Back

140up-PA - ClustalW2

Download 
--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 15:36:12 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/140up-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2398.61         -2409.66
2      -2398.87         -2411.80
--------------------------------------
TOTAL    -2398.73         -2411.22
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.820105    0.008222    0.651108    1.000156    0.812905   1067.72   1096.52    1.000
r(A<->C){all}   0.079087    0.000409    0.041854    0.120711    0.077942    920.17    989.87    1.000
r(A<->G){all}   0.196543    0.001057    0.134646    0.260142    0.195006    957.57    978.50    1.000
r(A<->T){all}   0.110014    0.000917    0.054042    0.169338    0.107765    988.70   1009.44    1.000
r(C<->G){all}   0.062425    0.000265    0.032195    0.095200    0.061588   1043.50   1109.52    1.000
r(C<->T){all}   0.494200    0.002429    0.399754    0.591764    0.493357    736.15    768.44    1.001
r(G<->T){all}   0.057731    0.000344    0.024252    0.094673    0.056321   1072.94   1103.32    1.000
pi(A){all}      0.259035    0.000210    0.230489    0.287533    0.258521   1089.84   1133.28    1.000
pi(C){all}      0.263281    0.000201    0.235066    0.289907    0.263120   1126.05   1163.10    1.000
pi(G){all}      0.269155    0.000207    0.240979    0.297106    0.268850   1156.56   1163.62    1.000
pi(T){all}      0.208530    0.000184    0.182554    0.234673    0.208347   1021.33   1107.82    1.000
alpha{1,2}      0.081995    0.001152    0.000923    0.129880    0.087793   1057.72   1164.39    1.001
alpha{3}        3.078765    0.938903    1.353621    4.886878    2.957174   1259.75   1380.38    1.000
pinvar{all}     0.201510    0.005327    0.064091    0.350348    0.203520   1282.21   1297.91    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2265.340105
Model 2: PositiveSelection	-2265.340105
Model 0: one-ratio	-2296.71442
Model 3: discrete	-2263.30653
Model 7: beta	-2263.441582
Model 8: beta&w>1	-2263.4416


Model 0 vs 1	62.74862999999914

Model 2 vs 1	0.0

Model 8 vs 7	3.600000036385609E-5
Download 
>C1
MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK
TSEHVSLDTIK
>C2
MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER
LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
TSEQVSLDTIK
>C3
MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER
LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
TSEQVSLDTIK
>C4
MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN
NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS
VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK
TAEQVSLDSIK
>C5
MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER
LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK
VPEEVSLDSVK
>C6
MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER
LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK
KSSEVSLDSVK
>C7
MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER
LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS
VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK
VPEQVSLDSVK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=261 

C1              MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER
C2              MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER
C3              MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER
C4              MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER
C5              MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER
C6              MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER
C7              MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER
                *.*: ************ :: ..*:* ***.*******  * *****:**

C1              LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
C2              LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
C3              LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
C4              LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN
C5              LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
C6              LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
C7              LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
                **:**:*************:*********:************.*******

C1              NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
C2              NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
C3              NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
C4              NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS
C5              NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
C6              NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
C7              NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS
                *:****************:***********************:*****:*

C1              VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL
C2              VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
C3              VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
C4              VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL
C5              VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
C6              VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
C7              VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
                ****************:******:.*******************.*****

C1              LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK
C2              LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
C3              LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
C4              LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK
C5              LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK
C6              LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK
C7              LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK
                *************************:*** ********: * ***.****

C1              TSEHVSLDTIK
C2              TSEQVSLDTIK
C3              TSEQVSLDTIK
C4              TAEQVSLDSIK
C5              VPEEVSLDSVK
C6              KSSEVSLDSVK
C7              VPEQVSLDSVK
                 ...****::*




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  261 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  261 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10962]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [10962]--->[10962]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/140up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.398 Mb, Max= 30.781 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK
TSEHVSLDTIK
>C2
MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER
LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
TSEQVSLDTIK
>C3
MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER
