (-2409.939) (-2403.217) * (-2398.443) [-2404.206] (-2403.010) (-2402.692) -- 0:01:36 723500 -- (-2401.098) (-2406.959) [-2405.112] (-2404.006) * (-2397.936) [-2406.467] (-2408.161) (-2404.214) -- 0:01:36 724000 -- [-2406.468] (-2410.875) (-2401.042) (-2404.505) * [-2401.037] (-2405.022) (-2401.115) (-2405.882) -- 0:01:36 724500 -- (-2403.101) [-2401.376] (-2404.565) (-2406.028) * (-2401.391) (-2401.280) [-2403.141] (-2410.152) -- 0:01:36 725000 -- (-2412.503) (-2402.697) [-2405.900] (-2403.007) * (-2407.079) (-2405.233) [-2399.982] (-2406.194) -- 0:01:36 Average standard deviation of split frequencies: 0.003506 725500 -- (-2411.217) (-2405.367) [-2399.249] (-2403.951) * [-2407.305] (-2402.417) (-2407.642) (-2402.128) -- 0:01:36 726000 -- (-2399.510) [-2401.055] (-2412.529) (-2400.809) * [-2404.622] (-2397.965) (-2414.693) (-2414.784) -- 0:01:35 726500 -- (-2409.555) (-2398.546) (-2401.229) [-2400.856] * [-2398.126] (-2406.693) (-2403.485) (-2404.238) -- 0:01:35 727000 -- (-2417.433) (-2407.326) (-2401.748) [-2401.282] * (-2400.984) (-2404.442) (-2406.516) [-2402.659] -- 0:01:35 727500 -- (-2413.385) (-2398.415) (-2399.998) [-2400.583] * (-2404.836) [-2397.302] (-2407.106) (-2409.249) -- 0:01:35 728000 -- (-2404.938) (-2402.213) (-2408.489) [-2409.630] * (-2406.301) (-2407.975) (-2404.360) [-2398.619] -- 0:01:35 728500 -- (-2403.530) [-2404.403] (-2415.940) (-2418.565) * (-2405.209) (-2411.977) (-2402.338) [-2402.279] -- 0:01:35 729000 -- (-2402.488) [-2406.700] (-2405.512) (-2407.869) * (-2404.054) [-2402.101] (-2406.347) (-2406.837) -- 0:01:34 729500 -- (-2404.097) [-2402.055] (-2400.927) (-2397.878) * (-2406.824) (-2403.878) [-2403.048] (-2400.833) -- 0:01:34 730000 -- [-2398.899] (-2402.063) (-2407.779) (-2401.587) * [-2402.294] (-2407.171) (-2405.065) (-2401.595) -- 0:01:34 Average standard deviation of split frequencies: 0.002968 730500 -- (-2412.753) [-2401.546] (-2400.183) (-2401.993) * (-2402.326) [-2403.068] (-2398.661) (-2403.852) -- 0:01:34 731000 -- (-2405.304) (-2409.946) [-2400.119] (-2400.643) * [-2409.550] (-2397.783) (-2405.384) (-2402.467) -- 0:01:34 731500 -- (-2403.807) [-2401.159] (-2399.253) (-2418.027) * (-2402.099) (-2406.507) (-2409.861) [-2400.155] -- 0:01:33 732000 -- (-2405.619) (-2405.921) [-2400.455] (-2414.856) * [-2396.835] (-2409.621) (-2405.663) (-2398.622) -- 0:01:33 732500 -- (-2407.924) [-2402.665] (-2403.786) (-2402.629) * (-2407.320) (-2400.579) (-2401.558) [-2405.480] -- 0:01:33 733000 -- (-2405.071) (-2405.605) (-2398.299) [-2404.214] * (-2397.991) (-2402.277) (-2400.041) [-2401.481] -- 0:01:33 733500 -- (-2402.173) (-2401.467) (-2403.445) [-2404.505] * [-2404.845] (-2405.473) (-2405.657) (-2404.033) -- 0:01:33 734000 -- (-2408.314) (-2400.822) [-2408.107] (-2403.880) * (-2401.622) (-2402.085) (-2409.746) [-2407.411] -- 0:01:33 734500 -- [-2401.838] (-2402.541) (-2400.217) (-2404.954) * (-2397.023) (-2404.815) [-2404.675] (-2400.880) -- 0:01:32 735000 -- (-2406.325) [-2407.295] (-2408.193) (-2404.405) * (-2408.171) (-2403.162) (-2403.544) [-2404.446] -- 0:01:32 Average standard deviation of split frequencies: 0.003202 735500 -- [-2411.784] (-2403.042) (-2407.278) (-2407.230) * (-2407.943) [-2407.211] (-2407.150) (-2401.188) -- 0:01:32 736000 -- [-2404.942] (-2407.024) (-2402.886) (-2409.965) * (-2412.221) [-2409.487] (-2401.095) (-2397.818) -- 0:01:32 736500 -- (-2408.711) [-2406.882] (-2402.002) (-2399.529) * [-2400.465] (-2405.387) (-2401.377) (-2399.791) -- 0:01:32 737000 -- [-2401.931] (-2399.832) (-2401.557) (-2410.547) * (-2405.892) (-2403.840) (-2403.249) [-2406.245] -- 0:01:32 737500 -- (-2398.696) (-2403.997) [-2399.527] (-2402.156) * (-2402.864) (-2407.051) (-2405.672) [-2398.193] -- 0:01:31 738000 -- (-2401.110) [-2402.544] (-2410.819) (-2404.372) * (-2404.346) [-2398.486] (-2403.423) (-2403.421) -- 0:01:31 738500 -- (-2404.858) (-2401.997) (-2409.153) [-2403.468] * [-2402.582] (-2399.818) (-2402.768) (-2402.816) -- 0:01:31 739000 -- [-2399.086] (-2397.267) (-2412.849) (-2401.089) * (-2413.510) [-2399.786] (-2408.706) (-2404.712) -- 0:01:31 739500 -- (-2398.176) (-2400.448) (-2405.990) [-2403.232] * (-2411.527) (-2400.290) [-2411.100] (-2398.486) -- 0:01:31 740000 -- [-2405.756] (-2408.239) (-2407.945) (-2403.017) * (-2412.765) [-2400.065] (-2409.865) (-2403.512) -- 0:01:31 Average standard deviation of split frequencies: 0.003691 740500 -- (-2398.838) [-2399.630] (-2400.533) (-2403.821) * (-2406.290) (-2405.148) (-2403.505) [-2402.519] -- 0:01:30 741000 -- (-2399.307) (-2405.966) (-2410.611) [-2400.557] * (-2410.995) (-2407.558) (-2403.557) [-2408.156] -- 0:01:30 741500 -- (-2407.770) [-2410.326] (-2400.180) (-2397.147) * (-2407.559) (-2403.368) [-2400.870] (-2397.796) -- 0:01:30 742000 -- (-2404.703) (-2404.153) (-2401.493) [-2403.659] * (-2407.229) (-2402.901) (-2404.846) [-2402.373] -- 0:01:30 742500 -- (-2404.967) (-2405.472) (-2406.464) [-2398.268] * (-2404.662) [-2401.525] (-2404.769) (-2400.141) -- 0:01:30 743000 -- (-2399.323) (-2406.088) (-2406.310) [-2398.434] * (-2405.449) [-2404.712] (-2405.681) (-2399.715) -- 0:01:29 743500 -- [-2402.409] (-2402.340) (-2403.778) (-2399.034) * (-2405.037) [-2402.804] (-2406.241) (-2400.872) -- 0:01:29 744000 -- [-2407.565] (-2403.272) (-2401.592) (-2411.415) * (-2418.663) (-2398.281) (-2406.268) [-2399.883] -- 0:01:29 744500 -- (-2410.524) [-2403.238] (-2398.334) (-2409.887) * (-2405.268) [-2398.986] (-2405.344) (-2400.615) -- 0:01:29 745000 -- (-2409.839) (-2407.729) (-2403.754) [-2407.366] * (-2405.163) (-2406.906) (-2401.500) [-2399.649] -- 0:01:29 Average standard deviation of split frequencies: 0.003665 745500 -- (-2421.360) (-2407.657) [-2398.410] (-2406.714) * (-2405.396) (-2405.709) (-2408.363) [-2405.282] -- 0:01:29 746000 -- (-2409.409) (-2401.237) [-2400.041] (-2410.556) * (-2400.001) [-2403.182] (-2405.865) (-2406.343) -- 0:01:28 746500 -- [-2405.329] (-2406.186) (-2402.135) (-2410.292) * (-2402.521) [-2404.487] (-2406.202) (-2409.244) -- 0:01:28 747000 -- (-2406.443) (-2404.041) [-2398.683] (-2400.150) * (-2399.069) (-2411.261) (-2402.010) [-2403.421] -- 0:01:28 747500 -- (-2404.724) (-2413.590) [-2398.068] (-2408.683) * (-2407.802) [-2405.163] (-2401.982) (-2403.089) -- 0:01:28 748000 -- (-2409.690) (-2402.247) [-2399.053] (-2404.592) * (-2407.937) [-2403.969] (-2397.661) (-2400.658) -- 0:01:28 748500 -- (-2400.522) (-2399.829) [-2403.468] (-2407.102) * (-2404.248) (-2402.981) [-2404.391] (-2401.158) -- 0:01:28 749000 -- (-2404.652) (-2402.734) [-2400.520] (-2403.951) * (-2407.961) (-2402.927) [-2397.922] (-2400.483) -- 0:01:27 749500 -- (-2403.567) (-2405.818) (-2403.351) [-2402.498] * (-2409.228) (-2407.335) (-2407.389) [-2395.522] -- 0:01:27 750000 -- (-2400.571) (-2401.979) [-2403.392] (-2397.720) * (-2406.464) (-2402.592) [-2396.753] (-2401.782) -- 0:01:27 Average standard deviation of split frequencies: 0.003391 750500 -- (-2404.396) (-2402.977) [-2401.167] (-2407.234) * (-2402.420) (-2408.159) [-2398.276] (-2400.704) -- 0:01:27 751000 -- (-2408.254) (-2403.765) (-2400.070) [-2400.373] * (-2402.870) (-2411.079) [-2398.588] (-2404.487) -- 0:01:27 751500 -- (-2404.051) [-2405.993] (-2399.169) (-2415.130) * [-2402.668] (-2401.530) (-2402.141) (-2406.524) -- 0:01:26 752000 -- (-2405.108) (-2402.460) [-2407.073] (-2408.250) * (-2404.316) (-2403.457) [-2406.156] (-2400.084) -- 0:01:26 752500 -- (-2411.316) (-2402.004) (-2402.621) [-2404.230] * (-2401.517) (-2396.742) (-2401.378) [-2406.597] -- 0:01:26 753000 -- (-2403.286) (-2409.018) (-2409.853) [-2405.452] * (-2406.829) (-2404.100) [-2410.404] (-2410.556) -- 0:01:26 753500 -- (-2403.100) (-2413.774) [-2405.835] (-2399.877) * [-2398.510] (-2412.596) (-2407.912) (-2411.878) -- 0:01:26 754000 -- [-2403.788] (-2407.960) (-2408.131) (-2406.630) * (-2403.480) (-2407.057) [-2403.126] (-2402.319) -- 0:01:26 754500 -- (-2407.131) (-2406.180) (-2403.696) [-2403.759] * [-2409.001] (-2406.303) (-2414.075) (-2405.259) -- 0:01:25 755000 -- (-2401.632) (-2406.964) [-2404.100] (-2407.980) * (-2402.252) (-2407.829) (-2407.271) [-2401.502] -- 0:01:25 Average standard deviation of split frequencies: 0.002619 755500 -- (-2409.436) (-2405.587) [-2401.413] (-2407.263) * (-2406.046) (-2403.952) (-2408.093) [-2399.835] -- 0:01:25 756000 -- [-2405.599] (-2405.282) (-2402.254) (-2411.944) * (-2398.059) (-2401.679) (-2400.982) [-2397.945] -- 0:01:25 756500 -- (-2406.726) (-2405.056) [-2397.683] (-2407.961) * [-2399.532] (-2412.865) (-2409.400) (-2400.639) -- 0:01:25 757000 -- [-2405.448] (-2401.174) (-2396.931) (-2403.960) * (-2404.590) (-2405.096) [-2403.077] (-2407.435) -- 0:01:25 757500 -- [-2408.992] (-2401.523) (-2407.415) (-2414.271) * (-2405.141) (-2404.418) (-2403.695) [-2403.147] -- 0:01:24 758000 -- (-2409.075) (-2405.707) [-2398.174] (-2406.567) * (-2405.231) [-2409.548] (-2403.987) (-2405.900) -- 0:01:24 758500 -- [-2404.059] (-2404.480) (-2400.698) (-2412.802) * [-2404.891] (-2400.601) (-2401.489) (-2403.317) -- 0:01:24 759000 -- (-2404.428) (-2396.024) [-2405.409] (-2408.601) * [-2399.367] (-2407.936) (-2405.841) (-2411.138) -- 0:01:24 759500 -- (-2404.437) [-2399.808] (-2403.571) (-2406.707) * (-2414.184) (-2404.880) (-2404.650) [-2399.130] -- 0:01:24 760000 -- (-2409.000) (-2404.391) (-2405.775) [-2402.898] * [-2407.439] (-2399.723) (-2399.968) (-2402.878) -- 0:01:24 Average standard deviation of split frequencies: 0.002355 760500 -- (-2402.626) (-2410.070) [-2409.360] (-2402.047) * [-2405.398] (-2405.247) (-2410.964) (-2400.300) -- 0:01:23 761000 -- (-2398.478) (-2411.396) (-2399.978) [-2406.295] * (-2401.471) (-2413.672) [-2402.636] (-2408.402) -- 0:01:23 761500 -- (-2411.487) (-2403.486) [-2397.930] (-2410.850) * (-2403.634) (-2405.519) (-2410.944) [-2401.580] -- 0:01:23 762000 -- (-2401.633) (-2406.558) (-2402.078) [-2404.588] * (-2398.124) (-2405.497) (-2402.766) [-2403.154] -- 0:01:23 762500 -- (-2402.410) [-2407.056] (-2403.612) (-2398.833) * (-2401.783) (-2404.874) [-2401.045] (-2410.430) -- 0:01:23 763000 -- (-2403.136) (-2406.062) [-2402.051] (-2411.174) * (-2406.334) (-2401.928) [-2405.966] (-2409.982) -- 0:01:22 763500 -- [-2406.939] (-2399.560) (-2405.022) (-2405.830) * [-2410.253] (-2400.997) (-2410.676) (-2412.608) -- 0:01:22 764000 -- [-2405.916] (-2401.520) (-2400.545) (-2401.801) * (-2403.443) (-2405.455) [-2397.913] (-2403.684) -- 0:01:22 764500 -- (-2414.546) [-2405.984] (-2405.503) (-2405.687) * [-2402.716] (-2403.792) (-2408.320) (-2404.967) -- 0:01:22 765000 -- (-2402.571) (-2410.453) (-2402.915) [-2398.385] * (-2414.259) (-2405.440) [-2407.083] (-2408.137) -- 0:01:22 Average standard deviation of split frequencies: 0.002585 765500 -- (-2411.377) (-2406.354) [-2398.882] (-2401.032) * (-2414.164) (-2402.977) (-2398.915) [-2404.909] -- 0:01:22 766000 -- [-2402.383] (-2406.953) (-2404.640) (-2403.692) * (-2403.569) [-2404.527] (-2406.346) (-2407.989) -- 0:01:21 766500 -- (-2404.089) (-2405.707) (-2400.954) [-2400.598] * (-2404.073) (-2407.319) (-2406.744) [-2405.308] -- 0:01:21 767000 -- [-2404.996] (-2402.399) (-2407.233) (-2404.451) * (-2403.452) [-2401.463] (-2406.506) (-2403.721) -- 0:01:21 767500 -- (-2405.677) [-2406.865] (-2408.138) (-2401.191) * [-2400.030] (-2401.580) (-2405.638) (-2400.166) -- 0:01:21 768000 -- (-2407.671) (-2425.366) [-2401.955] (-2404.446) * (-2408.923) [-2405.842] (-2401.543) (-2403.364) -- 0:01:21 768500 -- (-2401.885) (-2403.151) (-2403.044) [-2400.500] * (-2405.486) (-2408.621) [-2401.647] (-2404.877) -- 0:01:21 769000 -- (-2408.986) (-2402.111) (-2402.556) [-2403.392] * [-2399.159] (-2404.394) (-2410.991) (-2405.596) -- 0:01:20 769500 -- [-2402.254] (-2408.812) (-2415.731) (-2397.325) * [-2399.342] (-2399.164) (-2409.317) (-2405.363) -- 0:01:20 770000 -- (-2404.519) [-2403.899] (-2403.571) (-2411.270) * (-2401.615) [-2401.949] (-2414.416) (-2407.113) -- 0:01:20 Average standard deviation of split frequencies: 0.001346 770500 -- (-2398.397) [-2401.650] (-2403.553) (-2401.026) * (-2408.432) (-2407.530) (-2407.409) [-2407.310] -- 0:01:20 771000 -- (-2401.098) (-2413.396) (-2403.430) [-2400.518] * (-2407.543) [-2402.139] (-2409.960) (-2411.364) -- 0:01:20 771500 -- (-2404.298) (-2407.709) [-2404.425] (-2400.152) * (-2405.047) (-2401.714) [-2402.684] (-2406.842) -- 0:01:19 772000 -- [-2399.318] (-2396.537) (-2406.658) (-2410.208) * (-2406.553) [-2398.444] (-2401.825) (-2397.906) -- 0:01:19 772500 -- (-2402.922) (-2406.531) [-2399.375] (-2405.639) * (-2405.072) (-2398.310) [-2409.484] (-2402.561) -- 0:01:19 773000 -- (-2408.685) [-2406.412] (-2403.631) (-2403.596) * [-2397.628] (-2400.651) (-2407.450) (-2404.951) -- 0:01:19 773500 -- (-2413.232) (-2400.312) [-2397.442] (-2404.270) * [-2401.846] (-2401.603) (-2405.539) (-2403.509) -- 0:01:19 774000 -- (-2406.626) (-2408.059) [-2401.135] (-2398.535) * (-2404.023) (-2399.411) [-2400.322] (-2409.037) -- 0:01:19 774500 -- (-2402.300) (-2407.006) [-2408.710] (-2416.038) * (-2406.126) (-2404.002) [-2401.313] (-2402.102) -- 0:01:18 775000 -- [-2397.412] (-2401.383) (-2406.667) (-2405.628) * (-2411.359) [-2400.822] (-2405.488) (-2404.085) -- 0:01:18 Average standard deviation of split frequencies: 0.000607 775500 -- (-2403.086) (-2412.984) [-2403.770] (-2407.732) * (-2409.672) (-2409.993) [-2402.906] (-2405.694) -- 0:01:18 776000 -- [-2400.844] (-2399.326) (-2408.695) (-2408.273) * (-2398.778) (-2403.484) (-2400.271) [-2401.538] -- 0:01:18 776500 -- (-2405.088) [-2405.682] (-2402.491) (-2411.667) * [-2408.470] (-2403.782) (-2412.346) (-2406.499) -- 0:01:18 777000 -- (-2404.327) (-2408.108) [-2405.892] (-2407.428) * (-2402.961) (-2406.396) (-2405.966) [-2403.314] -- 0:01:18 777500 -- [-2401.514] (-2410.649) (-2404.045) (-2401.250) * (-2408.771) (-2396.429) [-2412.756] (-2405.795) -- 0:01:17 778000 -- (-2401.826) [-2411.078] (-2407.240) (-2401.185) * (-2406.485) (-2407.271) (-2407.026) [-2403.605] -- 0:01:17 778500 -- (-2405.385) (-2410.894) (-2404.574) [-2398.707] * (-2416.606) (-2412.236) [-2402.716] (-2404.265) -- 0:01:17 779000 -- [-2401.175] (-2405.530) (-2402.115) (-2411.399) * (-2406.257) [-2400.420] (-2403.806) (-2409.060) -- 0:01:17 779500 -- (-2406.683) (-2405.272) (-2405.309) [-2400.140] * (-2410.643) [-2401.101] (-2406.596) (-2407.068) -- 0:01:17 780000 -- [-2403.325] (-2408.644) (-2397.550) (-2395.747) * [-2410.130] (-2401.367) (-2407.025) (-2407.717) -- 0:01:17 Average standard deviation of split frequencies: 0.000604 780500 -- (-2402.484) (-2409.351) (-2399.417) [-2402.670] * (-2403.154) [-2399.987] (-2411.850) (-2404.641) -- 0:01:16 781000 -- (-2408.211) (-2406.815) (-2406.367) [-2395.377] * (-2409.529) [-2401.102] (-2399.693) (-2402.917) -- 0:01:16 781500 -- (-2405.958) (-2413.518) [-2405.516] (-2398.462) * (-2406.613) (-2404.896) [-2401.953] (-2403.173) -- 0:01:16 782000 -- [-2401.207] (-2407.527) (-2401.535) (-2403.488) * (-2407.854) (-2407.168) [-2405.808] (-2411.364) -- 0:01:16 782500 -- (-2399.601) (-2408.300) (-2404.346) [-2396.542] * (-2404.983) (-2408.617) [-2405.249] (-2402.196) -- 0:01:16 783000 -- (-2401.602) (-2407.431) (-2405.951) [-2402.296] * (-2404.832) [-2403.280] (-2404.279) (-2405.969) -- 0:01:15 783500 -- (-2401.904) (-2402.078) (-2401.627) [-2404.028] * (-2410.123) (-2408.178) [-2397.653] (-2411.324) -- 0:01:15 784000 -- (-2411.484) (-2398.493) (-2403.883) [-2409.066] * (-2402.215) (-2401.069) (-2405.892) [-2399.973] -- 0:01:15 784500 -- (-2411.650) [-2401.093] (-2396.625) (-2406.372) * (-2405.945) [-2411.299] (-2408.560) (-2411.086) -- 0:01:15 785000 -- (-2417.276) (-2402.062) (-2401.590) [-2398.575] * (-2406.903) (-2410.295) (-2410.577) [-2400.887] -- 0:01:15 Average standard deviation of split frequencies: 0.001080 785500 -- (-2407.474) [-2408.608] (-2405.292) (-2402.275) * (-2405.991) (-2403.772) (-2411.362) [-2398.847] -- 0:01:15 786000 -- (-2404.173) (-2408.415) [-2401.093] (-2403.107) * (-2407.200) (-2400.758) [-2401.180] (-2401.321) -- 0:01:14 786500 -- (-2409.188) [-2404.536] (-2407.135) (-2405.785) * [-2401.101] (-2404.909) (-2400.344) (-2403.798) -- 0:01:14 787000 -- (-2415.557) (-2410.605) (-2400.987) [-2402.456] * (-2399.266) (-2405.029) (-2403.327) [-2403.523] -- 0:01:14 787500 -- [-2407.172] (-2402.029) (-2404.491) (-2402.441) * (-2410.254) (-2409.498) (-2407.292) [-2407.007] -- 0:01:14 788000 -- (-2408.060) [-2407.190] (-2402.690) (-2396.865) * (-2411.946) [-2409.638] (-2411.408) (-2405.085) -- 0:01:14 788500 -- (-2406.116) (-2405.061) (-2402.666) [-2402.395] * [-2405.467] (-2405.036) (-2400.003) (-2404.480) -- 0:01:14 789000 -- (-2400.285) [-2407.027] (-2403.998) (-2404.241) * (-2407.043) (-2398.843) [-2400.128] (-2410.920) -- 0:01:13 789500 -- (-2405.037) (-2406.256) (-2398.228) [-2409.729] * (-2405.187) (-2405.599) [-2405.389] (-2409.465) -- 0:01:13 790000 -- (-2406.292) (-2406.681) [-2401.116] (-2406.628) * (-2403.475) (-2403.635) [-2404.470] (-2406.861) -- 0:01:13 Average standard deviation of split frequencies: 0.000835 790500 -- (-2404.603) (-2408.734) (-2404.587) [-2409.762] * (-2404.796) (-2412.981) (-2402.981) [-2406.574] -- 0:01:13 791000 -- (-2403.557) (-2402.392) [-2407.755] (-2402.645) * (-2410.521) (-2404.717) [-2400.938] (-2410.561) -- 0:01:13 791500 -- [-2403.443] (-2404.488) (-2398.940) (-2407.359) * (-2405.784) (-2405.272) (-2407.901) [-2405.849] -- 0:01:12 792000 -- (-2407.098) (-2403.240) [-2397.761] (-2412.236) * (-2395.813) [-2401.365] (-2405.177) (-2398.876) -- 0:01:12 792500 -- (-2417.691) (-2406.945) [-2401.693] (-2417.858) * [-2406.192] (-2397.653) (-2405.566) (-2407.617) -- 0:01:12 793000 -- (-2407.076) [-2403.187] (-2405.929) (-2411.894) * (-2401.593) (-2403.828) (-2416.415) [-2399.642] -- 0:01:12 793500 -- (-2405.974) [-2399.809] (-2407.785) (-2409.775) * (-2405.990) [-2401.387] (-2410.446) (-2406.569) -- 0:01:12 794000 -- (-2406.316) (-2405.737) [-2401.255] (-2407.904) * (-2403.497) (-2397.942) (-2408.800) [-2401.756] -- 0:01:12 794500 -- (-2399.675) (-2399.628) (-2401.901) [-2406.061] * [-2399.985] (-2403.684) (-2408.353) (-2413.481) -- 0:01:11 795000 -- (-2414.561) [-2398.966] (-2403.780) (-2410.171) * (-2403.451) (-2399.901) (-2399.450) [-2401.833] -- 0:01:11 Average standard deviation of split frequencies: 0.000829 795500 -- [-2403.443] (-2399.605) (-2408.105) (-2399.306) * (-2400.114) (-2404.720) [-2398.254] (-2396.507) -- 0:01:11 796000 -- [-2407.464] (-2404.728) (-2408.814) (-2411.005) * [-2403.232] (-2409.947) (-2406.719) (-2407.275) -- 0:01:11 796500 -- [-2394.939] (-2401.576) (-2408.147) (-2397.489) * [-2403.861] (-2400.019) (-2403.360) (-2405.014) -- 0:01:11 797000 -- [-2402.060] (-2399.805) (-2403.909) (-2413.047) * (-2400.786) (-2405.325) [-2405.262] (-2396.441) -- 0:01:11 797500 -- (-2397.794) [-2403.450] (-2404.341) (-2402.079) * (-2400.938) [-2404.278] (-2406.558) (-2402.574) -- 0:01:10 798000 -- [-2403.403] (-2398.370) (-2403.013) (-2400.772) * [-2403.803] (-2403.075) (-2399.035) (-2404.606) -- 0:01:10 798500 -- [-2400.540] (-2402.426) (-2403.507) (-2404.514) * [-2409.207] (-2409.571) (-2400.521) (-2404.097) -- 0:01:10 799000 -- [-2398.565] (-2399.936) (-2407.548) (-2396.445) * (-2398.257) [-2405.745] (-2402.626) (-2404.453) -- 0:01:10 799500 -- (-2408.328) (-2398.830) (-2401.764) [-2397.717] * [-2408.863] (-2399.474) (-2406.294) (-2404.190) -- 0:01:10 800000 -- (-2404.849) [-2403.081] (-2402.587) (-2404.473) * (-2400.996) (-2408.875) (-2407.351) [-2404.058] -- 0:01:10 Average standard deviation of split frequencies: 0.000824 800500 -- (-2407.148) (-2407.715) (-2402.157) [-2398.504] * [-2405.083] (-2407.739) (-2409.160) (-2403.428) -- 0:01:09 801000 -- (-2412.771) (-2402.032) [-2400.106] (-2403.212) * (-2416.025) [-2401.271] (-2402.701) (-2405.562) -- 0:01:09 801500 -- (-2405.060) [-2397.447] (-2404.311) (-2399.537) * (-2402.057) (-2402.752) (-2399.516) [-2410.309] -- 0:01:09 802000 -- (-2400.456) [-2401.217] (-2406.682) (-2402.708) * (-2398.340) (-2416.565) [-2402.022] (-2405.333) -- 0:01:09 802500 -- [-2404.353] (-2404.295) (-2408.029) (-2403.748) * [-2401.868] (-2411.787) (-2404.383) (-2402.860) -- 0:01:09 803000 -- (-2410.660) (-2402.383) (-2405.676) [-2401.457] * [-2398.744] (-2409.773) (-2405.883) (-2401.643) -- 0:01:08 803500 -- (-2404.756) (-2401.824) [-2401.960] (-2405.249) * (-2401.142) [-2403.880] (-2411.969) (-2406.948) -- 0:01:08 804000 -- (-2407.269) (-2404.981) [-2399.918] (-2409.909) * (-2404.631) (-2410.749) (-2399.555) [-2408.546] -- 0:01:08 804500 -- (-2404.951) [-2405.789] (-2407.653) (-2407.939) * (-2415.244) (-2407.019) (-2406.690) [-2411.133] -- 0:01:08 805000 -- (-2398.309) (-2403.340) [-2409.792] (-2406.118) * (-2405.781) (-2416.709) [-2407.182] (-2407.838) -- 0:01:08 Average standard deviation of split frequencies: 0.000819 805500 -- (-2402.735) (-2404.646) (-2400.910) [-2402.374] * [-2402.858] (-2414.076) (-2401.626) (-2401.260) -- 0:01:08 806000 -- (-2401.827) (-2403.264) (-2397.284) [-2408.322] * [-2405.127] (-2410.294) (-2401.940) (-2396.121) -- 0:01:07 806500 -- [-2403.481] (-2415.139) (-2408.592) (-2401.638) * (-2400.011) (-2401.345) [-2400.444] (-2402.812) -- 0:01:07 807000 -- (-2404.227) (-2406.297) [-2404.173] (-2407.548) * (-2401.727) (-2407.835) (-2399.389) [-2400.895] -- 0:01:07 807500 -- (-2402.248) (-2401.414) [-2404.086] (-2406.604) * (-2402.685) (-2401.145) (-2406.244) [-2406.382] -- 0:01:07 808000 -- [-2403.442] (-2404.365) (-2404.810) (-2404.250) * (-2406.590) [-2394.955] (-2406.430) (-2402.399) -- 0:01:07 808500 -- [-2399.456] (-2406.756) (-2405.089) (-2406.229) * (-2404.647) (-2411.771) [-2407.529] (-2410.071) -- 0:01:07 809000 -- (-2403.183) [-2402.147] (-2402.288) (-2409.175) * [-2402.972] (-2416.737) (-2408.130) (-2403.712) -- 0:01:06 809500 -- (-2403.001) [-2401.826] (-2408.018) (-2408.514) * [-2402.282] (-2414.837) (-2406.508) (-2408.857) -- 0:01:06 810000 -- (-2402.155) [-2402.657] (-2410.151) (-2402.656) * (-2406.635) (-2414.000) [-2405.501] (-2407.559) -- 0:01:06 Average standard deviation of split frequencies: 0.000930 810500 -- [-2398.608] (-2408.664) (-2408.122) (-2405.588) * (-2401.644) (-2409.714) (-2415.312) [-2403.465] -- 0:01:06 811000 -- (-2400.971) (-2398.332) (-2410.057) [-2408.400] * (-2408.430) [-2409.895] (-2402.754) (-2403.925) -- 0:01:06 811500 -- (-2398.723) [-2395.979] (-2403.539) (-2400.070) * (-2401.119) [-2400.405] (-2404.388) (-2409.462) -- 0:01:05 812000 -- (-2404.679) (-2404.969) [-2396.312] (-2410.540) * (-2401.720) (-2412.558) (-2405.647) [-2402.338] -- 0:01:05 812500 -- (-2401.515) (-2402.938) [-2400.838] (-2405.003) * [-2405.438] (-2406.896) (-2407.062) (-2409.239) -- 0:01:05 813000 -- (-2410.501) [-2403.793] (-2402.050) (-2408.724) * [-2400.804] (-2408.048) (-2402.963) (-2405.219) -- 0:01:05 813500 -- [-2404.165] (-2404.571) (-2411.144) (-2407.828) * (-2398.859) [-2401.768] (-2401.836) (-2410.110) -- 0:01:05 814000 -- (-2407.032) (-2405.862) (-2399.448) [-2413.289] * (-2403.155) [-2411.531] (-2400.624) (-2407.891) -- 0:01:05 814500 -- (-2405.473) (-2403.231) (-2399.759) [-2402.475] * (-2400.433) (-2406.110) [-2405.123] (-2403.611) -- 0:01:04 815000 -- (-2405.574) (-2405.113) (-2407.587) [-2401.615] * (-2406.273) (-2404.779) [-2398.677] (-2405.127) -- 0:01:04 Average standard deviation of split frequencies: 0.001618 815500 -- [-2406.675] (-2406.812) (-2405.913) (-2407.454) * (-2401.219) (-2398.907) [-2397.196] (-2406.253) -- 0:01:04 816000 -- (-2407.998) (-2404.200) (-2403.184) [-2403.485] * [-2404.446] (-2410.012) (-2403.837) (-2408.909) -- 0:01:04 816500 -- (-2405.093) [-2400.647] (-2406.963) (-2416.855) * [-2401.199] (-2407.499) (-2399.731) (-2420.796) -- 0:01:04 817000 -- (-2398.273) [-2404.807] (-2400.448) (-2421.054) * [-2399.195] (-2400.542) (-2403.674) (-2415.462) -- 0:01:04 817500 -- (-2399.165) (-2404.702) [-2398.869] (-2414.222) * (-2402.166) (-2409.168) [-2399.323] (-2402.756) -- 0:01:03 818000 -- (-2400.718) (-2406.424) (-2403.013) [-2402.222] * (-2399.951) (-2410.268) [-2397.497] (-2401.585) -- 0:01:03 818500 -- [-2403.379] (-2407.580) (-2406.013) (-2403.179) * (-2402.198) (-2408.880) (-2403.991) [-2401.682] -- 0:01:03 819000 -- (-2402.672) [-2405.227] (-2405.444) (-2408.924) * [-2409.753] (-2405.282) (-2401.662) (-2400.433) -- 0:01:03 819500 -- [-2399.209] (-2406.934) (-2407.383) (-2403.207) * (-2405.347) (-2403.868) (-2403.690) [-2397.507] -- 0:01:03 820000 -- (-2406.899) [-2403.006] (-2399.558) (-2406.886) * [-2409.427] (-2405.337) (-2402.751) (-2402.716) -- 0:01:03 Average standard deviation of split frequencies: 0.002527 820500 -- (-2403.452) [-2400.087] (-2410.309) (-2412.946) * [-2398.231] (-2406.052) (-2401.752) (-2401.516) -- 0:01:02 821000 -- (-2409.558) (-2407.225) [-2400.528] (-2409.691) * [-2403.483] (-2405.634) (-2400.247) (-2408.181) -- 0:01:02 821500 -- (-2404.522) (-2407.415) (-2401.293) [-2401.231] * (-2402.328) [-2408.767] (-2401.861) (-2399.963) -- 0:01:02 822000 -- [-2403.775] (-2405.668) (-2404.094) (-2400.871) * (-2400.040) [-2401.613] (-2413.786) (-2402.685) -- 0:01:02 822500 -- (-2406.954) (-2405.387) (-2398.567) [-2397.741] * (-2401.576) (-2414.023) (-2408.606) [-2403.711] -- 0:01:02 823000 -- (-2400.549) (-2412.319) [-2401.729] (-2405.069) * [-2405.043] (-2403.842) (-2403.657) (-2402.500) -- 0:01:01 823500 -- (-2405.464) [-2407.901] (-2409.359) (-2410.837) * (-2403.855) [-2398.726] (-2405.024) (-2399.739) -- 0:01:01 824000 -- (-2408.624) (-2402.451) [-2395.244] (-2405.781) * [-2399.950] (-2401.326) (-2402.573) (-2403.829) -- 0:01:01 824500 -- [-2409.578] (-2401.879) (-2405.989) (-2406.590) * (-2401.294) (-2403.027) (-2401.689) [-2401.196] -- 0:01:01 825000 -- (-2404.439) [-2403.334] (-2402.257) (-2411.800) * [-2403.538] (-2402.755) (-2404.825) (-2411.141) -- 0:01:01 Average standard deviation of split frequencies: 0.003424 825500 -- [-2399.225] (-2399.531) (-2399.746) (-2406.068) * (-2402.859) [-2406.616] (-2409.309) (-2406.339) -- 0:01:01 826000 -- [-2404.420] (-2405.400) (-2410.305) (-2406.441) * [-2408.296] (-2403.576) (-2400.406) (-2407.716) -- 0:01:00 826500 -- (-2403.436) (-2404.948) [-2404.078] (-2398.315) * (-2404.245) (-2407.193) [-2395.856] (-2409.495) -- 0:01:00 827000 -- (-2409.617) [-2400.974] (-2398.078) (-2407.025) * (-2402.408) (-2409.376) [-2401.892] (-2405.388) -- 0:01:00 827500 -- [-2408.007] (-2405.915) (-2402.901) (-2399.619) * (-2402.076) (-2409.103) [-2402.406] (-2399.850) -- 0:01:00 828000 -- [-2400.727] (-2409.307) (-2404.524) (-2400.600) * (-2403.601) [-2401.329] (-2407.790) (-2407.965) -- 0:01:00 828500 -- (-2404.406) (-2410.169) (-2400.678) [-2402.657] * [-2397.322] (-2403.360) (-2402.249) (-2400.764) -- 0:01:00 829000 -- (-2398.052) (-2401.919) (-2407.615) [-2408.449] * (-2404.222) (-2404.210) [-2403.164] (-2406.348) -- 0:00:59 829500 -- (-2406.484) (-2404.052) (-2414.350) [-2399.790] * [-2405.496] (-2404.925) (-2400.079) (-2404.596) -- 0:00:59 830000 -- (-2417.441) [-2399.311] (-2404.696) (-2404.785) * (-2408.885) (-2406.842) [-2401.535] (-2399.336) -- 0:00:59 Average standard deviation of split frequencies: 0.003519 830500 -- (-2403.532) (-2396.596) (-2406.460) [-2402.012] * (-2409.785) [-2417.594] (-2405.911) (-2403.460) -- 0:00:59 831000 -- (-2408.634) (-2404.341) [-2403.625] (-2409.614) * (-2404.970) (-2410.611) [-2404.881] (-2403.127) -- 0:00:59 831500 -- (-2407.309) [-2399.851] (-2407.048) (-2407.473) * (-2397.035) (-2403.719) (-2404.184) [-2399.500] -- 0:00:58 832000 -- (-2398.402) [-2400.259] (-2402.670) (-2405.867) * (-2409.288) (-2401.269) [-2399.396] (-2398.529) -- 0:00:58 832500 -- (-2399.697) (-2399.344) (-2404.060) [-2406.141] * (-2403.400) [-2400.688] (-2407.212) (-2411.810) -- 0:00:58 833000 -- (-2400.248) [-2399.155] (-2402.845) (-2402.601) * (-2395.373) (-2401.105) (-2410.721) [-2398.551] -- 0:00:58 833500 -- [-2396.657] (-2403.058) (-2404.246) (-2401.224) * (-2402.425) (-2404.851) (-2401.410) [-2406.326] -- 0:00:58 834000 -- (-2407.024) (-2403.098) [-2400.390] (-2404.497) * (-2401.727) (-2402.807) [-2398.362] (-2402.884) -- 0:00:58 834500 -- (-2403.622) (-2400.403) (-2404.137) [-2401.044] * (-2409.226) (-2402.974) (-2409.191) [-2405.281] -- 0:00:57 835000 -- (-2402.853) [-2400.299] (-2412.100) (-2405.202) * (-2399.716) (-2401.060) (-2403.888) [-2405.952] -- 0:00:57 Average standard deviation of split frequencies: 0.004624 835500 -- [-2404.022] (-2402.533) (-2411.856) (-2416.564) * [-2405.536] (-2404.620) (-2402.547) (-2408.366) -- 0:00:57 836000 -- (-2401.372) (-2409.866) (-2411.988) [-2402.776] * (-2406.636) (-2418.356) (-2406.402) [-2404.721] -- 0:00:57 836500 -- (-2402.969) (-2409.942) (-2401.426) [-2406.497] * [-2399.515] (-2404.444) (-2409.872) (-2405.263) -- 0:00:57 837000 -- (-2404.520) (-2406.447) [-2402.149] (-2401.933) * (-2405.059) (-2408.713) (-2403.328) [-2401.783] -- 0:00:57 837500 -- (-2398.898) [-2402.718] (-2407.932) (-2402.239) * (-2406.016) [-2400.965] (-2406.805) (-2405.243) -- 0:00:56 838000 -- (-2399.562) (-2403.341) [-2405.832] (-2405.307) * (-2404.540) (-2404.444) (-2409.952) [-2400.327] -- 0:00:56 838500 -- [-2401.294] (-2404.558) (-2415.078) (-2399.784) * [-2400.686] (-2406.356) (-2408.984) (-2401.424) -- 0:00:56 839000 -- (-2402.595) [-2402.985] (-2404.258) (-2404.866) * [-2405.858] (-2410.026) (-2402.637) (-2409.097) -- 0:00:56 839500 -- (-2415.115) [-2397.910] (-2408.546) (-2408.326) * [-2398.794] (-2407.318) (-2404.878) (-2408.847) -- 0:00:56 840000 -- (-2398.134) (-2400.639) [-2403.154] (-2412.940) * (-2405.926) (-2412.339) [-2403.823] (-2400.961) -- 0:00:56 Average standard deviation of split frequencies: 0.003925 840500 -- (-2409.623) (-2403.603) [-2402.606] (-2416.757) * [-2401.305] (-2405.252) (-2400.588) (-2408.191) -- 0:00:55 841000 -- (-2409.289) [-2409.949] (-2401.646) (-2406.479) * (-2407.423) [-2401.261] (-2406.168) (-2405.875) -- 0:00:55 841500 -- (-2409.543) [-2402.863] (-2401.955) (-2400.110) * [-2414.739] (-2398.679) (-2404.089) (-2402.386) -- 0:00:55 842000 -- [-2399.795] (-2398.443) (-2408.288) (-2398.626) * (-2401.103) [-2399.415] (-2406.821) (-2403.305) -- 0:00:55 842500 -- (-2402.453) (-2399.168) [-2399.903] (-2410.097) * (-2401.017) (-2407.145) (-2404.559) [-2408.132] -- 0:00:55 843000 -- (-2404.491) (-2407.058) (-2403.256) [-2403.823] * [-2402.192] (-2405.015) (-2400.221) (-2401.665) -- 0:00:54 843500 -- (-2400.986) (-2408.532) (-2399.981) [-2405.480] * (-2406.783) [-2402.321] (-2401.923) (-2401.403) -- 0:00:54 844000 -- [-2402.004] (-2402.991) (-2403.803) (-2411.997) * (-2399.699) (-2407.759) [-2400.791] (-2405.398) -- 0:00:54 844500 -- (-2407.366) (-2400.676) (-2401.909) [-2405.786] * (-2407.779) [-2404.954] (-2404.134) (-2415.366) -- 0:00:54 845000 -- [-2401.126] (-2405.921) (-2405.065) (-2402.553) * (-2405.857) (-2409.025) (-2404.018) [-2410.899] -- 0:00:54 Average standard deviation of split frequencies: 0.003678 845500 -- (-2401.207) (-2407.843) (-2404.233) [-2405.599] * (-2408.287) [-2403.536] (-2404.407) (-2404.535) -- 0:00:54 846000 -- (-2407.442) (-2405.964) (-2404.773) [-2400.356] * [-2401.663] (-2399.617) (-2401.006) (-2407.144) -- 0:00:53 846500 -- (-2400.444) [-2403.776] (-2403.897) (-2401.159) * [-2398.817] (-2407.962) (-2412.051) (-2405.744) -- 0:00:53 847000 -- (-2407.176) (-2408.002) (-2404.356) [-2404.695] * (-2403.037) (-2401.032) [-2411.686] (-2402.915) -- 0:00:53 847500 -- [-2410.517] (-2411.113) (-2409.016) (-2401.442) * [-2401.084] (-2402.330) (-2405.338) (-2404.367) -- 0:00:53 848000 -- (-2405.342) [-2399.211] (-2399.011) (-2404.446) * (-2405.718) [-2398.760] (-2402.661) (-2399.248) -- 0:00:53 848500 -- (-2402.999) (-2398.414) [-2408.223] (-2406.557) * [-2406.761] (-2410.355) (-2410.921) (-2402.770) -- 0:00:53 849000 -- (-2403.316) (-2399.577) (-2405.460) [-2404.958] * (-2406.713) (-2405.470) (-2401.851) [-2407.921] -- 0:00:52 849500 -- (-2404.845) (-2403.640) (-2407.028) [-2404.076] * (-2408.138) (-2414.532) (-2398.540) [-2403.385] -- 0:00:52 850000 -- (-2397.336) [-2400.552] (-2404.921) (-2403.888) * (-2407.622) (-2410.584) [-2403.011] (-2404.536) -- 0:00:52 Average standard deviation of split frequencies: 0.004322 850500 -- (-2407.793) [-2401.647] (-2406.092) (-2403.241) * (-2410.558) (-2405.522) (-2405.479) [-2400.281] -- 0:00:52 851000 -- (-2410.770) (-2400.890) (-2404.057) [-2398.418] * [-2400.843] (-2403.098) (-2406.902) (-2404.133) -- 0:00:52 851500 -- (-2403.785) (-2401.611) (-2403.391) [-2400.098] * [-2403.745] (-2401.610) (-2397.991) (-2401.020) -- 0:00:51 852000 -- (-2410.318) (-2416.589) [-2397.152] (-2402.669) * (-2401.945) (-2398.455) (-2415.615) [-2399.904] -- 0:00:51 852500 -- (-2402.439) (-2399.752) [-2397.862] (-2399.933) * (-2401.820) [-2403.130] (-2406.545) (-2405.231) -- 0:00:51 853000 -- (-2406.224) [-2399.787] (-2401.213) (-2399.944) * (-2405.197) (-2402.492) (-2398.106) [-2406.800] -- 0:00:51 853500 -- [-2405.285] (-2406.903) (-2413.982) (-2398.772) * (-2403.675) [-2404.414] (-2401.160) (-2400.382) -- 0:00:51 854000 -- (-2404.260) (-2403.338) (-2406.235) [-2400.367] * (-2404.638) (-2402.471) [-2407.555] (-2401.981) -- 0:00:51 854500 -- [-2405.191] (-2402.229) (-2397.921) (-2403.913) * (-2413.614) (-2401.803) (-2404.499) [-2406.799] -- 0:00:50 855000 -- (-2408.166) [-2398.178] (-2402.016) (-2408.545) * [-2406.950] (-2408.500) (-2403.999) (-2401.980) -- 0:00:50 Average standard deviation of split frequencies: 0.004296 855500 -- (-2399.935) [-2401.458] (-2407.342) (-2404.796) * (-2399.955) (-2403.496) [-2406.942] (-2401.522) -- 0:00:50 856000 -- (-2398.540) (-2403.109) [-2406.291] (-2402.311) * (-2400.073) [-2401.324] (-2401.882) (-2410.459) -- 0:00:50 856500 -- [-2399.687] (-2403.548) (-2408.911) (-2406.924) * [-2400.404] (-2405.623) (-2399.838) (-2400.282) -- 0:00:50 857000 -- (-2402.272) [-2396.305] (-2404.512) (-2403.458) * [-2407.278] (-2403.957) (-2401.888) (-2398.659) -- 0:00:50 857500 -- (-2403.451) [-2395.194] (-2416.541) (-2400.939) * (-2399.302) (-2413.439) [-2400.355] (-2397.288) -- 0:00:49 858000 -- (-2409.479) [-2404.322] (-2406.125) (-2402.117) * (-2406.711) (-2409.153) (-2400.350) [-2407.964] -- 0:00:49 858500 -- [-2397.941] (-2403.853) (-2405.215) (-2406.055) * (-2403.089) (-2408.638) [-2410.411] (-2410.745) -- 0:00:49 859000 -- (-2403.893) [-2404.468] (-2402.857) (-2400.916) * [-2401.145] (-2407.921) (-2403.840) (-2411.811) -- 0:00:49 859500 -- (-2406.136) (-2402.538) [-2405.957] (-2398.473) * (-2399.620) (-2409.431) (-2412.562) [-2403.349] -- 0:00:49 860000 -- (-2414.837) (-2407.248) [-2401.073] (-2407.900) * [-2403.791] (-2407.931) (-2405.451) (-2411.474) -- 0:00:49 Average standard deviation of split frequencies: 0.003834 860500 -- (-2404.066) (-2408.244) (-2402.388) [-2402.403] * (-2403.178) [-2404.198] (-2400.084) (-2423.003) -- 0:00:48 861000 -- (-2402.138) [-2400.298] (-2404.533) (-2403.370) * (-2401.337) [-2401.797] (-2415.381) (-2408.155) -- 0:00:48 861500 -- (-2404.064) [-2409.706] (-2413.916) (-2401.105) * [-2404.040] (-2409.977) (-2410.891) (-2410.967) -- 0:00:48 862000 -- [-2401.837] (-2404.679) (-2403.141) (-2400.221) * (-2407.922) (-2400.398) (-2409.921) [-2403.373] -- 0:00:48 862500 -- [-2399.073] (-2404.557) (-2403.965) (-2410.245) * (-2403.505) (-2402.368) (-2402.644) [-2398.179] -- 0:00:48 863000 -- (-2398.459) [-2408.887] (-2405.262) (-2405.596) * [-2403.787] (-2401.467) (-2405.710) (-2406.627) -- 0:00:47 863500 -- (-2407.131) (-2416.147) [-2403.191] (-2398.549) * (-2404.059) (-2403.867) (-2406.635) [-2400.385] -- 0:00:47 864000 -- (-2402.731) (-2411.508) (-2402.935) [-2403.125] * [-2400.758] (-2403.569) (-2407.187) (-2397.580) -- 0:00:47 864500 -- (-2404.102) [-2406.270] (-2408.552) (-2409.367) * [-2404.790] (-2406.650) (-2409.006) (-2398.444) -- 0:00:47 865000 -- (-2414.113) (-2412.328) (-2400.083) [-2405.366] * (-2404.412) [-2404.633] (-2405.407) (-2404.985) -- 0:00:47 Average standard deviation of split frequencies: 0.004464 865500 -- (-2401.321) [-2400.034] (-2409.230) (-2401.662) * (-2407.872) (-2401.725) [-2403.478] (-2398.150) -- 0:00:47 866000 -- (-2407.266) [-2400.651] (-2402.757) (-2407.189) * [-2412.194] (-2402.693) (-2404.215) (-2410.086) -- 0:00:46 866500 -- (-2404.331) (-2402.032) [-2399.055] (-2401.624) * (-2404.466) (-2408.706) [-2412.158] (-2406.645) -- 0:00:46 867000 -- (-2406.367) (-2399.265) (-2401.502) [-2403.900] * (-2413.603) (-2403.443) (-2413.536) [-2409.801] -- 0:00:46 867500 -- (-2400.230) [-2407.759] (-2405.409) (-2405.398) * [-2409.940] (-2413.708) (-2403.583) (-2413.062) -- 0:00:46 868000 -- (-2403.309) (-2406.964) [-2404.312] (-2403.005) * (-2409.912) [-2409.834] (-2395.760) (-2415.131) -- 0:00:46 868500 -- (-2403.236) (-2403.053) (-2404.366) [-2402.264] * (-2410.222) (-2403.814) (-2400.207) [-2410.504] -- 0:00:46 869000 -- (-2398.887) (-2399.978) [-2403.892] (-2395.646) * [-2402.521] (-2404.778) (-2400.101) (-2415.594) -- 0:00:45 869500 -- (-2398.276) (-2404.067) (-2398.606) [-2403.444] * [-2403.936] (-2402.451) (-2403.326) (-2404.287) -- 0:00:45 870000 -- (-2402.747) (-2400.320) [-2400.673] (-2406.433) * (-2408.454) [-2398.676] (-2401.193) (-2404.329) -- 0:00:45 Average standard deviation of split frequencies: 0.004656 870500 -- (-2405.512) [-2402.852] (-2406.398) (-2406.941) * (-2399.945) (-2399.987) (-2401.109) [-2402.880] -- 0:00:45 871000 -- (-2407.299) (-2401.972) [-2402.265] (-2409.144) * (-2407.274) (-2408.038) (-2401.567) [-2405.923] -- 0:00:45 871500 -- (-2404.857) [-2399.178] (-2403.242) (-2404.353) * (-2403.463) (-2403.261) [-2398.901] (-2406.305) -- 0:00:44 872000 -- (-2402.888) (-2405.587) [-2405.038] (-2410.049) * (-2405.315) [-2403.692] (-2408.392) (-2404.694) -- 0:00:44 872500 -- (-2401.958) (-2403.902) [-2402.604] (-2413.633) * (-2400.637) [-2401.078] (-2408.696) (-2401.505) -- 0:00:44 873000 -- (-2400.878) (-2411.762) (-2403.518) [-2405.247] * [-2398.881] (-2398.136) (-2399.428) (-2407.480) -- 0:00:44 873500 -- [-2407.014] (-2402.918) (-2403.001) (-2405.323) * [-2398.218] (-2405.007) (-2408.035) (-2398.840) -- 0:00:44 874000 -- (-2399.332) [-2405.628] (-2397.134) (-2404.582) * (-2404.516) (-2396.009) (-2411.441) [-2402.443] -- 0:00:44 874500 -- [-2401.906] (-2402.695) (-2403.387) (-2406.987) * [-2403.761] (-2404.271) (-2408.200) (-2401.948) -- 0:00:43 875000 -- (-2416.843) (-2407.531) [-2408.381] (-2397.306) * [-2410.801] (-2406.768) (-2403.703) (-2412.232) -- 0:00:43 Average standard deviation of split frequencies: 0.005704 875500 -- (-2403.452) (-2404.376) (-2398.524) [-2403.980] * (-2407.083) (-2403.419) [-2401.068] (-2401.521) -- 0:00:43 876000 -- (-2408.601) (-2411.299) (-2403.704) [-2402.921] * [-2409.184] (-2399.750) (-2409.935) (-2404.727) -- 0:00:43 876500 -- [-2405.513] (-2405.951) (-2408.825) (-2403.170) * (-2403.484) (-2405.000) (-2405.198) [-2403.442] -- 0:00:43 877000 -- (-2406.455) [-2403.557] (-2410.891) (-2402.268) * (-2401.694) (-2409.984) (-2405.901) [-2402.289] -- 0:00:43 877500 -- (-2414.021) (-2399.972) (-2411.613) [-2397.836] * (-2407.149) (-2401.445) (-2408.224) [-2401.574] -- 0:00:42 878000 -- [-2409.852] (-2405.943) (-2408.249) (-2403.713) * (-2403.020) [-2400.845] (-2404.619) (-2399.907) -- 0:00:42 878500 -- (-2403.946) [-2397.462] (-2400.579) (-2402.831) * [-2407.138] (-2410.822) (-2404.368) (-2402.860) -- 0:00:42 879000 -- (-2407.500) (-2404.333) (-2407.955) [-2394.885] * (-2406.033) (-2397.929) [-2402.505] (-2399.399) -- 0:00:42 879500 -- [-2404.633] (-2410.702) (-2399.440) (-2402.848) * (-2400.718) (-2398.461) [-2397.978] (-2405.724) -- 0:00:42 880000 -- (-2406.450) [-2403.060] (-2396.776) (-2398.318) * [-2406.864] (-2402.061) (-2401.479) (-2400.897) -- 0:00:42 Average standard deviation of split frequencies: 0.005246 880500 -- (-2402.098) (-2408.804) (-2404.582) [-2402.975] * [-2404.424] (-2399.641) (-2400.608) (-2406.760) -- 0:00:41 881000 -- (-2402.735) [-2401.011] (-2406.083) (-2401.796) * [-2404.267] (-2403.467) (-2395.087) (-2407.214) -- 0:00:41 881500 -- (-2409.578) (-2406.139) (-2406.093) [-2401.073] * (-2404.716) (-2403.525) [-2406.098] (-2401.944) -- 0:00:41 882000 -- (-2410.523) (-2404.380) (-2406.317) [-2401.171] * (-2411.073) (-2408.019) [-2409.439] (-2399.178) -- 0:00:41 882500 -- [-2402.950] (-2399.682) (-2398.183) (-2398.382) * [-2401.257] (-2404.128) (-2407.074) (-2401.127) -- 0:00:41 883000 -- (-2401.972) [-2401.194] (-2401.476) (-2408.882) * (-2400.231) [-2399.164] (-2415.891) (-2413.856) -- 0:00:40 883500 -- (-2397.362) (-2404.233) (-2403.745) [-2403.052] * (-2404.732) (-2404.739) (-2401.240) [-2403.565] -- 0:00:40 884000 -- [-2402.084] (-2398.046) (-2404.034) (-2405.881) * (-2407.158) (-2400.423) [-2397.481] (-2403.091) -- 0:00:40 884500 -- [-2411.867] (-2397.787) (-2404.372) (-2398.338) * (-2402.656) (-2406.183) [-2403.272] (-2406.615) -- 0:00:40 885000 -- [-2407.243] (-2406.363) (-2400.064) (-2403.621) * [-2398.913] (-2402.112) (-2406.552) (-2401.863) -- 0:00:40 Average standard deviation of split frequencies: 0.005214 885500 -- (-2402.254) (-2401.053) [-2403.727] (-2405.484) * [-2408.738] (-2401.025) (-2407.511) (-2405.840) -- 0:00:40 886000 -- (-2399.923) [-2408.388] (-2410.739) (-2398.908) * [-2399.286] (-2402.207) (-2398.827) (-2410.174) -- 0:00:39 886500 -- [-2400.217] (-2406.079) (-2405.251) (-2403.032) * [-2404.259] (-2411.790) (-2410.425) (-2402.649) -- 0:00:39 887000 -- (-2401.378) (-2407.777) [-2408.749] (-2403.999) * [-2403.228] (-2402.518) (-2409.138) (-2410.944) -- 0:00:39 887500 -- (-2403.513) (-2403.886) [-2404.933] (-2403.822) * (-2400.372) (-2404.023) [-2400.059] (-2400.551) -- 0:00:39 888000 -- (-2411.938) (-2401.999) (-2408.736) [-2403.422] * (-2398.511) (-2409.041) [-2400.064] (-2398.475) -- 0:00:39 888500 -- [-2407.073] (-2403.036) (-2418.289) (-2402.728) * (-2404.410) [-2402.316] (-2403.962) (-2405.164) -- 0:00:39 889000 -- (-2407.408) [-2404.476] (-2410.110) (-2401.106) * (-2413.109) (-2402.921) (-2409.137) [-2410.390] -- 0:00:38 889500 -- (-2401.579) (-2404.812) (-2402.007) [-2406.875] * (-2404.159) [-2400.352] (-2403.361) (-2413.129) -- 0:00:38 890000 -- (-2407.721) [-2401.238] (-2406.734) (-2409.512) * (-2400.159) (-2407.710) (-2406.407) [-2403.368] -- 0:00:38 Average standard deviation of split frequencies: 0.004552 890500 -- [-2401.255] (-2403.985) (-2404.852) (-2413.254) * (-2401.194) (-2407.418) [-2402.289] (-2407.000) -- 0:00:38 891000 -- [-2403.803] (-2399.564) (-2405.414) (-2401.891) * (-2402.008) [-2400.356] (-2401.534) (-2413.825) -- 0:00:38 891500 -- (-2399.804) [-2407.498] (-2406.835) (-2404.716) * (-2400.967) [-2398.653] (-2403.483) (-2403.869) -- 0:00:37 892000 -- (-2406.536) (-2402.949) (-2407.145) [-2400.261] * (-2405.340) [-2398.169] (-2396.998) (-2407.181) -- 0:00:37 892500 -- (-2406.670) [-2412.449] (-2407.350) (-2410.001) * (-2406.037) (-2403.512) [-2407.092] (-2406.119) -- 0:00:37 893000 -- (-2403.043) (-2407.898) (-2406.546) [-2404.568] * [-2410.471] (-2401.952) (-2405.396) (-2404.933) -- 0:00:37 893500 -- (-2402.035) [-2405.293] (-2406.984) (-2408.137) * (-2402.738) [-2402.290] (-2405.462) (-2409.225) -- 0:00:37 894000 -- (-2405.156) [-2401.530] (-2403.687) (-2402.107) * [-2404.334] (-2409.455) (-2406.096) (-2401.876) -- 0:00:37 894500 -- (-2407.972) [-2401.362] (-2400.665) (-2404.312) * [-2401.492] (-2416.466) (-2411.816) (-2395.547) -- 0:00:36 895000 -- [-2404.454] (-2405.945) (-2411.216) (-2405.774) * [-2400.004] (-2414.871) (-2408.012) (-2408.189) -- 0:00:36 Average standard deviation of split frequencies: 0.003893 895500 -- (-2408.933) (-2407.762) (-2408.175) [-2404.627] * (-2410.529) (-2416.276) (-2400.871) [-2403.545] -- 0:00:36 896000 -- [-2409.258] (-2404.665) (-2400.460) (-2402.847) * [-2402.165] (-2414.331) (-2406.146) (-2403.560) -- 0:00:36 896500 -- [-2399.264] (-2401.488) (-2405.330) (-2405.735) * (-2402.284) (-2401.369) [-2398.508] (-2406.941) -- 0:00:36 897000 -- (-2403.578) (-2407.774) (-2408.772) [-2401.335] * (-2400.439) (-2402.313) (-2404.637) [-2399.247] -- 0:00:36 897500 -- (-2404.892) (-2399.381) [-2404.353] (-2405.774) * (-2403.628) (-2399.699) (-2409.126) [-2398.390] -- 0:00:35 898000 -- (-2402.801) [-2400.758] (-2405.173) (-2398.842) * (-2400.849) (-2404.370) (-2404.644) [-2403.588] -- 0:00:35 898500 -- (-2399.630) (-2402.440) (-2402.022) [-2401.430] * [-2404.103] (-2399.782) (-2405.131) (-2402.532) -- 0:00:35 899000 -- (-2405.732) (-2397.928) [-2404.329] (-2404.788) * [-2398.466] (-2399.603) (-2402.339) (-2403.074) -- 0:00:35 899500 -- (-2400.492) (-2400.883) [-2402.953] (-2400.969) * [-2407.888] (-2403.342) (-2404.026) (-2410.069) -- 0:00:35 900000 -- (-2399.618) (-2405.076) (-2403.250) [-2403.301] * (-2397.631) (-2401.381) (-2403.293) [-2398.433] -- 0:00:35 Average standard deviation of split frequencies: 0.004292 900500 -- (-2410.789) (-2402.665) (-2401.384) [-2404.032] * [-2400.813] (-2399.303) (-2409.387) (-2407.845) -- 0:00:34 901000 -- (-2399.209) [-2398.512] (-2406.870) (-2410.494) * (-2404.688) (-2407.830) (-2406.094) [-2405.685] -- 0:00:34 901500 -- [-2403.318] (-2401.920) (-2404.936) (-2407.934) * (-2397.007) [-2397.886] (-2409.921) (-2398.182) -- 0:00:34 902000 -- (-2406.779) (-2400.014) [-2411.729] (-2405.006) * (-2404.167) (-2399.838) (-2400.625) [-2405.002] -- 0:00:34 902500 -- [-2405.579] (-2398.346) (-2408.550) (-2400.118) * (-2398.255) (-2401.474) [-2403.015] (-2410.014) -- 0:00:34 903000 -- (-2405.634) (-2398.398) [-2405.099] (-2406.581) * [-2399.802] (-2414.175) (-2402.898) (-2406.500) -- 0:00:33 903500 -- [-2406.088] (-2399.766) (-2398.704) (-2404.823) * [-2399.684] (-2404.622) (-2405.140) (-2401.524) -- 0:00:33 904000 -- (-2401.053) [-2401.887] (-2400.471) (-2409.198) * (-2402.577) (-2402.083) (-2399.760) [-2408.879] -- 0:00:33 904500 -- (-2405.094) (-2409.723) [-2403.367] (-2406.243) * (-2403.357) (-2410.064) [-2401.071] (-2401.558) -- 0:00:33 905000 -- (-2410.078) [-2404.097] (-2408.998) (-2405.606) * [-2402.047] (-2407.013) (-2403.066) (-2397.074) -- 0:00:33 Average standard deviation of split frequencies: 0.004267 905500 -- (-2402.206) (-2397.811) (-2409.038) [-2400.942] * (-2410.557) (-2400.608) (-2402.219) [-2406.413] -- 0:00:33 906000 -- (-2400.027) (-2403.320) (-2401.693) [-2406.148] * (-2401.985) (-2403.631) [-2405.731] (-2406.774) -- 0:00:32 906500 -- (-2404.936) (-2410.010) (-2400.884) [-2400.120] * [-2403.596] (-2401.161) (-2406.785) (-2399.505) -- 0:00:32 907000 -- (-2399.699) (-2404.721) (-2400.530) [-2398.137] * (-2411.094) (-2401.677) [-2396.151] (-2404.632) -- 0:00:32 907500 -- (-2398.497) [-2401.812] (-2399.772) (-2399.291) * (-2401.754) (-2399.112) (-2397.577) [-2397.869] -- 0:00:32 908000 -- (-2404.317) (-2398.878) (-2403.478) [-2402.503] * (-2401.521) [-2402.563] (-2399.303) (-2404.324) -- 0:00:32 908500 -- (-2405.769) [-2396.790] (-2407.489) (-2404.298) * (-2402.247) [-2399.790] (-2405.671) (-2410.028) -- 0:00:32 909000 -- (-2404.481) (-2405.006) (-2403.258) [-2400.026] * (-2400.796) [-2402.322] (-2404.688) (-2412.614) -- 0:00:31 909500 -- (-2404.426) (-2404.534) (-2406.307) [-2408.068] * (-2404.777) [-2396.962] (-2406.437) (-2413.205) -- 0:00:31 910000 -- (-2413.379) (-2399.509) (-2406.708) [-2397.040] * [-2407.628] (-2404.611) (-2406.012) (-2409.316) -- 0:00:31 Average standard deviation of split frequencies: 0.004245 910500 -- (-2405.198) (-2398.973) (-2405.636) [-2402.970] * (-2404.633) (-2403.074) [-2402.875] (-2412.540) -- 0:00:31 911000 -- (-2404.074) (-2403.978) (-2403.457) [-2400.261] * (-2403.046) [-2403.573] (-2401.859) (-2408.793) -- 0:00:31 911500 -- [-2401.754] (-2404.566) (-2403.258) (-2402.350) * (-2402.766) (-2406.762) [-2409.116] (-2401.627) -- 0:00:30 912000 -- (-2406.430) (-2413.943) [-2396.132] (-2408.455) * (-2410.600) [-2407.834] (-2408.262) (-2407.034) -- 0:00:30 912500 -- [-2397.421] (-2399.476) (-2406.336) (-2398.537) * (-2403.258) (-2402.975) (-2411.424) [-2403.884] -- 0:00:30 913000 -- (-2402.643) [-2400.722] (-2406.793) (-2404.971) * (-2408.158) (-2399.726) (-2407.016) [-2403.697] -- 0:00:30 913500 -- (-2411.009) (-2401.267) [-2404.198] (-2403.109) * (-2402.494) (-2400.282) [-2404.918] (-2399.813) -- 0:00:30 914000 -- (-2408.265) (-2404.349) (-2410.637) [-2399.690] * (-2417.567) (-2398.907) [-2400.338] (-2399.650) -- 0:00:30 914500 -- (-2398.746) [-2400.121] (-2404.188) (-2398.494) * (-2420.785) (-2405.370) (-2401.228) [-2397.633] -- 0:00:29 915000 -- [-2397.031] (-2401.106) (-2407.607) (-2404.676) * (-2412.353) [-2403.378] (-2408.965) (-2401.871) -- 0:00:29 Average standard deviation of split frequencies: 0.004014 915500 -- (-2398.934) (-2409.798) (-2399.341) [-2402.844] * (-2406.198) (-2410.585) [-2399.164] (-2408.341) -- 0:00:29 916000 -- (-2405.158) (-2405.544) [-2403.465] (-2400.013) * (-2404.361) [-2404.580] (-2399.806) (-2402.959) -- 0:00:29 916500 -- (-2414.888) (-2398.452) (-2401.612) [-2397.132] * [-2410.580] (-2404.104) (-2404.799) (-2407.277) -- 0:00:29 917000 -- (-2402.090) [-2402.787] (-2400.715) (-2403.987) * (-2397.471) (-2420.049) [-2398.109] (-2410.581) -- 0:00:29 917500 -- [-2402.567] (-2405.454) (-2398.090) (-2406.159) * (-2399.171) [-2400.128] (-2398.430) (-2414.240) -- 0:00:28 918000 -- (-2403.596) [-2405.484] (-2403.051) (-2401.696) * [-2398.461] (-2403.240) (-2401.848) (-2402.088) -- 0:00:28 918500 -- (-2403.924) [-2403.552] (-2406.890) (-2407.313) * (-2410.102) [-2397.984] (-2404.732) (-2410.941) -- 0:00:28 919000 -- [-2402.819] (-2398.149) (-2403.250) (-2404.185) * [-2401.257] (-2403.550) (-2404.378) (-2408.285) -- 0:00:28 919500 -- (-2402.545) [-2400.571] (-2399.638) (-2410.680) * (-2404.754) (-2403.579) [-2403.708] (-2409.637) -- 0:00:28 920000 -- [-2397.073] (-2410.217) (-2400.682) (-2401.506) * [-2401.015] (-2400.880) (-2399.409) (-2405.746) -- 0:00:28 Average standard deviation of split frequencies: 0.003994 920500 -- (-2398.660) [-2401.279] (-2409.055) (-2408.097) * (-2404.177) [-2399.865] (-2407.530) (-2404.721) -- 0:00:27 921000 -- (-2405.994) (-2412.995) [-2403.108] (-2411.755) * [-2402.547] (-2405.175) (-2406.610) (-2399.464) -- 0:00:27 921500 -- [-2402.518] (-2401.220) (-2403.775) (-2402.955) * (-2405.433) [-2398.467] (-2405.996) (-2403.955) -- 0:00:27 922000 -- [-2399.826] (-2397.189) (-2400.927) (-2403.038) * (-2406.935) [-2402.016] (-2406.204) (-2408.144) -- 0:00:27 922500 -- [-2397.489] (-2403.589) (-2418.516) (-2406.983) * (-2406.090) (-2409.183) [-2400.818] (-2408.171) -- 0:00:27 923000 -- [-2399.754] (-2400.997) (-2407.066) (-2407.112) * (-2406.635) (-2403.071) (-2396.703) [-2398.174] -- 0:00:26 923500 -- [-2404.352] (-2396.574) (-2409.264) (-2401.977) * (-2403.333) (-2414.127) [-2406.128] (-2405.623) -- 0:00:26 924000 -- [-2399.961] (-2404.135) (-2415.596) (-2405.519) * (-2409.258) (-2396.859) [-2399.941] (-2403.409) -- 0:00:26 924500 -- (-2399.463) [-2409.830] (-2411.026) (-2406.817) * (-2405.441) [-2403.501] (-2402.732) (-2397.698) -- 0:00:26 925000 -- (-2404.955) (-2405.282) [-2402.561] (-2403.112) * (-2400.200) (-2402.840) [-2412.620] (-2399.249) -- 0:00:26 Average standard deviation of split frequencies: 0.003971 925500 -- (-2405.323) (-2403.667) [-2403.777] (-2407.204) * (-2410.616) [-2397.098] (-2406.035) (-2402.165) -- 0:00:26 926000 -- [-2401.325] (-2405.961) (-2402.456) (-2406.103) * (-2403.784) [-2395.743] (-2400.837) (-2406.545) -- 0:00:25 926500 -- (-2403.494) (-2398.704) (-2397.907) [-2401.365] * (-2413.742) (-2400.731) [-2405.819] (-2405.573) -- 0:00:25 927000 -- (-2401.082) (-2400.561) (-2401.042) [-2400.188] * (-2401.478) (-2405.991) [-2404.344] (-2406.046) -- 0:00:25 927500 -- (-2399.578) [-2403.624] (-2412.320) (-2397.782) * [-2406.318] (-2403.550) (-2412.538) (-2401.515) -- 0:00:25 928000 -- (-2402.784) (-2403.213) (-2412.659) [-2402.164] * (-2404.002) (-2402.979) [-2401.343] (-2405.549) -- 0:00:25 928500 -- (-2405.763) (-2408.026) [-2408.026] (-2406.648) * [-2400.000] (-2403.421) (-2403.417) (-2412.682) -- 0:00:25 929000 -- [-2401.110] (-2400.495) (-2399.209) (-2401.496) * (-2407.131) [-2402.696] (-2409.933) (-2412.387) -- 0:00:24 929500 -- (-2408.990) (-2406.602) [-2403.529] (-2400.965) * [-2397.648] (-2403.586) (-2410.994) (-2406.087) -- 0:00:24 930000 -- (-2402.124) [-2403.325] (-2402.325) (-2395.917) * [-2406.404] (-2403.468) (-2403.407) (-2404.791) -- 0:00:24 Average standard deviation of split frequencies: 0.005167 930500 -- (-2412.195) (-2415.097) [-2404.630] (-2404.258) * (-2399.414) [-2404.083] (-2400.545) (-2404.654) -- 0:00:24 931000 -- (-2407.188) (-2404.129) [-2403.012] (-2399.477) * [-2404.163] (-2405.902) (-2403.640) (-2398.527) -- 0:00:24 931500 -- (-2408.001) (-2402.495) (-2402.511) [-2406.900] * (-2401.061) (-2405.379) (-2407.510) [-2403.063] -- 0:00:23 932000 -- (-2401.545) (-2406.176) [-2410.449] (-2407.875) * (-2401.948) (-2399.241) (-2405.535) [-2405.879] -- 0:00:23 932500 -- (-2403.031) [-2403.484] (-2404.523) (-2406.750) * (-2399.643) (-2405.915) [-2400.747] (-2404.201) -- 0:00:23 933000 -- (-2405.191) [-2401.724] (-2407.519) (-2405.689) * (-2402.648) (-2403.491) (-2400.409) [-2400.281] -- 0:00:23 933500 -- (-2401.676) (-2402.957) [-2402.488] (-2406.358) * (-2403.928) (-2401.383) (-2401.727) [-2402.975] -- 0:00:23 934000 -- [-2404.617] (-2399.545) (-2405.305) (-2397.420) * (-2411.357) (-2404.059) (-2405.066) [-2404.128] -- 0:00:23 934500 -- (-2405.475) (-2404.764) [-2405.434] (-2403.901) * (-2400.989) [-2402.172] (-2407.677) (-2405.067) -- 0:00:22 935000 -- (-2403.611) (-2401.610) [-2405.739] (-2405.952) * (-2403.355) (-2402.101) [-2405.309] (-2406.516) -- 0:00:22 Average standard deviation of split frequencies: 0.005540 935500 -- (-2406.045) [-2399.901] (-2414.429) (-2405.992) * (-2400.354) (-2408.789) [-2401.378] (-2401.014) -- 0:00:22 936000 -- [-2399.848] (-2402.422) (-2404.980) (-2404.550) * [-2401.514] (-2407.950) (-2405.280) (-2399.852) -- 0:00:22 936500 -- (-2404.035) [-2400.755] (-2403.959) (-2401.183) * (-2409.289) (-2403.913) [-2401.865] (-2401.568) -- 0:00:22 937000 -- (-2400.702) [-2400.682] (-2409.724) (-2400.832) * (-2405.846) [-2399.691] (-2402.613) (-2404.153) -- 0:00:22 937500 -- (-2401.956) (-2403.781) (-2415.044) [-2404.014] * [-2401.052] (-2402.277) (-2401.469) (-2403.147) -- 0:00:21 938000 -- [-2407.395] (-2407.366) (-2406.944) (-2407.647) * (-2401.237) (-2405.731) [-2399.725] (-2407.183) -- 0:00:21 938500 -- (-2405.585) (-2399.271) (-2399.481) [-2400.323] * [-2401.022] (-2403.057) (-2410.616) (-2407.164) -- 0:00:21 939000 -- (-2413.935) (-2405.904) (-2398.124) [-2399.632] * (-2402.240) (-2401.913) [-2401.123] (-2402.621) -- 0:00:21 939500 -- (-2403.654) (-2410.496) [-2399.340] (-2404.046) * (-2403.352) (-2405.534) (-2409.046) [-2399.529] -- 0:00:21 940000 -- [-2404.044] (-2420.335) (-2406.407) (-2402.732) * (-2400.866) (-2397.580) (-2398.273) [-2400.447] -- 0:00:21 Average standard deviation of split frequencies: 0.005312 940500 -- (-2409.401) (-2406.465) (-2410.852) [-2399.253] * [-2405.899] (-2415.455) (-2402.938) (-2402.668) -- 0:00:20 941000 -- (-2402.893) (-2401.907) [-2405.511] (-2405.735) * (-2411.660) (-2402.965) [-2399.774] (-2405.279) -- 0:00:20 941500 -- [-2397.312] (-2411.609) (-2401.920) (-2398.796) * (-2410.171) (-2406.329) (-2402.907) [-2400.063] -- 0:00:20 942000 -- (-2407.752) (-2415.451) (-2408.430) [-2398.138] * (-2404.355) [-2409.841] (-2406.381) (-2401.192) -- 0:00:20 942500 -- (-2408.790) (-2402.839) [-2407.857] (-2405.023) * (-2405.648) (-2406.907) (-2401.936) [-2405.948] -- 0:00:20 943000 -- (-2401.701) (-2406.223) [-2396.737] (-2407.271) * (-2409.801) (-2408.689) (-2409.070) [-2401.929] -- 0:00:19 943500 -- (-2410.778) (-2403.931) [-2409.314] (-2398.775) * (-2406.632) [-2405.463] (-2405.491) (-2407.180) -- 0:00:19 944000 -- (-2407.537) [-2401.053] (-2411.874) (-2405.326) * [-2407.484] (-2406.734) (-2401.420) (-2400.082) -- 0:00:19 944500 -- (-2410.441) [-2408.234] (-2399.418) (-2404.150) * (-2402.732) (-2407.589) (-2400.464) [-2404.008] -- 0:00:19 945000 -- (-2402.596) [-2406.338] (-2404.374) (-2405.703) * (-2407.001) (-2416.118) (-2408.279) [-2405.629] -- 0:00:19 Average standard deviation of split frequencies: 0.005481 945500 -- [-2402.510] (-2406.228) (-2409.590) (-2404.369) * [-2400.974] (-2416.326) (-2405.975) (-2408.979) -- 0:00:19 946000 -- (-2407.408) [-2402.255] (-2405.689) (-2413.426) * (-2405.700) [-2406.263] (-2401.503) (-2402.632) -- 0:00:18 946500 -- [-2405.125] (-2404.668) (-2409.891) (-2408.329) * (-2399.748) (-2409.602) [-2402.310] (-2413.301) -- 0:00:18 947000 -- (-2398.885) [-2398.429] (-2396.844) (-2404.074) * (-2401.918) [-2409.870] (-2406.648) (-2408.804) -- 0:00:18 947500 -- (-2407.980) (-2400.794) [-2403.897] (-2407.806) * (-2408.239) [-2403.142] (-2407.558) (-2410.957) -- 0:00:18 948000 -- (-2402.120) (-2404.611) (-2410.443) [-2409.322] * (-2406.685) (-2402.623) [-2402.819] (-2408.868) -- 0:00:18 948500 -- [-2403.419] (-2400.626) (-2405.161) (-2415.115) * [-2403.157] (-2407.770) (-2411.907) (-2410.052) -- 0:00:18 949000 -- (-2401.613) (-2401.973) [-2398.011] (-2409.849) * (-2408.386) (-2412.448) [-2403.329] (-2400.848) -- 0:00:17 949500 -- [-2399.146] (-2403.994) (-2402.707) (-2410.809) * (-2401.871) (-2406.757) (-2412.399) [-2402.759] -- 0:00:17 950000 -- (-2417.918) [-2405.470] (-2401.960) (-2407.664) * (-2408.788) (-2407.943) (-2414.545) [-2405.320] -- 0:00:17 Average standard deviation of split frequencies: 0.005058 950500 -- (-2395.545) (-2401.319) (-2407.177) [-2398.388] * [-2400.932] (-2403.681) (-2403.059) (-2405.149) -- 0:00:17 951000 -- [-2396.208] (-2402.191) (-2399.616) (-2408.194) * (-2404.913) (-2402.878) [-2404.483] (-2409.170) -- 0:00:17 951500 -- [-2397.467] (-2403.148) (-2404.591) (-2405.650) * (-2400.777) (-2404.780) (-2415.080) [-2405.119] -- 0:00:16 952000 -- [-2401.930] (-2400.423) (-2407.670) (-2399.298) * (-2409.076) (-2401.095) (-2397.667) [-2401.831] -- 0:00:16 952500 -- [-2399.987] (-2407.938) (-2405.059) (-2398.909) * (-2407.726) (-2408.503) [-2400.908] (-2409.470) -- 0:00:16 953000 -- (-2397.577) [-2407.680] (-2403.076) (-2397.706) * [-2402.952] (-2408.645) (-2403.432) (-2403.909) -- 0:00:16 953500 -- [-2403.103] (-2405.767) (-2401.942) (-2406.296) * (-2397.977) (-2406.450) [-2404.920] (-2407.362) -- 0:00:16 954000 -- (-2402.309) (-2399.466) [-2399.361] (-2406.496) * (-2401.492) (-2407.897) (-2405.774) [-2407.476] -- 0:00:16 954500 -- (-2410.113) (-2402.139) [-2407.010] (-2410.642) * (-2406.417) (-2404.540) (-2409.177) [-2402.078] -- 0:00:15 955000 -- (-2415.759) (-2399.289) (-2403.599) [-2406.082] * (-2398.614) (-2404.218) (-2415.683) [-2400.566] -- 0:00:15 Average standard deviation of split frequencies: 0.005227 955500 -- (-2407.388) [-2399.966] (-2400.685) (-2407.557) * (-2404.956) (-2405.207) [-2400.303] (-2406.442) -- 0:00:15 956000 -- (-2408.059) [-2404.355] (-2409.178) (-2402.319) * [-2399.709] (-2405.882) (-2396.305) (-2407.590) -- 0:00:15 956500 -- (-2406.513) (-2400.724) [-2397.541] (-2401.225) * [-2400.772] (-2409.013) (-2402.804) (-2398.315) -- 0:00:15 957000 -- (-2404.533) (-2405.147) (-2404.949) [-2407.108] * (-2402.781) (-2411.219) [-2404.897] (-2396.650) -- 0:00:15 957500 -- (-2399.976) [-2398.228] (-2402.080) (-2412.283) * (-2406.751) [-2398.651] (-2403.362) (-2401.354) -- 0:00:14 958000 -- (-2404.748) [-2407.784] (-2405.973) (-2404.202) * (-2405.989) (-2408.757) (-2402.882) [-2397.538] -- 0:00:14 958500 -- (-2401.562) (-2406.444) [-2399.037] (-2404.417) * [-2402.798] (-2405.582) (-2408.546) (-2403.027) -- 0:00:14 959000 -- (-2407.831) (-2411.604) [-2403.567] (-2405.846) * (-2404.799) (-2397.654) (-2406.595) [-2404.572] -- 0:00:14 959500 -- (-2407.597) (-2411.504) [-2399.938] (-2410.555) * (-2403.684) [-2400.950] (-2401.076) (-2408.299) -- 0:00:14 960000 -- (-2407.241) [-2401.464] (-2407.452) (-2404.982) * (-2401.326) [-2402.289] (-2408.300) (-2403.509) -- 0:00:14 Average standard deviation of split frequencies: 0.005790 960500 -- (-2404.263) (-2403.627) (-2407.345) [-2408.619] * (-2402.594) (-2401.949) (-2404.400) [-2405.368] -- 0:00:13 961000 -- (-2402.083) [-2400.028] (-2402.526) (-2409.188) * (-2406.867) (-2405.697) [-2404.978] (-2406.191) -- 0:00:13 961500 -- [-2403.776] (-2401.805) (-2399.058) (-2402.124) * [-2403.824] (-2399.825) (-2414.961) (-2406.185) -- 0:00:13 962000 -- (-2401.589) (-2411.864) (-2401.477) [-2401.787] * (-2409.030) (-2399.951) [-2404.159] (-2401.456) -- 0:00:13 962500 -- (-2400.672) [-2407.193] (-2403.642) (-2404.075) * (-2399.073) (-2403.304) (-2405.428) [-2407.919] -- 0:00:13 963000 -- (-2408.659) (-2407.652) [-2405.826] (-2401.927) * (-2407.061) (-2406.191) (-2405.530) [-2402.027] -- 0:00:12 963500 -- (-2401.164) (-2400.524) (-2397.508) [-2400.339] * [-2401.842] (-2403.223) (-2413.797) (-2399.950) -- 0:00:12 964000 -- (-2405.419) (-2403.524) [-2398.215] (-2411.974) * [-2402.032] (-2401.287) (-2400.711) (-2411.519) -- 0:00:12 964500 -- (-2400.082) (-2401.915) (-2406.367) [-2406.701] * [-2401.094] (-2409.061) (-2411.830) (-2405.787) -- 0:00:12 965000 -- (-2409.270) [-2402.930] (-2410.280) (-2403.963) * [-2396.402] (-2407.025) (-2401.997) (-2404.670) -- 0:00:12 Average standard deviation of split frequencies: 0.005758 965500 -- (-2411.081) (-2405.903) (-2398.406) [-2400.849] * (-2404.708) (-2409.648) [-2404.960] (-2413.973) -- 0:00:12 966000 -- (-2404.284) (-2402.517) [-2400.313] (-2399.724) * (-2404.384) (-2405.311) (-2408.926) [-2404.066] -- 0:00:11 966500 -- (-2411.706) [-2401.563] (-2402.581) (-2401.392) * [-2407.902] (-2402.451) (-2403.528) (-2396.498) -- 0:00:11 967000 -- [-2410.069] (-2410.803) (-2401.962) (-2410.864) * [-2410.412] (-2405.095) (-2408.851) (-2409.190) -- 0:00:11 967500 -- (-2407.865) [-2400.957] (-2405.068) (-2407.821) * [-2405.605] (-2402.837) (-2406.552) (-2408.751) -- 0:00:11 968000 -- (-2410.601) [-2400.993] (-2402.442) (-2399.459) * (-2405.817) [-2404.315] (-2404.063) (-2398.442) -- 0:00:11 968500 -- (-2403.233) (-2401.379) (-2406.087) [-2401.768] * (-2405.400) (-2404.969) [-2399.524] (-2408.308) -- 0:00:11 969000 -- (-2403.928) (-2400.353) [-2402.778] (-2401.826) * (-2404.256) (-2406.742) [-2402.807] (-2399.941) -- 0:00:10 969500 -- [-2399.953] (-2405.035) (-2403.177) (-2407.949) * (-2405.356) [-2401.596] (-2403.007) (-2402.810) -- 0:00:10 970000 -- (-2408.658) (-2405.853) [-2402.077] (-2413.184) * (-2402.584) [-2400.366] (-2413.305) (-2405.222) -- 0:00:10 Average standard deviation of split frequencies: 0.005148 970500 -- (-2406.982) (-2413.707) [-2398.656] (-2412.992) * (-2398.943) (-2401.049) (-2402.193) [-2397.646] -- 0:00:10 971000 -- [-2405.850] (-2397.697) (-2404.637) (-2405.776) * (-2409.539) (-2407.292) [-2399.342] (-2408.400) -- 0:00:10 971500 -- (-2403.186) [-2403.688] (-2412.185) (-2399.356) * (-2409.667) (-2404.196) (-2400.845) [-2401.771] -- 0:00:09 972000 -- (-2408.777) (-2401.806) [-2402.642] (-2409.369) * (-2409.393) [-2403.974] (-2402.760) (-2402.436) -- 0:00:09 972500 -- (-2408.356) (-2401.656) [-2398.517] (-2404.716) * (-2402.853) (-2397.710) [-2410.861] (-2401.609) -- 0:00:09 973000 -- [-2397.550] (-2400.707) (-2405.519) (-2404.335) * (-2404.144) (-2401.792) [-2409.144] (-2407.107) -- 0:00:09 973500 -- (-2409.142) [-2405.243] (-2400.374) (-2402.592) * [-2406.351] (-2404.901) (-2409.111) (-2404.902) -- 0:00:09 974000 -- (-2406.193) (-2403.642) (-2407.947) [-2403.960] * (-2402.727) (-2398.943) [-2407.400] (-2407.526) -- 0:00:09 974500 -- (-2405.642) [-2406.437] (-2403.553) (-2406.929) * (-2405.683) (-2402.545) (-2401.313) [-2402.870] -- 0:00:08 975000 -- (-2399.425) (-2414.063) [-2402.758] (-2400.683) * (-2408.114) (-2401.311) [-2404.165] (-2400.990) -- 0:00:08 Average standard deviation of split frequencies: 0.005410 975500 -- (-2405.502) [-2395.803] (-2414.534) (-2403.082) * [-2402.844] (-2405.762) (-2404.091) (-2401.670) -- 0:00:08 976000 -- [-2399.787] (-2406.187) (-2400.856) (-2406.651) * [-2405.749] (-2409.395) (-2404.655) (-2403.835) -- 0:00:08 976500 -- (-2402.859) [-2399.137] (-2399.393) (-2409.245) * (-2397.875) (-2409.029) (-2412.616) [-2406.843] -- 0:00:08 977000 -- (-2404.931) (-2400.602) [-2409.242] (-2411.076) * (-2399.444) (-2417.762) [-2413.092] (-2409.687) -- 0:00:08 977500 -- (-2405.741) (-2409.719) [-2402.388] (-2412.122) * [-2410.452] (-2411.521) (-2414.785) (-2410.305) -- 0:00:07 978000 -- (-2408.198) (-2407.912) (-2402.076) [-2403.532] * (-2403.639) (-2419.771) (-2409.008) [-2399.957] -- 0:00:07 978500 -- (-2399.207) (-2405.815) [-2401.130] (-2399.518) * [-2407.437] (-2415.221) (-2410.866) (-2408.394) -- 0:00:07 979000 -- (-2398.517) (-2402.996) (-2406.146) [-2393.250] * (-2410.208) (-2403.969) (-2406.273) [-2397.797] -- 0:00:07 979500 -- (-2403.338) (-2404.383) [-2401.553] (-2406.899) * (-2417.315) (-2405.218) (-2406.485) [-2400.509] -- 0:00:07 980000 -- (-2407.431) (-2411.381) (-2408.264) [-2397.185] * (-2409.760) (-2403.796) [-2408.089] (-2407.444) -- 0:00:07 Average standard deviation of split frequencies: 0.005768 980500 -- (-2403.704) (-2408.533) (-2404.970) [-2398.614] * (-2404.594) (-2398.851) (-2407.245) [-2400.112] -- 0:00:06 981000 -- (-2406.455) (-2411.123) [-2396.647] (-2408.235) * (-2411.350) [-2403.216] (-2406.105) (-2399.950) -- 0:00:06 981500 -- (-2403.465) (-2407.304) (-2405.529) [-2398.339] * [-2402.398] (-2398.300) (-2409.587) (-2402.998) -- 0:00:06 982000 -- (-2408.091) (-2409.150) (-2410.286) [-2405.097] * (-2406.777) (-2401.097) (-2405.969) [-2400.581] -- 0:00:06 982500 -- (-2403.779) (-2405.941) (-2401.855) [-2403.240] * (-2404.862) [-2398.048] (-2400.953) (-2405.084) -- 0:00:06 983000 -- [-2403.354] (-2417.743) (-2404.028) (-2402.725) * (-2405.479) (-2398.860) [-2400.902] (-2402.659) -- 0:00:05 983500 -- (-2407.098) (-2412.698) (-2397.588) [-2405.235] * [-2398.509] (-2399.700) (-2399.651) (-2405.061) -- 0:00:05 984000 -- (-2405.180) [-2405.279] (-2399.517) (-2402.929) * (-2410.480) [-2400.856] (-2401.301) (-2404.073) -- 0:00:05 984500 -- [-2399.655] (-2411.934) (-2403.472) (-2398.696) * [-2401.367] (-2406.809) (-2404.016) (-2410.254) -- 0:00:05 985000 -- (-2399.228) [-2407.339] (-2401.494) (-2404.071) * (-2397.943) [-2406.161] (-2408.267) (-2410.310) -- 0:00:05 Average standard deviation of split frequencies: 0.005355 985500 -- (-2403.654) (-2409.129) (-2402.826) [-2401.679] * [-2402.321] (-2406.193) (-2407.921) (-2409.905) -- 0:00:05 986000 -- (-2402.311) [-2401.913] (-2401.637) (-2406.195) * (-2406.175) [-2403.226] (-2410.119) (-2409.185) -- 0:00:04 986500 -- (-2402.803) (-2404.357) (-2405.112) [-2406.952] * (-2404.337) (-2401.921) (-2407.924) [-2397.507] -- 0:00:04 987000 -- (-2407.209) (-2405.333) (-2411.719) [-2400.872] * (-2407.728) (-2404.407) (-2405.894) [-2398.860] -- 0:00:04 987500 -- (-2403.696) (-2412.707) (-2400.012) [-2398.346] * (-2405.070) [-2398.940] (-2400.235) (-2400.913) -- 0:00:04 988000 -- (-2407.599) [-2399.937] (-2395.957) (-2405.082) * [-2400.431] (-2400.824) (-2401.417) (-2403.994) -- 0:00:04 988500 -- (-2410.950) [-2399.178] (-2406.330) (-2403.297) * [-2403.287] (-2413.220) (-2406.517) (-2405.825) -- 0:00:04 989000 -- (-2407.017) [-2402.496] (-2401.545) (-2402.939) * (-2412.907) (-2413.903) (-2411.867) [-2406.247] -- 0:00:03 989500 -- (-2408.264) (-2402.689) (-2408.364) [-2407.540] * (-2417.053) (-2414.688) (-2403.562) [-2399.092] -- 0:00:03 990000 -- [-2402.113] (-2409.363) (-2403.849) (-2410.883) * (-2412.059) (-2401.585) [-2404.600] (-2406.718) -- 0:00:03 Average standard deviation of split frequencies: 0.005710 990500 -- (-2406.606) (-2406.539) [-2404.547] (-2405.386) * (-2412.213) (-2404.181) [-2398.736] (-2404.275) -- 0:00:03 991000 -- (-2399.773) (-2404.489) [-2402.396] (-2400.702) * [-2409.824] (-2413.300) (-2405.599) (-2400.010) -- 0:00:03 991500 -- (-2400.331) (-2405.242) (-2406.517) [-2404.988] * (-2406.781) [-2402.607] (-2408.903) (-2407.610) -- 0:00:02 992000 -- (-2403.365) (-2401.481) [-2406.256] (-2402.358) * (-2398.638) (-2405.989) (-2418.338) [-2409.728] -- 0:00:02 992500 -- (-2402.946) (-2406.040) [-2403.812] (-2396.459) * (-2404.777) (-2399.133) [-2400.383] (-2401.038) -- 0:00:02 993000 -- (-2413.454) (-2402.059) (-2412.387) [-2399.390] * [-2404.286] (-2402.239) (-2402.117) (-2397.609) -- 0:00:02 993500 -- (-2404.647) [-2404.807] (-2407.594) (-2398.459) * (-2413.079) [-2401.814] (-2404.882) (-2399.772) -- 0:00:02 994000 -- [-2406.748] (-2405.805) (-2405.014) (-2396.127) * (-2410.372) (-2397.625) [-2400.286] (-2400.616) -- 0:00:02 994500 -- (-2415.705) (-2405.541) (-2402.546) [-2398.258] * (-2394.817) (-2402.512) (-2402.959) [-2405.755] -- 0:00:01 995000 -- (-2397.426) (-2403.470) (-2407.572) [-2397.927] * (-2403.778) (-2405.639) [-2408.626] (-2409.024) -- 0:00:01 Average standard deviation of split frequencies: 0.005680 995500 -- (-2400.782) (-2406.888) [-2404.759] (-2399.578) * (-2402.294) (-2406.173) (-2403.784) [-2402.514] -- 0:00:01 996000 -- (-2409.585) [-2409.144] (-2395.667) (-2398.159) * (-2404.260) (-2404.689) [-2401.512] (-2412.845) -- 0:00:01 996500 -- (-2399.035) [-2403.355] (-2403.437) (-2404.441) * (-2405.028) (-2407.251) (-2400.988) [-2405.648] -- 0:00:01 997000 -- (-2401.075) [-2405.448] (-2400.177) (-2406.018) * (-2401.861) (-2403.587) [-2402.591] (-2404.077) -- 0:00:01 997500 -- (-2403.254) (-2406.469) (-2401.645) [-2398.830] * (-2402.479) (-2407.309) (-2399.155) [-2398.893] -- 0:00:00 998000 -- (-2413.035) (-2403.520) [-2400.388] (-2405.600) * [-2401.502] (-2407.059) (-2411.756) (-2406.792) -- 0:00:00 998500 -- (-2404.995) (-2407.200) (-2402.354) [-2411.668] * (-2408.779) (-2402.925) [-2407.932] (-2403.173) -- 0:00:00 999000 -- [-2403.174] (-2401.830) (-2402.867) (-2399.904) * [-2404.432] (-2401.057) (-2408.698) (-2403.676) -- 0:00:00 999500 -- (-2398.808) (-2403.255) (-2402.110) [-2400.848] * (-2403.455) (-2401.728) (-2405.512) [-2402.584] -- 0:00:00 1000000 -- (-2409.658) (-2404.103) (-2407.397) [-2408.224] * (-2408.952) (-2398.248) (-2402.522) [-2402.742] -- 0:00:00 Average standard deviation of split frequencies: 0.006689 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2409.658148 -- 10.750959 Chain 1 -- -2409.658146 -- 10.750959 Chain 2 -- -2404.102814 -- 13.473504 Chain 2 -- -2404.102810 -- 13.473504 Chain 3 -- -2407.396647 -- 12.990854 Chain 3 -- -2407.396659 -- 12.990854 Chain 4 -- -2408.224155 -- 13.156925 Chain 4 -- -2408.224144 -- 13.156925 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2408.952371 -- 12.639916 Chain 1 -- -2408.952371 -- 12.639916 Chain 2 -- -2398.247984 -- 9.310641 Chain 2 -- -2398.247996 -- 9.310641 Chain 3 -- -2402.521656 -- 13.010106 Chain 3 -- -2402.521657 -- 13.010106 Chain 4 -- -2402.741607 -- 11.920392 Chain 4 -- -2402.741606 -- 11.920392 Analysis completed in 5 mins 50 seconds Analysis used 349.59 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2392.45 Likelihood of best state for "cold" chain of run 2 was -2392.45 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 43.0 % ( 31 %) Dirichlet(Revmat{all}) 59.2 % ( 37 %) Slider(Revmat{all}) 25.7 % ( 27 %) Dirichlet(Pi{all}) 27.3 % ( 31 %) Slider(Pi{all}) 42.9 % ( 23 %) Multiplier(Alpha{1,2}) 42.0 % ( 33 %) Multiplier(Alpha{3}) 55.4 % ( 34 %) Slider(Pinvar{all}) 3.3 % ( 2 %) ExtSPR(Tau{all},V{all}) 0.1 % ( 0 %) ExtTBR(Tau{all},V{all}) 4.4 % ( 5 %) NNI(Tau{all},V{all}) 8.3 % ( 10 %) ParsSPR(Tau{all},V{all}) 26.3 % ( 35 %) Multiplier(V{all}) 30.7 % ( 33 %) Nodeslider(V{all}) 25.1 % ( 33 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 43.4 % ( 36 %) Dirichlet(Revmat{all}) 58.3 % ( 39 %) Slider(Revmat{all}) 25.1 % ( 29 %) Dirichlet(Pi{all}) 27.5 % ( 25 %) Slider(Pi{all}) 42.0 % ( 28 %) Multiplier(Alpha{1,2}) 42.6 % ( 22 %) Multiplier(Alpha{3}) 55.3 % ( 41 %) Slider(Pinvar{all}) 3.3 % ( 7 %) ExtSPR(Tau{all},V{all}) 0.1 % ( 0 %) ExtTBR(Tau{all},V{all}) 4.3 % ( 2 %) NNI(Tau{all},V{all}) 8.2 % ( 6 %) ParsSPR(Tau{all},V{all}) 26.1 % ( 32 %) Multiplier(V{all}) 30.4 % ( 32 %) Nodeslider(V{all}) 25.5 % ( 22 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.82 0.66 0.53 2 | 165796 0.83 0.69 3 | 167253 166609 0.85 4 | 166854 166876 166612 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.82 0.66 0.53 2 | 165800 0.84 0.69 3 | 166385 166924 0.85 4 | 166811 166922 167158 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2400.87 | 1 | | 1 | | * 1 | | 1 2 2 | | 2 2 1 1 | | 1 1 1 2 1 2 2 1 1 21 1 | |1 * 2 2 2 2 22 1 2 * 2 2 1 2 2 2121 | | 1 2 112 1 2 1 2 2* 1 2 | | 2 11 1 1 1 1 1 1121 2 21 2 1 | | 2 2 12 1 1 1 12 2 *| |2 2 1 2 2 2 2 21 1 * 1 2 | | 12 2 22 2 1 | | 1 2 1 1 2 | | * 1 1 | | 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2404.82 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2398.61 -2409.66 2 -2398.87 -2411.80 -------------------------------------- TOTAL -2398.73 -2411.22 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.820105 0.008222 0.651108 1.000156 0.812905 1067.72 1096.52 1.000 r(A<->C){all} 0.079087 0.000409 0.041854 0.120711 0.077942 920.17 989.87 1.000 r(A<->G){all} 0.196543 0.001057 0.134646 0.260142 0.195006 957.57 978.50 1.000 r(A<->T){all} 0.110014 0.000917 0.054042 0.169338 0.107765 988.70 1009.44 1.000 r(C<->G){all} 0.062425 0.000265 0.032195 0.095200 0.061588 1043.50 1109.52 1.000 r(C<->T){all} 0.494200 0.002429 0.399754 0.591764 0.493357 736.15 768.44 1.001 r(G<->T){all} 0.057731 0.000344 0.024252 0.094673 0.056321 1072.94 1103.32 1.000 pi(A){all} 0.259035 0.000210 0.230489 0.287533 0.258521 1089.84 1133.28 1.000 pi(C){all} 0.263281 0.000201 0.235066 0.289907 0.263120 1126.05 1163.10 1.000 pi(G){all} 0.269155 0.000207 0.240979 0.297106 0.268850 1156.56 1163.62 1.000 pi(T){all} 0.208530 0.000184 0.182554 0.234673 0.208347 1021.33 1107.82 1.000 alpha{1,2} 0.081995 0.001152 0.000923 0.129880 0.087793 1057.72 1164.39 1.001 alpha{3} 3.078765 0.938903 1.353621 4.886878 2.957174 1259.75 1380.38 1.000 pinvar{all} 0.201510 0.005327 0.064091 0.350348 0.203520 1282.21 1297.91 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 Key to taxon bipartitions (saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------- 1 -- .****** 2 -- .*..... 3 -- ..*.... 4 -- ...*... 5 -- ....*.. 6 -- .....*. 7 -- ......* 8 -- .....** 9 -- ....*** 10 -- .**.... 11 -- ...**** 12 -- .**.*** ------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 8 3002 1.000000 0.000000 1.000000 1.000000 2 9 3002 1.000000 0.000000 1.000000 1.000000 2 10 2998 0.998668 0.000942 0.998001 0.999334 2 11 1547 0.515323 0.016488 0.503664 0.526982 2 12 1450 0.483011 0.016017 0.471686 0.494337 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.037223 0.000123 0.017131 0.059603 0.036202 1.000 2 length{all}[2] 0.009896 0.000022 0.001466 0.018625 0.009157 1.000 2 length{all}[3] 0.011383 0.000024 0.003020 0.021338 0.010634 1.000 2 length{all}[4] 0.101225 0.000550 0.058311 0.148505 0.099730 1.000 2 length{all}[5] 0.183640 0.001406 0.115521 0.258941 0.180678 1.000 2 length{all}[6] 0.160803 0.000991 0.101592 0.220929 0.158274 1.000 2 length{all}[7] 0.077809 0.000463 0.036748 0.120151 0.075535 1.000 2 length{all}[8] 0.073899 0.000649 0.029402 0.125672 0.071321 1.000 2 length{all}[9] 0.114945 0.000824 0.064605 0.175930 0.112756 1.000 2 length{all}[10] 0.026259 0.000121 0.005681 0.047045 0.025223 1.000 2 length{all}[11] 0.027696 0.000148 0.006469 0.052934 0.026451 1.000 2 length{all}[12] 0.018166 0.000078 0.002840 0.035430 0.017003 1.001 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.006689 Maximum standard deviation of split frequencies = 0.016488 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------ C2 (2) |-------------------------100-------------------------+ + \------------------ C3 (3) | | /------------------------------------------------------ C4 (4) | | \--------52-------+ /------------------------------------ C5 (5) | | \-------100-------+ /------------------ C6 (6) \-------100-------+ \------------------ C7 (7) Phylogram (based on average branch lengths): /------- C1 (1) | | /-- C2 (2) |----+ + \-- C3 (3) | | /-------------------- C4 (4) | | \----+ /----------------------------------- C5 (5) | | \---------------------+ /------------------------------- C6 (6) \-------------+ \--------------- C7 (7) |--------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (5 trees sampled): 90 % credible set contains 2 trees 95 % credible set contains 2 trees 99 % credible set contains 2 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 7 ls = 783 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Sequences read.. Counting site patterns.. 0:00 194 patterns at 261 / 261 sites (100.0%), 0:00 Counting codons.. 168 bytes for distance 189344 bytes for conP 26384 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 473360 bytes for conP, adjusted 0.081374 0.040905 0.007442 0.027956 0.042065 0.148320 0.137374 0.291601 0.116091 0.253564 0.127162 0.300000 1.300000 ntime & nrate & np: 11 2 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 13 lnL0 = -2674.261875 Iterating by ming2 Initial: fx= 2674.261875 x= 0.08137 0.04090 0.00744 0.02796 0.04206 0.14832 0.13737 0.29160 0.11609 0.25356 0.12716 0.30000 1.30000 1 h-m-p 0.0000 0.0006 443.3641 +++ 2634.109103 m 0.0006 19 | 0/13 2 h-m-p 0.0000 0.0000 18182.1481 YCCC 2612.767369 3 0.0000 40 | 0/13 3 h-m-p 0.0004 0.0018 506.3850 +YCYCCC 2499.534216 5 0.0017 65 | 0/13 4 h-m-p 0.0000 0.0001 1900.4452 +YYCYCYC 2478.470505 6 0.0001 90 | 0/13 5 h-m-p 0.0002 0.0010 376.8843 ++ 2427.046235 m 0.0010 106 | 0/13 6 h-m-p 0.0000 0.0000 24843.2474 h-m-p: 5.32508587e-21 2.66254294e-20 2.48432474e+04 2427.046235 .. | 0/13 7 h-m-p 0.0000 0.0014 5928.8789 YYYCCCCC 2406.045817 7 0.0000 146 | 0/13 8 h-m-p 0.0001 0.0014 364.9287 +YCYYYYYCCC 2338.855092 10 0.0010 176 | 0/13 9 h-m-p 0.0001 0.0003 435.8975 CYCCCC 2331.322373 5 0.0001 201 | 0/13 10 h-m-p 0.0001 0.0006 252.7182 +YCYCCC 2322.939531 5 0.0003 226 | 0/13 11 h-m-p 0.0021 0.0105 29.3674 YCC 2322.330901 2 0.0014 245 | 0/13 12 h-m-p 0.0017 0.0564 23.4912 CCCC 2321.792104 3 0.0026 267 | 0/13 13 h-m-p 0.0011 0.0240 55.7657 +CCCC 2319.339658 3 0.0052 290 | 0/13 14 h-m-p 0.0015 0.0091 198.1753 YYCCC 2316.162817 4 0.0022 312 | 0/13 15 h-m-p 0.0009 0.0046 207.5387 CCCCC 2313.351342 4 0.0016 336 | 0/13 16 h-m-p 0.0024 0.0120 32.4210 YCC 2313.141821 2 0.0009 355 | 0/13 17 h-m-p 0.0022 0.0108 11.9298 YCC 2313.029162 2 0.0014 374 | 0/13 18 h-m-p 0.0076 0.1802 2.2277 +CCC 2311.757004 2 0.0261 395 | 0/13 19 h-m-p 0.0014 0.0069 9.5564 +YYYYYC 2304.096805 5 0.0054 417 | 0/13 20 h-m-p 0.0003 0.0015 70.2988 YCCCCC 2302.223664 5 0.0006 442 | 0/13 21 h-m-p 0.0591 0.9927 0.7398 +YCYCCC 2298.446483 5 0.5438 467 | 0/13 22 h-m-p 0.3502 2.0437 1.1488 YCYC 2297.076637 3 0.2360 500 | 0/13 23 h-m-p 0.6677 3.3385 0.1400 YYC 2296.902208 2 0.6019 518 | 0/13 24 h-m-p 1.6000 8.0000 0.0520 CCC 2296.844048 2 0.5037 551 | 0/13 25 h-m-p 0.9575 8.0000 0.0273 C 2296.818996 0 0.9575 580 | 0/13 26 h-m-p 1.6000 8.0000 0.0079 YC 2296.799999 1 3.9299 610 | 0/13 27 h-m-p 1.6000 8.0000 0.0058 +YC 2296.729651 1 4.5445 641 | 0/13 28 h-m-p 1.6000 8.0000 0.0047 YC 2296.715481 1 1.2441 671 | 0/13 29 h-m-p 1.6000 8.0000 0.0010 YC 2296.714462 1 0.9936 701 | 0/13 30 h-m-p 1.6000 8.0000 0.0005 Y 2296.714421 0 1.0528 730 | 0/13 31 h-m-p 1.6000 8.0000 0.0001 Y 2296.714420 0 0.9288 759 | 0/13 32 h-m-p 1.6000 8.0000 0.0000 Y 2296.714420 0 1.2051 788 | 0/13 33 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/13 34 h-m-p 0.0160 8.0000 0.0019 ------------C 2296.714420 0 0.0000 872 | 0/13 35 h-m-p 0.0004 0.1812 0.1230 ----------.. | 0/13 36 h-m-p 0.0160 8.0000 0.0019 ------------- | 0/13 37 h-m-p 0.0160 8.0000 0.0019 ------------- Out.. lnL = -2296.714420 990 lfun, 990 eigenQcodon, 10890 P(t) Time used: 0:05 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 0.081374 0.040905 0.007442 0.027956 0.042065 0.148320 0.137374 0.291601 0.116091 0.253564 0.127162 1.974197 0.534390 0.193110 ntime & nrate & np: 11 2 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 7.100693 np = 14 lnL0 = -2375.073962 Iterating by ming2 Initial: fx= 2375.073962 x= 0.08137 0.04090 0.00744 0.02796 0.04206 0.14832 0.13737 0.29160 0.11609 0.25356 0.12716 1.97420 0.53439 0.19311 1 h-m-p 0.0000 0.0009 423.4873 ++++ 2322.480491 m 0.0009 35 | 1/14 2 h-m-p 0.0004 0.0021 157.1123 CCCCC 2316.850528 4 0.0005 74 | 0/14 3 h-m-p 0.0000 0.0000 13323.6273 YCCCCC 2310.181257 5 0.0000 113 | 0/14 4 h-m-p 0.0001 0.0004 78.5000 YCYCC 2309.637241 4 0.0002 150 | 0/14 5 h-m-p 0.0007 0.0090 20.5964 YCCC 2309.302310 3 0.0016 186 | 0/14 6 h-m-p 0.0018 0.0106 17.7089 CCC 2309.227241 2 0.0006 221 | 0/14 7 h-m-p 0.0011 0.0365 10.0444 +YCC 2309.057283 2 0.0033 256 | 0/14 8 h-m-p 0.0019 0.0723 17.0749 +CYC 2308.274030 2 0.0086 291 | 0/14 9 h-m-p 0.0025 0.0330 58.6281 +CYC 2305.307425 2 0.0096 326 | 0/14 10 h-m-p 0.0026 0.0128 130.3523 CYCCC 2302.154415 4 0.0040 364 | 0/14 11 h-m-p 0.0079 0.0394 15.7030 YCCC 2301.732848 3 0.0040 400 | 0/14 12 h-m-p 0.0099 0.0493 3.6924 CYCCC 2300.539192 4 0.0147 438 | 0/14 13 h-m-p 0.0037 0.0186 11.4386 +YCYYYCC 2278.320389 6 0.0165 478 | 0/14 14 h-m-p 0.0003 0.0013 50.3827 YCYCCC 2277.110727 5 0.0006 517 | 0/14 15 h-m-p 0.0072 0.0383 4.5312 YCC 2277.026747 2 0.0030 551 | 0/14 16 h-m-p 0.0035 0.3796 3.8411 ++YCCC 2271.922725 3 0.1014 589 | 0/14 17 h-m-p 0.2200 1.6991 1.7703 YCCCC 2267.215016 4 0.4881 627 | 0/14 18 h-m-p 1.4214 7.1070 0.1791 YCCC 2266.710330 3 0.6082 663 | 0/14 19 h-m-p 0.9351 4.6756 0.0402 CCCC 2266.142036 3 1.0227 700 | 0/14 20 h-m-p 1.1137 8.0000 0.0369 CCC 2265.746854 2 1.4423 735 | 0/14 21 h-m-p 1.6000 8.0000 0.0223 YCCC 2265.504330 3 0.9046 771 | 0/14 22 h-m-p 1.5548 8.0000 0.0130 YCC 2265.359926 2 0.8826 805 | 0/14 23 h-m-p 0.8982 8.0000 0.0128 CC 2265.341637 1 0.9819 838 | 0/14 24 h-m-p 1.1967 8.0000 0.0105 YC 2265.340232 1 0.7514 870 | 0/14 25 h-m-p 1.6000 8.0000 0.0020 Y 2265.340116 0 0.7111 901 | 0/14 26 h-m-p 1.6000 8.0000 0.0006 Y 2265.340106 0 0.8475 932 | 0/14 27 h-m-p 1.6000 8.0000 0.0002 Y 2265.340105 0 0.7487 963 | 0/14 28 h-m-p 1.6000 8.0000 0.0000 Y 2265.340105 0 1.0045 994 | 0/14 29 h-m-p 1.6000 8.0000 0.0000 Y 2265.340105 0 0.8529 1025 | 0/14 30 h-m-p 1.6000 8.0000 0.0000 Y 2265.340105 0 1.2151 1056 | 0/14 31 h-m-p 1.6000 8.0000 0.0000 C 2265.340105 0 1.6000 1087 | 0/14 32 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/14 33 h-m-p 0.0160 8.0000 0.0003 ------------- Out.. lnL = -2265.340105 1175 lfun, 3525 eigenQcodon, 25850 P(t) Time used: 0:17 Model 2: PositiveSelection TREE # 1 (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 initial w for M2:NSpselection reset. 0.081374 0.040905 0.007442 0.027956 0.042065 0.148320 0.137374 0.291601 0.116091 0.253564 0.127162 2.088670 1.131355 0.291249 0.418683 2.981222 ntime & nrate & np: 11 3 16 Bounds (np=16): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.536371 np = 16 lnL0 = -2435.553517 Iterating by ming2 Initial: fx= 2435.553517 x= 0.08137 0.04090 0.00744 0.02796 0.04206 0.14832 0.13737 0.29160 0.11609 0.25356 0.12716 2.08867 1.13136 0.29125 0.41868 2.98122 1 h-m-p 0.0000 0.0028 379.3670 ++YYCYC 2429.004595 4 0.0002 44 | 0/16 2 h-m-p 0.0003 0.0017 278.5451 ++ 2330.933963 m 0.0017 79 | 1/16 3 h-m-p 0.0004 0.0020 443.2957 CYCCC 2325.422084 4 0.0003 121 | 1/16 4 h-m-p 0.0005 0.0026 145.8208 +YYCCC 2316.552387 4 0.0016 162 | 0/16 5 h-m-p 0.0000 0.0000 5275.7638 YCCCC 2313.747377 4 0.0000 203 | 0/16 6 h-m-p 0.0017 0.0149 39.6481 +CCCCC 2308.347873 4 0.0074 247 | 0/16 7 h-m-p 0.0005 0.0027 128.9681 YCC 2306.772792 2 0.0009 285 | 0/16 8 h-m-p 0.0034 0.0221 33.1954 YCCC 2304.529716 3 0.0063 325 | 0/16 9 h-m-p 0.0181 0.1081 11.5954 YCCCC 2301.019861 4 0.0318 367 | 0/16 10 h-m-p 0.0018 0.0090 73.7232 +YYCCCC 2295.993195 5 0.0060 411 | 0/16 11 h-m-p 0.0021 0.0107 43.8323 YCCCC 2294.478057 4 0.0042 453 | 0/16 12 h-m-p 0.0081 0.0408 22.5396 YYC 2293.731353 2 0.0057 490 | 0/16 13 h-m-p 0.0074 0.0688 17.3769 +YCCC 2291.919672 3 0.0196 531 | 0/16 14 h-m-p 0.0115 0.0574 26.3914 YYC 2290.731046 2 0.0095 568 | 0/16 15 h-m-p 0.0186 0.0930 11.6482 YCCC 2290.282261 3 0.0100 608 | 0/16 16 h-m-p 0.0094 0.4059 12.4539 ++CCCCC 2282.334597 4 0.1581 653 | 0/16 17 h-m-p 0.0869 0.4344 2.8070 +YYCCCC 2275.850396 5 0.2731 697 | 0/16 18 h-m-p 0.0992 0.4959 4.1828 CCCCC 2272.650929 4 0.1315 740 | 0/16 19 h-m-p 0.2256 1.3392 2.4372 CCC 2270.531355 2 0.1989 779 | 0/16 20 h-m-p 1.2855 7.3046 0.3770 YCCC 2269.323689 3 0.7561 819 | 0/16 21 h-m-p 0.2952 3.5274 0.9657 YCCC 2268.630562 3 0.5318 859 | 0/16 22 h-m-p 0.3241 2.2877 1.5844 YCCC 2267.550037 3 0.7277 899 | 0/16 23 h-m-p 0.8291 5.5569 1.3906 CYC 2266.865482 2 0.7583 937 | 0/16 24 h-m-p 0.7544 8.0000 1.3978 CC 2266.349261 1 0.7514 974 | 0/16 25 h-m-p 0.7848 5.2445 1.3383 CCCC 2265.876071 3 0.9731 1015 | 0/16 26 h-m-p 0.9051 4.5253 1.2396 YC 2265.685095 1 0.5314 1051 | 0/16 27 h-m-p 0.9859 8.0000 0.6682 CYC 2265.615089 2 0.9136 1089 | 0/16 28 h-m-p 0.7811 8.0000 0.7815 CCC 2265.541569 2 1.1046 1128 | 0/16 29 h-m-p 0.7307 8.0000 1.1813 CCC 2265.478456 2 0.8614 1167 | 0/16 30 h-m-p 0.9684 8.0000 1.0508 C 2265.430984 0 0.9684 1202 | 0/16 31 h-m-p 0.7432 8.0000 1.3693 CCC 2265.400739 2 0.6054 1241 | 0/16 32 h-m-p 0.8994 8.0000 0.9217 CYC 2265.380712 2 1.0219 1279 | 0/16 33 h-m-p 1.1849 8.0000 0.7949 YCC 2265.363289 2 2.0351 1317 | 0/16 34 h-m-p 1.6000 8.0000 0.9756 CCC 2265.349303 2 2.1172 1356 | 0/16 35 h-m-p 1.6000 8.0000 0.8622 C 2265.344770 0 1.6000 1391 | 0/16 36 h-m-p 1.4790 8.0000 0.9328 C 2265.342834 0 1.4790 1426 | 0/16 37 h-m-p 1.5045 8.0000 0.9170 C 2265.341881 0 1.4052 1461 | 0/16 38 h-m-p 1.3606 8.0000 0.9471 C 2265.341102 0 1.6557 1496 | 0/16 39 h-m-p 1.4952 8.0000 1.0488 C 2265.340557 0 1.4952 1531 | 0/16 40 h-m-p 1.6000 8.0000 0.9241 C 2265.340321 0 1.7816 1566 | 0/16 41 h-m-p 1.6000 8.0000 0.7482 C 2265.340224 0 2.2334 1601 | 0/16 42 h-m-p 1.6000 8.0000 0.8895 C 2265.340159 0 2.0722 1636 | 0/16 43 h-m-p 1.6000 8.0000 0.9379 C 2265.340129 0 1.8667 1671 | 0/16 44 h-m-p 1.6000 8.0000 0.8203 Y 2265.340115 0 2.8317 1706 | 0/16 45 h-m-p 1.6000 8.0000 0.8585 C 2265.340109 0 2.2727 1741 | 0/16 46 h-m-p 1.6000 8.0000 0.8451 Y 2265.340107 0 2.8870 1776 | 0/16 47 h-m-p 1.6000 8.0000 0.9101 C 2265.340106 0 2.3782 1811 | 0/16 48 h-m-p 1.6000 8.0000 0.9495 Y 2265.340105 0 2.8613 1846 | 0/16 49 h-m-p 1.6000 8.0000 1.6244 Y 2265.340105 0 3.3008 1881 | 0/16 50 h-m-p 1.6000 8.0000 2.9003 C 2265.340105 0 2.4864 1916 | 0/16 51 h-m-p 0.1288 3.1378 55.9674 -C 2265.340105 0 0.0081 1952 | 0/16 52 h-m-p 0.1498 8.0000 3.0078 ++Y 2265.340105 0 1.6011 1989 | 0/16 53 h-m-p 0.2772 8.0000 17.3703 Y 2265.340105 0 0.4571 2024 | 0/16 54 h-m-p 0.1388 1.2640 57.2192 ---------------.. | 0/16 55 h-m-p 0.0160 8.0000 0.0011 ------------- Out.. lnL = -2265.340105 2119 lfun, 8476 eigenQcodon, 69927 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2278.612698 S = -2180.439074 -89.013483 Calculating f(w|X), posterior probabilities of site classes. did 10 / 194 patterns 0:48 did 20 / 194 patterns 0:48 did 30 / 194 patterns 0:48 did 40 / 194 patterns 0:48 did 50 / 194 patterns 0:48 did 60 / 194 patterns 0:48 did 70 / 194 patterns 0:48 did 80 / 194 patterns 0:48 did 90 / 194 patterns 0:48 did 100 / 194 patterns 0:48 did 110 / 194 patterns 0:48 did 120 / 194 patterns 0:48 did 130 / 194 patterns 0:48 did 140 / 194 patterns 0:49 did 150 / 194 patterns 0:49 did 160 / 194 patterns 0:49 did 170 / 194 patterns 0:49 did 180 / 194 patterns 0:49 did 190 / 194 patterns 0:49 did 194 / 194 patterns 0:49 Time used: 0:49 Model 3: discrete TREE # 1 (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 0.081374 0.040905 0.007442 0.027956 0.042065 0.148320 0.137374 0.291601 0.116091 0.253564 0.127162 2.088672 0.960589 0.897086 0.042885 0.110318 0.150237 ntime & nrate & np: 11 4 17 Bounds (np=17): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 14.911874 np = 17 lnL0 = -2293.084445 Iterating by ming2 Initial: fx= 2293.084445 x= 0.08137 0.04090 0.00744 0.02796 0.04206 0.14832 0.13737 0.29160 0.11609 0.25356 0.12716 2.08867 0.96059 0.89709 0.04289 0.11032 0.15024 1 h-m-p 0.0000 0.0003 296.6895 +++ 2288.495560 m 0.0003 40 | 1/17 2 h-m-p 0.0006 0.0028 87.8545 CCCC 2286.188357 3 0.0007 83 | 1/17 3 h-m-p 0.0001 0.0004 145.0972 YCYCCC 2285.388426 5 0.0002 127 | 1/17 4 h-m-p 0.0001 0.0025 164.0473 ++YCYCCC 2274.814405 5 0.0017 173 | 1/17 5 h-m-p 0.0001 0.0005 175.8338 YCCCC 2273.845803 4 0.0002 216 | 1/17 6 h-m-p 0.0006 0.0038 68.7609 CCCC 2272.996783 3 0.0008 258 | 1/17 7 h-m-p 0.0014 0.0102 36.7617 YCCC 2272.630207 3 0.0010 299 | 1/17 8 h-m-p 0.0013 0.0078 27.1959 YCC 2272.440174 2 0.0009 338 | 1/17 9 h-m-p 0.0035 0.0487 7.1302 YC 2272.391285 1 0.0017 375 | 1/17 10 h-m-p 0.0038 0.1574 3.2102 YC 2272.289250 1 0.0073 412 | 1/17 11 h-m-p 0.0017 0.1057 13.9664 +CCC 2271.626375 2 0.0093 453 | 1/17 12 h-m-p 0.0025 0.0217 53.0424 CCCC 2270.475197 3 0.0039 495 | 1/17 13 h-m-p 0.0039 0.0306 52.7242 YCCC 2270.014713 3 0.0017 536 | 1/17 14 h-m-p 0.0211 0.1056 3.9412 CCC 2269.909863 2 0.0061 576 | 0/17 15 h-m-p 0.0022 0.1359 10.7366 -CC 2269.897287 1 0.0002 615 | 0/17 16 h-m-p 0.0001 0.0481 15.9376 ++++YCCC 2267.968912 3 0.0264 661 | 0/17 17 h-m-p 0.1182 0.5908 1.6510 +YCYCCC 2265.039967 5 0.3367 707 | 0/17 18 h-m-p 0.0605 0.3027 1.9727 YCCCC 2264.101699 4 0.1289 751 | 0/17 19 h-m-p 0.1999 1.0787 1.2718 CCC 2263.536343 2 0.2855 792 | 0/17 20 h-m-p 0.6691 4.1645 0.5428 CC 2263.346202 1 0.2577 831 | 0/17 21 h-m-p 1.6000 8.0000 0.0312 YC 2263.322745 1 0.6881 869 | 0/17 22 h-m-p 1.3543 8.0000 0.0158 CC 2263.316209 1 1.8305 908 | 0/17 23 h-m-p 1.6000 8.0000 0.0169 CC 2263.312552 1 1.7895 947 | 0/17 24 h-m-p 1.6000 8.0000 0.0069 C 2263.312116 0 1.5122 984 | 0/17 25 h-m-p 1.6000 8.0000 0.0020 +C 2263.310981 0 6.2983 1022 | 0/17 26 h-m-p 1.6000 8.0000 0.0027 CC 2263.310237 1 2.0733 1061 | 0/17 27 h-m-p 1.6000 8.0000 0.0031 +CY 2263.308079 1 5.7613 1101 | 0/17 28 h-m-p 1.6000 8.0000 0.0024 C 2263.306792 0 1.5862 1138 | 0/17 29 h-m-p 0.6816 8.0000 0.0056 C 2263.306619 0 0.6816 1175 | 0/17 30 h-m-p 1.0716 8.0000 0.0036 C 2263.306546 0 1.0250 1212 | 0/17 31 h-m-p 1.6000 8.0000 0.0012 Y 2263.306532 0 1.0680 1249 | 0/17 32 h-m-p 1.6000 8.0000 0.0006 Y 2263.306530 0 0.9909 1286 | 0/17 33 h-m-p 1.6000 8.0000 0.0000 Y 2263.306530 0 0.9329 1323 | 0/17 34 h-m-p 1.6000 8.0000 0.0000 Y 2263.306530 0 1.6000 1360 | 0/17 35 h-m-p 1.6000 8.0000 0.0000 Y 2263.306530 0 1.6000 1397 | 0/17 36 h-m-p 1.6000 8.0000 0.0000 ----Y 2263.306530 0 0.0016 1438 Out.. lnL = -2263.306530 1439 lfun, 5756 eigenQcodon, 47487 P(t) Time used: 1:10 Model 7: beta TREE # 1 (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 0.081374 0.040905 0.007442 0.027956 0.042065 0.148320 0.137374 0.291601 0.116091 0.253564 0.127162 2.028450 0.496071 1.323761 ntime & nrate & np: 11 1 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 10.508244 np = 14 lnL0 = -2306.524556 Iterating by ming2 Initial: fx= 2306.524556 x= 0.08137 0.04090 0.00744 0.02796 0.04206 0.14832 0.13737 0.29160 0.11609 0.25356 0.12716 2.02845 0.49607 1.32376 1 h-m-p 0.0000 0.0010 309.4509 ++YCYCCC 2303.701229 5 0.0001 43 | 0/14 2 h-m-p 0.0002 0.0008 205.0199 +YYYYCC 2293.155010 5 0.0006 81 | 0/14 3 h-m-p 0.0000 0.0002 1579.6735 +YCCC 2283.169607 3 0.0001 118 | 0/14 4 h-m-p 0.0002 0.0009 279.9855 CYCCC 2275.063415 4 0.0004 157 | 0/14 5 h-m-p 0.0021 0.0105 22.0168 YCCC 2274.858343 3 0.0009 193 | 0/14 6 h-m-p 0.0005 0.0059 35.1100 YCCC 2274.498836 3 0.0012 229 | 0/14 7 h-m-p 0.0017 0.0330 24.5916 +CCCC 2273.245961 3 0.0081 267 | 0/14 8 h-m-p 0.0023 0.0116 71.0339 YCYCCC 2270.436125 5 0.0058 306 | 0/14 9 h-m-p 0.0013 0.0064 157.7337 YYYY 2269.227242 3 0.0013 340 | 0/14 10 h-m-p 0.0028 0.0139 31.6347 CCC 2269.055212 2 0.0011 375 | 0/14 11 h-m-p 0.0083 0.0845 4.2090 CC 2269.029897 1 0.0026 408 | 0/14 12 h-m-p 0.0039 0.6944 2.8074 ++YCC 2268.745954 2 0.0517 444 | 0/14 13 h-m-p 0.0034 0.0373 42.1092 YCC 2268.527834 2 0.0027 478 | 0/14 14 h-m-p 0.0097 0.0488 11.6893 YC 2268.486329 1 0.0019 510 | 0/14 15 h-m-p 0.0373 1.5068 0.5901 +YCCC 2267.386306 3 0.3563 547 | 0/14 16 h-m-p 0.3204 2.2709 0.6563 YCCCC 2266.311312 4 0.6567 585 | 0/14 17 h-m-p 1.0089 5.0445 0.3001 CYCCC 2264.742976 4 1.7178 623 | 0/14 18 h-m-p 0.3165 1.5824 0.7599 CYCCC 2264.035819 4 0.5455 661 | 0/14 19 h-m-p 1.6000 8.0000 0.0460 YCCC 2263.641344 3 0.8084 697 | 0/14 20 h-m-p 1.0807 8.0000 0.0344 CCC 2263.523818 2 0.9382 732 | 0/14 21 h-m-p 0.5016 8.0000 0.0643 CCC 2263.460217 2 0.8463 767 | 0/14 22 h-m-p 1.0295 8.0000 0.0529 YC 2263.443870 1 0.7060 799 | 0/14 23 h-m-p 1.6000 8.0000 0.0101 YC 2263.441700 1 0.7917 831 | 0/14 24 h-m-p 1.6000 8.0000 0.0012 Y 2263.441584 0 0.6774 862 | 0/14 25 h-m-p 1.6000 8.0000 0.0001 Y 2263.441582 0 0.8663 893 | 0/14 26 h-m-p 1.6000 8.0000 0.0000 Y 2263.441582 0 0.9483 924 | 0/14 27 h-m-p 1.6000 8.0000 0.0000 Y 2263.441582 0 1.1359 955 | 0/14 28 h-m-p 1.6000 8.0000 0.0000 Y 2263.441582 0 0.4000 986 | 0/14 29 h-m-p 0.3633 8.0000 0.0000 ---------------.. | 0/14 30 h-m-p 0.0160 8.0000 0.0001 ------------- Out.. lnL = -2263.441582 1073 lfun, 11803 eigenQcodon, 118030 P(t) Time used: 2:01 Model 8: beta&w>1 TREE # 1 (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 initial w for M8:NSbetaw>1 reset. 0.081374 0.040905 0.007442 0.027956 0.042065 0.148320 0.137374 0.291601 0.116091 0.253564 0.127162 2.029656 0.900000 0.225525 1.016293 2.374037 ntime & nrate & np: 11 2 16 Bounds (np=16): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 8.640570 np = 16 lnL0 = -2306.850636 Iterating by ming2 Initial: fx= 2306.850636 x= 0.08137 0.04090 0.00744 0.02796 0.04206 0.14832 0.13737 0.29160 0.11609 0.25356 0.12716 2.02966 0.90000 0.22553 1.01629 2.37404 1 h-m-p 0.0000 0.0003 499.8162 +++ 2280.684264 m 0.0003 38 | 1/16 2 h-m-p 0.0001 0.0006 161.0018 +YYCCC 2275.788641 4 0.0004 80 | 1/16 3 h-m-p 0.0001 0.0006 277.3551 YYC 2274.525185 2 0.0001 116 | 1/16 4 h-m-p 0.0010 0.0074 24.9455 CCC 2274.183770 2 0.0011 154 | 0/16 5 h-m-p 0.0004 0.0153 68.5523 YCCC 2273.766091 3 0.0002 193 | 0/16 6 h-m-p 0.0004 0.0105 34.3193 YCCC 2273.496665 3 0.0009 233 | 0/16 7 h-m-p 0.0021 0.0136 13.6327 YCC 2273.394002 2 0.0014 271 | 0/16 8 h-m-p 0.0016 0.0395 11.8623 YC 2273.222789 1 0.0038 307 | 0/16 9 h-m-p 0.0021 0.0340 21.0111 YC 2272.871444 1 0.0051 343 | 0/16 10 h-m-p 0.0013 0.0193 82.2217 +CCCCC 2271.118143 4 0.0062 387 | 0/16 11 h-m-p 0.0006 0.0032 336.6931 +YYCCC 2268.259620 4 0.0022 429 | 0/16 12 h-m-p 0.0008 0.0038 85.8359 YCCC 2267.853116 3 0.0015 469 | 0/16 13 h-m-p 0.0059 0.0294 7.7927 CC 2267.808645 1 0.0023 506 | 0/16 14 h-m-p 0.0038 0.0472 4.6601 +CCC 2267.647958 2 0.0168 546 | 0/16 15 h-m-p 0.0006 0.0031 45.3865 ++ 2267.173808 m 0.0031 581 | 0/16 16 h-m-p -0.0000 -0.0000 1.6229 h-m-p: -0.00000000e+00 -0.00000000e+00 1.62291572e+00 2267.173808 .. | 0/16 17 h-m-p 0.0000 0.0005 93.3652 ++YCCCCC 2266.227331 5 0.0002 659 | 0/16 18 h-m-p 0.0002 0.0030 87.6702 YCCC 2265.284075 3 0.0004 699 | 0/16 19 h-m-p 0.0004 0.0024 80.4802 CCCCC 2264.342104 4 0.0006 742 | 0/16 20 h-m-p 0.0001 0.0005 29.3842 CYC 2264.309550 2 0.0001 780 | 0/16 21 h-m-p 0.0001 0.0003 19.6838 ++ 2264.253869 m 0.0003 815 | 1/16 22 h-m-p 0.0005 0.0300 10.7409 C 2264.233974 0 0.0005 850 | 1/16 23 h-m-p 0.0014 0.1120 4.0296 YC 2264.215704 1 0.0028 885 | 1/16 24 h-m-p 0.0008 0.0218 14.1559 CC 2264.192528 1 0.0011 921 | 1/16 25 h-m-p 0.0014 0.1981 11.5459 +CC 2264.089010 1 0.0070 958 | 1/16 26 h-m-p 0.0014 0.0198 59.0489 CYC 2263.991851 2 0.0013 995 | 1/16 27 h-m-p 0.0011 0.0258 66.4819 CYC 2263.901904 2 0.0011 1032 | 1/16 28 h-m-p 0.0188 0.3274 3.8407 -CC 2263.896142 1 0.0016 1069 | 1/16 29 h-m-p 0.0095 0.2761 0.6676 YC 2263.895701 1 0.0018 1104 | 1/16 30 h-m-p 0.0093 4.6658 0.3367 +C 2263.891875 0 0.0371 1139 | 1/16 31 h-m-p 0.0019 0.2792 6.6302 ++YCCC 2263.754504 3 0.0646 1180 | 1/16 32 h-m-p 0.2614 1.3070 1.0872 YYCCCCC 2263.657862 6 0.3420 1224 | 1/16 33 h-m-p 0.7662 3.8308 0.2093 YCCCC 2263.580536 4 0.8295 1265 | 1/16 34 h-m-p 0.7902 8.0000 0.2197 YCC 2263.541099 2 0.3244 1302 | 1/16 35 h-m-p 0.2616 1.3078 0.0756 CC 2263.513569 1 0.3149 1338 | 1/16 36 h-m-p 0.2955 2.2307 0.0805 ++ 2263.457807 m 2.2307 1372 | 2/16 37 h-m-p 0.7088 8.0000 0.2522 YC 2263.444673 1 0.1031 1407 | 2/16 38 h-m-p 1.6000 8.0000 0.0082 YC 2263.441608 1 0.9770 1441 | 2/16 39 h-m-p 1.6000 8.0000 0.0008 Y 2263.441600 0 0.9362 1474 | 2/16 40 h-m-p 1.6000 8.0000 0.0000 Y 2263.441600 0 0.9938 1507 | 2/16 41 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/16 42 h-m-p 0.0160 8.0000 0.0004 -------Y 2263.441600 0 0.0000 1594 Out.. lnL = -2263.441600 1595 lfun, 19140 eigenQcodon, 192995 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2281.337423 S = -2182.045878 -90.874887 Calculating f(w|X), posterior probabilities of site classes. did 10 / 194 patterns 3:28 did 20 / 194 patterns 3:28 did 30 / 194 patterns 3:28 did 40 / 194 patterns 3:28 did 50 / 194 patterns 3:28 did 60 / 194 patterns 3:29 did 70 / 194 patterns 3:29 did 80 / 194 patterns 3:29 did 90 / 194 patterns 3:29 did 100 / 194 patterns 3:29 did 110 / 194 patterns 3:30 did 120 / 194 patterns 3:30 did 130 / 194 patterns 3:30 did 140 / 194 patterns 3:30 did 150 / 194 patterns 3:30 did 160 / 194 patterns 3:31 did 170 / 194 patterns 3:31 did 180 / 194 patterns 3:31 did 190 / 194 patterns 3:31 did 194 / 194 patterns 3:31 Time used: 3:31 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=261 D_melanogaster_140up-PA MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER D_sechellia_140up-PA MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER D_simulans_140up-PA MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER D_erecta_140up-PA MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER D_biarmipes_140up-PA MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER D_rhopaloa_140up-PA MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER D_elegans_140up-PA MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER *.*: ************ :: ..*:* ***.******* * *****:** D_melanogaster_140up-PA LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN D_sechellia_140up-PA LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN D_simulans_140up-PA LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN D_erecta_140up-PA LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN D_biarmipes_140up-PA LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN D_rhopaloa_140up-PA LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN D_elegans_140up-PA LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN **:**:*************:*********:************.******* D_melanogaster_140up-PA NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS D_sechellia_140up-PA NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS D_simulans_140up-PA NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS D_erecta_140up-PA NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS D_biarmipes_140up-PA NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS D_rhopaloa_140up-PA NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS D_elegans_140up-PA NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS *:****************:***********************:*****:* D_melanogaster_140up-PA VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL D_sechellia_140up-PA VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL D_simulans_140up-PA VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL D_erecta_140up-PA VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL D_biarmipes_140up-PA VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL D_rhopaloa_140up-PA VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL D_elegans_140up-PA VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL ****************:******:.*******************.***** D_melanogaster_140up-PA LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK D_sechellia_140up-PA LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK D_simulans_140up-PA LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK D_erecta_140up-PA LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK D_biarmipes_140up-PA LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK D_rhopaloa_140up-PA LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK D_elegans_140up-PA LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK *************************:*** ********: * ***.**** D_melanogaster_140up-PA TSEHVSLDTIK D_sechellia_140up-PA TSEQVSLDTIK D_simulans_140up-PA TSEQVSLDTIK D_erecta_140up-PA TAEQVSLDSIK D_biarmipes_140up-PA VPEEVSLDSVK D_rhopaloa_140up-PA KSSEVSLDSVK D_elegans_140up-PA VPEQVSLDSVK ...****::*
>D_melanogaster_140up-PA ATGAATTTTCTGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC AACATTCGAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAACAAAACAT ACAAGGCCTTTCTGGCCAGTAAACCACCAGAGGAAACAGGACTGGAGCGC CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCCTCCGAGCT TAACTCGGTTTACCAGGCCGGCTTCCTAGGATTCCTTATTGGAGCTATTT ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC AACCAGGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA AGATCAATTCACAGTCAACTTTGCCAAAGGCGGCTTCAAATGGGGCTGGC GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACTTGTATGTCG GTGTACCGTGGAAAATCCTCAATCTACGAATACTTGGCCGCTGGTTCCAT CACCGGCTCGCTTTACAAAGTGAGTCTTGGTCTGCGGGGCATGGCGGCAG GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG CTGCTGATGAAAGCATCAGGGACCTCGATGGAAGAGGTTCGCTACTGGCA GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA AACTGACAGAGGACGAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA ACATCCGAACATGTATCGCTGGACACGATCAAG >D_sechellia_140up-PA ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT ACAAGGCATTTCTGGACAGTAAACTACCAGAAGAAACGGGACTGGAGCGC CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG GTGTACCGTGGAAAATCCTCAATATACGAATACTTGGCCGCTGGCTCCGT CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA ACATCCGAACAGGTATCGCTGGACACGATCAAG >D_simulans_140up-PA ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT ACAAGGCCTTTCTGGACCGTAAACTACCAGAGGAAACGGGACTGGAGCGC CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT ACGGCGGAGTTACACAATCGCGCGTGGCTTATATGAATTTCATGGAGAAC AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC GAGTAGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG GTGTACCGTGGAAAATCCTCAATTTACGAATACTTGGCCGCTGGTTCCGT CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGTTG CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA ACATCCGAACAGGTATCGCTGGACACGATCAAG >D_erecta_140up-PA ATGAATTTTCTGTGGAAAGGCCGTCGGTTTCTGATCGCAGGTATCCTGCC AACATTTGACGGCAGCTCAGACGACATAATCGACAAGGAAAGCAAAACTT ACAAGGCCTTCCTGGCCAGTAAACCACCAGAGGAAACGGGACTGGAGCGC CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCGTCCGAACT TAACTCTGTTTACCAGGCTGGCTTCCTGGGATTCCTCGTTGGAGCAATTT ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC AACGAAGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA AGATCAATTCACAGTCAACTTCGCCAAAGGCGGTTTCAAATGGGGCTGGC GAGTGGGACTTTTTACCACATCCTACCTCGGCATCATCACCTGCATTTCG GTGTACCGTGGAAAGTCCTCAATTTATGAGTACTTGGCCGCTGGTTCCAT CACCGGCTCACTTTACAAAATGAATCTTGGTCTGCGGGGCATGGCGGCAG GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGGTGGTGTAACGTCCCTG CTGCTGATGAAGGCATCCGGGACTTCGATGGAGGAGGTTCGCTACTGGCA GTACAAATGGCGACTCGATCGCGACGAGAACATTCAACTGGCGTTCAAAA AACTGACAGAGGATGAAACCCCAGAACTTTTCAAGGTCCACGACGAAAAA ACAGCCGAACAGGTATCGCTGGACTCGATCAAG >D_biarmipes_140up-PA ATGAGTTTCTTGTGGAAAGGACGCCGGTTTCTGATCGCCGGGATCCTGCC GATCATGGAAAACGGCGCCGACGACATAAAGGACAAGGAAAACAAGACCT ACAAGGCTTTCCTGGCCAGTAAACCGCCGGAGGAAACGGGTCTGGAGCGC CTCAAACAAATGTTTTCCATCGACGAGTTTGGAAGCATATCCTCCGAGTT GAACTCCATTTACCAGGCCGGCTTCCTGGGCTTCCTCATTGGAGCCATTT ATGGAGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC AACCAGGCGACAGCCTTCAAATCTCACTTTGATGCCAAGAAAAAGCTGCA GGATGAGTTCACAGTCAACTTTGCCAAGGGTGGTTTCAAATGGGGCTGGC GCGTGGGCCTCTTTACCACCTCCTACTTTGGGATCATCACCTGCATGTCG GTGTACCGTGGCAAATCCTCGATCTACGAGTACCTGGCCGCCGGTTCCAT CACCGGCTCGCTCTACAAGATGAATTTGGGACTGCGCGGCATGGCGGCAG GTGGAATCATTGGAGGCTTCCTGGGCGGAGTGGCTGGCGTGACCTCGCTG CTGCTGATGAAGGCTTCCGGCACCTCGATGGAGGAGGTGCGCTACTGGCA GTACAAGTGGCGACTCGACCGCGACGAAAACATCCAGCTGGCCTTCAAAA AGCTGACGGAAGACGAAAACCCAGCGCTCTTCAAGGCGCACGACGAAAAA GTACCCGAAGAGGTGTCCCTGGACTCGGTCAAG >D_rhopaloa_140up-PA ATGAGTTTCTTGTGGAAAGGACGACGGTTTTTGATTGCCGGCATTCTGCC AGTCCTAGAACGCGGCGCAGATGACATAGTGGATAAGGAAAACAAGACCT ACAAGGCATTCCTAGCCAGTAAACCACCAGAGGAAACAGGAATGGAGCGC CTTAAACATATGTTTACAATCGACGAGTTCGGTAGTATATCCTCTGAACT GAATTCAATTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCGATTT ACGGTGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTTCA GGACCAATTTACTGTTAACTTTGCCAAAGGCGGCTTTAAATGGGGTTGGC GAGTGGGACTTTTCACCACTTCCTACTTTGGCATCATTACGTGCATGTCG GTGTACCGTGGAAAATCATCTATCTACGAGTACTTGGCCGCTGGATCCGT CACCGGCTCCCTTTACAAAGTAAATCTGGGACTACGGGGTATGGCAGCAG GCGGGATCATTGGTGGCTTCTTGGGCGGAGTCGCTGGAGTCACCTCCCTG CTGCTGATGAAGGCATCCGGCACTTCGATGGAGGAAGTGCGCTACTGGCA GTACAAGTGGCGACTGGATCGCGACGAAAACATTCAGCTGGCGTTCAAAA AACTGACGGAGGATGAAACCCCTGAGTTGTTTAAGGCCCATGATGAAAAG AAATCCTCTGAGGTATCCCTCGACTCGGTCAAG >D_elegans_140up-PA ATGAGTTTTTTGTTGAAAGGACGCCGGTTTTTGATCGCCGGCATCCTGCC AGCTTTTGAACGCGGCCCAGACGACATAGTGGATAAGGAAAACAAGACTT ATAAGGCATTCCTGGCCAGTAAACCGCCAGAGGAAACGGGACTGGAGCGC CTCAAACAAATGTTTTCAATTGACGAGTTTGGTAGTATATCTTCCGAGCT GAATTCAATTTACCAGGCCGGTTTCCTGGGATTCCTCATTGGAGCGATTT ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTACA GGACCAATTTACGGTCAACTTTGCCAAGGGCGGCTTCAAATGGGGCTGGC GAGTGGGACTTTTTACAACTTCCTACTTCGGCATCATCACCTGCATATCT GTGTATCGTGGAAAATCGTCGATCTACGAGTACTTGGCCGCAGGTTCCGT CACCGGCTCCCTTTACAAAATGAATCTGGGACTGCGAGGCATGGCGGCAG GCGGGATCATTGGCGGCTTCTTGGGCGGAGTGGCTGGAGTCACCTCCCTG CTACTGATGAAGGCATCCGGCACTTCGATGGAGGAGGTGCGCTATTGGCA GTACAAGTGGCGGCTCGATCGCGATGATAACATCCAGCAGGCCTTCAAAA AACTGACAGAGGATGAACAACCGGAGCTGTTCAAGGTCCATGACGAAAAG GTACCCGAACAGGTATCCCTGGACTCGGTCAAG
>D_melanogaster_140up-PA MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK TSEHVSLDTIK >D_sechellia_140up-PA MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK TSEQVSLDTIK >D_simulans_140up-PA MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK TSEQVSLDTIK >D_erecta_140up-PA MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK TAEQVSLDSIK >D_biarmipes_140up-PA MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK VPEEVSLDSVK >D_rhopaloa_140up-PA MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK KSSEVSLDSVK >D_elegans_140up-PA MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK VPEQVSLDSVK
#NEXUS [ID: 7445175374] begin taxa; dimensions ntax=7; taxlabels D_melanogaster_140up-PA D_sechellia_140up-PA D_simulans_140up-PA D_erecta_140up-PA D_biarmipes_140up-PA D_rhopaloa_140up-PA D_elegans_140up-PA ; end; begin trees; translate 1 D_melanogaster_140up-PA, 2 D_sechellia_140up-PA, 3 D_simulans_140up-PA, 4 D_erecta_140up-PA, 5 D_biarmipes_140up-PA, 6 D_rhopaloa_140up-PA, 7 D_elegans_140up-PA ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.03620244,(2:0.009156944,3:0.01063421)0.999:0.02522272,(4:0.09973014,(5:0.1806781,(6:0.1582741,7:0.07553494)1.000:0.07132086)1.000:0.1127562)0.515:0.02645107); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.03620244,(2:0.009156944,3:0.01063421):0.02522272,(4:0.09973014,(5:0.1806781,(6:0.1582741,7:0.07553494):0.07132086):0.1127562):0.02645107); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2398.61 -2409.66 2 -2398.87 -2411.80 -------------------------------------- TOTAL -2398.73 -2411.22 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.820105 0.008222 0.651108 1.000156 0.812905 1067.72 1096.52 1.000 r(A<->C){all} 0.079087 0.000409 0.041854 0.120711 0.077942 920.17 989.87 1.000 r(A<->G){all} 0.196543 0.001057 0.134646 0.260142 0.195006 957.57 978.50 1.000 r(A<->T){all} 0.110014 0.000917 0.054042 0.169338 0.107765 988.70 1009.44 1.000 r(C<->G){all} 0.062425 0.000265 0.032195 0.095200 0.061588 1043.50 1109.52 1.000 r(C<->T){all} 0.494200 0.002429 0.399754 0.591764 0.493357 736.15 768.44 1.001 r(G<->T){all} 0.057731 0.000344 0.024252 0.094673 0.056321 1072.94 1103.32 1.000 pi(A){all} 0.259035 0.000210 0.230489 0.287533 0.258521 1089.84 1133.28 1.000 pi(C){all} 0.263281 0.000201 0.235066 0.289907 0.263120 1126.05 1163.10 1.000 pi(G){all} 0.269155 0.000207 0.240979 0.297106 0.268850 1156.56 1163.62 1.000 pi(T){all} 0.208530 0.000184 0.182554 0.234673 0.208347 1021.33 1107.82 1.000 alpha{1,2} 0.081995 0.001152 0.000923 0.129880 0.087793 1057.72 1164.39 1.001 alpha{3} 3.078765 0.938903 1.353621 4.886878 2.957174 1259.75 1380.38 1.000 pinvar{all} 0.201510 0.005327 0.064091 0.350348 0.203520 1282.21 1297.91 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/1/140up-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 7 ls = 261 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 9 7 7 8 7 8 | Ser TCT 0 1 1 1 1 3 | Tyr TAT 0 1 2 1 1 1 | Cys TGT 1 0 0 0 0 0 TTC 10 12 12 10 11 10 | TCC 6 7 7 6 9 8 | TAC 11 10 9 10 10 10 | TGC 0 1 1 1 1 1 Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 3 0 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 2 2 3 2 3 5 | TCG 8 7 7 7 7 5 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 6 3 3 5 0 4 | Pro CCT 0 0 0 0 0 1 | His CAT 1 0 0 0 0 2 | Arg CGT 1 1 2 2 1 1 CTC 2 3 3 4 6 2 | CCC 0 0 0 0 1 0 | CAC 2 2 2 2 2 1 | CGC 5 5 5 4 7 5 CTA 1 1 1 0 0 3 | CCA 4 3 3 4 1 3 | Gln CAA 5 7 7 5 2 2 | CGA 2 2 2 2 1 3 CTG 12 14 13 14 15 10 | CCG 0 0 0 0 3 0 | CAG 4 5 5 3 5 5 | CGG 2 2 2 2 1 2 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 4 4 5 5 4 8 | Thr ACT 1 1 1 2 0 3 | Asn AAT 2 4 4 3 2 3 | Ser AGT 2 1 0 1 2 3 ATC 9 7 7 9 10 4 | ACC 3 5 5 4 7 5 | AAC 7 6 6 5 8 5 | AGC 1 1 1 3 1 0 ATA 2 3 2 2 2 2 | ACA 10 6 6 8 3 4 | Lys AAA 14 14 14 12 9 12 | Arg AGA 0 0 0 0 0 0 Met ATG 8 9 9 8 10 9 | ACG 2 3 3 2 2 2 | AAG 7 7 7 9 13 10 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 3 3 4 1 2 | Ala GCT 3 2 3 2 3 3 | Asp GAT 5 5 5 4 2 6 | Gly GGT 5 4 5 8 5 5 GTC 2 3 3 2 2 5 | GCC 10 9 9 7 11 8 | GAC 5 6 6 8 9 5 | GGC 13 14 13 13 13 12 GTA 1 1 2 2 1 2 | GCA 5 6 5 5 1 5 | Glu GAA 9 7 6 8 8 8 | GGA 9 9 9 8 9 11 GTG 6 6 5 4 7 5 | GCG 2 2 2 2 4 2 | GAG 9 9 10 9 10 9 | GGG 1 1 1 1 2 1 -------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------ Phe TTT 9 | Ser TCT 2 | Tyr TAT 3 | Cys TGT 0 TTC 10 | TCC 7 | TAC 8 | TGC 1 Leu TTA 0 | TCA 2 | *** TAA 0 | *** TGA 0 TTG 5 | TCG 6 | TAG 0 | Trp TGG 4 ------------------------------------------------------ Leu CTT 2 | Pro CCT 0 | His CAT 1 | Arg CGT 1 CTC 3 | CCC 1 | CAC 1 | CGC 6 CTA 2 | CCA 3 | Gln CAA 4 | CGA 2 CTG 12 | CCG 2 | CAG 7 | CGG 2 ------------------------------------------------------ Ile ATT 5 | Thr ACT 3 | Asn AAT 3 | Ser AGT 3 ATC 7 | ACC 3 | AAC 5 | AGC 0 ATA 3 | ACA 4 | Lys AAA 10 | Arg AGA 0 Met ATG 8 | ACG 2 | AAG 11 | AGG 0 ------------------------------------------------------ Val GTT 1 | Ala GCT 3 | Asp GAT 6 | Gly GGT 3 GTC 5 | GCC 8 | GAC 6 | GGC 15 GTA 2 | GCA 4 | Glu GAA 6 | GGA 10 GTG 6 | GCG 2 | GAG 10 | GGG 1 ------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_140up-PA position 1: T:0.20690 C:0.18008 A:0.27586 G:0.33716 position 2: T:0.29502 C:0.21456 A:0.31034 G:0.18008 position 3: T:0.16475 C:0.32950 A:0.24521 G:0.26054 Average T:0.22222 C:0.24138 A:0.27714 G:0.25926 #2: D_sechellia_140up-PA position 1: T:0.21073 C:0.18391 A:0.27203 G:0.33333 position 2: T:0.29885 C:0.20690 A:0.31801 G:0.17625 position 3: T:0.14176 C:0.34866 A:0.23372 G:0.27586 Average T:0.21711 C:0.24649 A:0.27458 G:0.26181 #3: D_simulans_140up-PA position 1: T:0.21456 C:0.18391 A:0.26820 G:0.33333 position 2: T:0.29885 C:0.20690 A:0.31801 G:0.17625 position 3: T:0.15709 C:0.34100 A:0.22605 G:0.27586 Average T:0.22350 C:0.24393 A:0.27075 G:0.26181 #4: D_erecta_140up-PA position 1: T:0.20690 C:0.18008 A:0.27969 G:0.33333 position 2: T:0.30268 C:0.20307 A:0.30268 G:0.19157 position 3: T:0.17625 C:0.33716 A:0.22605 G:0.26054 Average T:0.22861 C:0.24010 A:0.26948 G:0.26181 #5: D_biarmipes_140up-PA position 1: T:0.21073 C:0.17241 A:0.27969 G:0.33716 position 2: T:0.30268 C:0.20307 A:0.31034 G:0.18391 position 3: T:0.11111 C:0.41379 A:0.14176 G:0.33333 Average T:0.20817 C:0.26309 A:0.24393 G:0.28480 #6: D_rhopaloa_140up-PA position 1: T:0.22222 C:0.16858 A:0.26820 G:0.34100 position 2: T:0.30268 C:0.20690 A:0.30268 G:0.18774 position 3: T:0.20307 C:0.31034 A:0.21839 G:0.26820 Average T:0.24266 C:0.22861 A:0.26309 G:0.26564 #7: D_elegans_140up-PA position 1: T:0.21839 C:0.18774 A:0.25670 G:0.33716 position 2: T:0.30651 C:0.19923 A:0.31034 G:0.18391 position 3: T:0.17241 C:0.32950 A:0.19923 G:0.29885 Average T:0.23244 C:0.23883 A:0.25543 G:0.27331 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 55 | Ser S TCT 9 | Tyr Y TAT 9 | Cys C TGT 1 TTC 75 | TCC 50 | TAC 68 | TGC 6 Leu L TTA 0 | TCA 13 | *** * TAA 0 | *** * TGA 0 TTG 22 | TCG 47 | TAG 0 | Trp W TGG 34 ------------------------------------------------------------------------------ Leu L CTT 23 | Pro P CCT 1 | His H CAT 4 | Arg R CGT 9 CTC 23 | CCC 2 | CAC 12 | CGC 37 CTA 8 | CCA 21 | Gln Q CAA 32 | CGA 14 CTG 90 | CCG 5 | CAG 34 | CGG 13 ------------------------------------------------------------------------------ Ile I ATT 35 | Thr T ACT 11 | Asn N AAT 21 | Ser S AGT 12 ATC 53 | ACC 32 | AAC 42 | AGC 7 ATA 16 | ACA 41 | Lys K AAA 85 | Arg R AGA 0 Met M ATG 61 | ACG 16 | AAG 64 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 17 | Ala A GCT 19 | Asp D GAT 33 | Gly G GGT 35 GTC 22 | GCC 62 | GAC 45 | GGC 93 GTA 11 | GCA 31 | Glu E GAA 52 | GGA 65 GTG 39 | GCG 16 | GAG 66 | GGG 8 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.21292 C:0.17953 A:0.27148 G:0.33607 position 2: T:0.30104 C:0.20580 A:0.31034 G:0.18281 position 3: T:0.16092 C:0.34428 A:0.21292 G:0.28188 Average T:0.22496 C:0.24320 A:0.26492 G:0.26692 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_140up-PA D_sechellia_140up-PA 0.1082 (0.0152 0.1410) D_simulans_140up-PA 0.1151 (0.0170 0.1474) 0.0380 (0.0017 0.0442) D_erecta_140up-PA 0.1632 (0.0361 0.2215) 0.2026 (0.0450 0.2220) 0.2107 (0.0468 0.2219) D_biarmipes_140up-PA 0.0757 (0.0478 0.6317) 0.0933 (0.0514 0.5505) 0.0928 (0.0532 0.5731) 0.0786 (0.0521 0.6623) D_rhopaloa_140up-PA 0.0545 (0.0405 0.7443) 0.0703 (0.0458 0.6518) 0.0676 (0.0476 0.7043) 0.0680 (0.0513 0.7546) 0.0436 (0.0369 0.8468) D_elegans_140up-PA 0.0681 (0.0414 0.6078) 0.0815 (0.0432 0.5295) 0.0799 (0.0449 0.5626) 0.0759 (0.0432 0.5698) 0.0569 (0.0343 0.6022) 0.0898 (0.0370 0.4121) Model 0: one-ratio TREE # 1: (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 check convergence.. lnL(ntime: 11 np: 13): -2296.714420 +0.000000 8..1 8..9 9..2 9..3 8..10 10..4 10..11 11..5 11..12 12..6 12..7 0.064138 0.061828 0.015104 0.020894 0.053230 0.143736 0.165684 0.295242 0.098018 0.248945 0.140494 1.974197 0.085771 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.30731 (1: 0.064138, (2: 0.015104, 3: 0.020894): 0.061828, (4: 0.143736, (5: 0.295242, (6: 0.248945, 7: 0.140494): 0.098018): 0.165684): 0.053230); (D_melanogaster_140up-PA: 0.064138, (D_sechellia_140up-PA: 0.015104, D_simulans_140up-PA: 0.020894): 0.061828, (D_erecta_140up-PA: 0.143736, (D_biarmipes_140up-PA: 0.295242, (D_rhopaloa_140up-PA: 0.248945, D_elegans_140up-PA: 0.140494): 0.098018): 0.165684): 0.053230); Detailed output identifying parameters kappa (ts/tv) = 1.97420 omega (dN/dS) = 0.08577 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.064 592.4 190.6 0.0858 0.0059 0.0693 3.5 13.2 8..9 0.062 592.4 190.6 0.0858 0.0057 0.0668 3.4 12.7 9..2 0.015 592.4 190.6 0.0858 0.0014 0.0163 0.8 3.1 9..3 0.021 592.4 190.6 0.0858 0.0019 0.0226 1.1 4.3 8..10 0.053 592.4 190.6 0.0858 0.0049 0.0575 2.9 11.0 10..4 0.144 592.4 190.6 0.0858 0.0133 0.1554 7.9 29.6 10..11 0.166 592.4 190.6 0.0858 0.0154 0.1791 9.1 34.1 11..5 0.295 592.4 190.6 0.0858 0.0274 0.3191 16.2 60.8 11..12 0.098 592.4 190.6 0.0858 0.0091 0.1060 5.4 20.2 12..6 0.249 592.4 190.6 0.0858 0.0231 0.2691 13.7 51.3 12..7 0.140 592.4 190.6 0.0858 0.0130 0.1519 7.7 29.0 tree length for dN: 0.1212 tree length for dS: 1.4132 Time used: 0:05 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 check convergence.. lnL(ntime: 11 np: 14): -2265.340105 +0.000000 8..1 8..9 9..2 9..3 8..10 10..4 10..11 11..5 11..12 12..6 12..7 0.066366 0.060689 0.015267 0.020935 0.050950 0.150483 0.173745 0.305454 0.101444 0.264030 0.140321 2.088670 0.903855 0.026360 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.34968 (1: 0.066366, (2: 0.015267, 3: 0.020935): 0.060689, (4: 0.150483, (5: 0.305454, (6: 0.264030, 7: 0.140321): 0.101444): 0.173745): 0.050950); (D_melanogaster_140up-PA: 0.066366, (D_sechellia_140up-PA: 0.015267, D_simulans_140up-PA: 0.020935): 0.060689, (D_erecta_140up-PA: 0.150483, (D_biarmipes_140up-PA: 0.305454, (D_rhopaloa_140up-PA: 0.264030, D_elegans_140up-PA: 0.140321): 0.101444): 0.173745): 0.050950); Detailed output identifying parameters kappa (ts/tv) = 2.08867 dN/dS (w) for site classes (K=2) p: 0.90385 0.09615 w: 0.02636 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.066 590.8 192.2 0.1200 0.0079 0.0658 4.7 12.7 8..9 0.061 590.8 192.2 0.1200 0.0072 0.0602 4.3 11.6 9..2 0.015 590.8 192.2 0.1200 0.0018 0.0151 1.1 2.9 9..3 0.021 590.8 192.2 0.1200 0.0025 0.0208 1.5 4.0 8..10 0.051 590.8 192.2 0.1200 0.0061 0.0505 3.6 9.7 10..4 0.150 590.8 192.2 0.1200 0.0179 0.1493 10.6 28.7 10..11 0.174 590.8 192.2 0.1200 0.0207 0.1724 12.2 33.1 11..5 0.305 590.8 192.2 0.1200 0.0364 0.3030 21.5 58.2 11..12 0.101 590.8 192.2 0.1200 0.0121 0.1006 7.1 19.3 12..6 0.264 590.8 192.2 0.1200 0.0314 0.2619 18.6 50.3 12..7 0.140 590.8 192.2 0.1200 0.0167 0.1392 9.9 26.8 Time used: 0:17 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 check convergence.. lnL(ntime: 11 np: 16): -2265.340105 +0.000000 8..1 8..9 9..2 9..3 8..10 10..4 10..11 11..5 11..12 12..6 12..7 0.066366 0.060689 0.015267 0.020935 0.050950 0.150483 0.173744 0.305454 0.101444 0.264030 0.140321 2.088672 0.903855 0.096145 0.026360 59.617560 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.34968 (1: 0.066366, (2: 0.015267, 3: 0.020935): 0.060689, (4: 0.150483, (5: 0.305454, (6: 0.264030, 7: 0.140321): 0.101444): 0.173744): 0.050950); (D_melanogaster_140up-PA: 0.066366, (D_sechellia_140up-PA: 0.015267, D_simulans_140up-PA: 0.020935): 0.060689, (D_erecta_140up-PA: 0.150483, (D_biarmipes_140up-PA: 0.305454, (D_rhopaloa_140up-PA: 0.264030, D_elegans_140up-PA: 0.140321): 0.101444): 0.173744): 0.050950); Detailed output identifying parameters kappa (ts/tv) = 2.08867 dN/dS (w) for site classes (K=3) p: 0.90385 0.09615 0.00000 w: 0.02636 1.00000 59.61756 (note that p[2] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.066 590.8 192.2 0.1200 0.0079 0.0658 4.7 12.7 8..9 0.061 590.8 192.2 0.1200 0.0072 0.0602 4.3 11.6 9..2 0.015 590.8 192.2 0.1200 0.0018 0.0151 1.1 2.9 9..3 0.021 590.8 192.2 0.1200 0.0025 0.0208 1.5 4.0 8..10 0.051 590.8 192.2 0.1200 0.0061 0.0505 3.6 9.7 10..4 0.150 590.8 192.2 0.1200 0.0179 0.1493 10.6 28.7 10..11 0.174 590.8 192.2 0.1200 0.0207 0.1724 12.2 33.1 11..5 0.305 590.8 192.2 0.1200 0.0364 0.3030 21.5 58.2 11..12 0.101 590.8 192.2 0.1200 0.0121 0.1006 7.1 19.3 12..6 0.264 590.8 192.2 0.1200 0.0314 0.2619 18.6 50.3 12..7 0.140 590.8 192.2 0.1200 0.0167 0.1392 9.9 26.8 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_140up-PA) Pr(w>1) post mean +- SE for w 18 T 0.543 1.276 +- 0.328 19 F 0.524 1.262 +- 0.326 56 T 0.608 1.321 +- 0.329 240 N 0.551 1.292 +- 0.311 251 T 0.667 1.359 +- 0.313 254 H 0.501 1.246 +- 0.325 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.967 0.030 0.002 0.001 0.000 0.000 0.000 0.000 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.014 0.984 sum of density on p0-p1 = 1.000000 Time used: 0:49 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 lnL(ntime: 11 np: 17): -2263.306530 +0.000000 8..1 8..9 9..2 9..3 8..10 10..4 10..11 11..5 11..12 12..6 12..7 0.066036 0.061483 0.015267 0.021050 0.051227 0.149998 0.172792 0.305893 0.100178 0.260352 0.141622 2.028450 0.427292 0.424028 0.013246 0.013246 0.589244 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.34590 (1: 0.066036, (2: 0.015267, 3: 0.021050): 0.061483, (4: 0.149998, (5: 0.305893, (6: 0.260352, 7: 0.141622): 0.100178): 0.172792): 0.051227); (D_melanogaster_140up-PA: 0.066036, (D_sechellia_140up-PA: 0.015267, D_simulans_140up-PA: 0.021050): 0.061483, (D_erecta_140up-PA: 0.149998, (D_biarmipes_140up-PA: 0.305893, (D_rhopaloa_140up-PA: 0.260352, D_elegans_140up-PA: 0.141622): 0.100178): 0.172792): 0.051227); Detailed output identifying parameters kappa (ts/tv) = 2.02845 dN/dS (w) for site classes (K=3) p: 0.42729 0.42403 0.14868 w: 0.01325 0.01325 0.58924 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.066 591.6 191.4 0.0989 0.0068 0.0690 4.0 13.2 8..9 0.061 591.6 191.4 0.0989 0.0063 0.0642 3.8 12.3 9..2 0.015 591.6 191.4 0.0989 0.0016 0.0159 0.9 3.1 9..3 0.021 591.6 191.4 0.0989 0.0022 0.0220 1.3 4.2 8..10 0.051 591.6 191.4 0.0989 0.0053 0.0535 3.1 10.2 10..4 0.150 591.6 191.4 0.0989 0.0155 0.1567 9.2 30.0 10..11 0.173 591.6 191.4 0.0989 0.0178 0.1805 10.6 34.5 11..5 0.306 591.6 191.4 0.0989 0.0316 0.3195 18.7 61.1 11..12 0.100 591.6 191.4 0.0989 0.0103 0.1046 6.1 20.0 12..6 0.260 591.6 191.4 0.0989 0.0269 0.2719 15.9 52.0 12..7 0.142 591.6 191.4 0.0989 0.0146 0.1479 8.7 28.3 Naive Empirical Bayes (NEB) analysis Time used: 1:10 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 check convergence.. lnL(ntime: 11 np: 14): -2263.441582 +0.000000 8..1 8..9 9..2 9..3 8..10 10..4 10..11 11..5 11..12 12..6 12..7 0.065909 0.061452 0.015250 0.021026 0.051388 0.149731 0.172398 0.305676 0.100793 0.260315 0.141534 2.029656 0.087200 0.773416 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.34547 (1: 0.065909, (2: 0.015250, 3: 0.021026): 0.061452, (4: 0.149731, (5: 0.305676, (6: 0.260315, 7: 0.141534): 0.100793): 0.172398): 0.051388); (D_melanogaster_140up-PA: 0.065909, (D_sechellia_140up-PA: 0.015250, D_simulans_140up-PA: 0.021026): 0.061452, (D_erecta_140up-PA: 0.149731, (D_biarmipes_140up-PA: 0.305676, (D_rhopaloa_140up-PA: 0.260315, D_elegans_140up-PA: 0.141534): 0.100793): 0.172398): 0.051388); Detailed output identifying parameters kappa (ts/tv) = 2.02966 Parameters in M7 (beta): p = 0.08720 q = 0.77342 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00001 0.00016 0.00160 0.01086 0.05550 0.22431 0.69448 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.066 591.6 191.4 0.0987 0.0068 0.0689 4.0 13.2 8..9 0.061 591.6 191.4 0.0987 0.0063 0.0642 3.7 12.3 9..2 0.015 591.6 191.4 0.0987 0.0016 0.0159 0.9 3.0 9..3 0.021 591.6 191.4 0.0987 0.0022 0.0220 1.3 4.2 8..10 0.051 591.6 191.4 0.0987 0.0053 0.0537 3.1 10.3 10..4 0.150 591.6 191.4 0.0987 0.0154 0.1564 9.1 29.9 10..11 0.172 591.6 191.4 0.0987 0.0178 0.1801 10.5 34.5 11..5 0.306 591.6 191.4 0.0987 0.0315 0.3194 18.6 61.1 11..12 0.101 591.6 191.4 0.0987 0.0104 0.1053 6.1 20.2 12..6 0.260 591.6 191.4 0.0987 0.0268 0.2720 15.9 52.1 12..7 0.142 591.6 191.4 0.0987 0.0146 0.1479 8.6 28.3 Time used: 2:01 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), (4, (5, (6, 7)))); MP score: 266 lnL(ntime: 11 np: 16): -2263.441600 +0.000000 8..1 8..9 9..2 9..3 8..10 10..4 10..11 11..5 11..12 12..6 12..7 0.065909 0.061452 0.015250 0.021026 0.051388 0.149731 0.172398 0.305676 0.100793 0.260315 0.141534 2.029659 0.999990 0.087201 0.773486 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.34547 (1: 0.065909, (2: 0.015250, 3: 0.021026): 0.061452, (4: 0.149731, (5: 0.305676, (6: 0.260315, 7: 0.141534): 0.100793): 0.172398): 0.051388); (D_melanogaster_140up-PA: 0.065909, (D_sechellia_140up-PA: 0.015250, D_simulans_140up-PA: 0.021026): 0.061452, (D_erecta_140up-PA: 0.149731, (D_biarmipes_140up-PA: 0.305676, (D_rhopaloa_140up-PA: 0.260315, D_elegans_140up-PA: 0.141534): 0.100793): 0.172398): 0.051388); Detailed output identifying parameters kappa (ts/tv) = 2.02966 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.08720 q = 0.77349 (p1 = 0.00001) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00001 0.00016 0.00160 0.01086 0.05549 0.22429 0.69443 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.066 591.6 191.4 0.0987 0.0068 0.0689 4.0 13.2 8..9 0.061 591.6 191.4 0.0987 0.0063 0.0642 3.7 12.3 9..2 0.015 591.6 191.4 0.0987 0.0016 0.0159 0.9 3.0 9..3 0.021 591.6 191.4 0.0987 0.0022 0.0220 1.3 4.2 8..10 0.051 591.6 191.4 0.0987 0.0053 0.0537 3.1 10.3 10..4 0.150 591.6 191.4 0.0987 0.0154 0.1564 9.1 29.9 10..11 0.172 591.6 191.4 0.0987 0.0178 0.1801 10.5 34.5 11..5 0.306 591.6 191.4 0.0987 0.0315 0.3194 18.6 61.1 11..12 0.101 591.6 191.4 0.0987 0.0104 0.1053 6.1 20.2 12..6 0.260 591.6 191.4 0.0987 0.0268 0.2720 15.9 52.1 12..7 0.142 591.6 191.4 0.0987 0.0146 0.1479 8.6 28.3 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_140up-PA) Pr(w>1) post mean +- SE for w 18 T 0.671 1.195 +- 0.491 19 F 0.634 1.154 +- 0.505 27 V 0.531 1.038 +- 0.536 56 T 0.771 1.302 +- 0.436 230 Q 0.521 0.992 +- 0.580 240 N 0.705 1.242 +- 0.458 251 T 0.868 1.404 +- 0.338 252 S 0.548 1.060 +- 0.525 254 H 0.595 1.112 +- 0.516 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.002 0.017 0.066 0.160 0.296 0.459 ws: 0.981 0.018 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 Time used: 3:31
Model 1: NearlyNeutral -2265.340105 Model 2: PositiveSelection -2265.340105 Model 0: one-ratio -2296.71442 Model 3: discrete -2263.30653 Model 7: beta -2263.441582 Model 8: beta&w>1 -2263.4416 Model 0 vs 1 62.74862999999914 Model 2 vs 1 0.0 Model 8 vs 7 3.600000036385609E-5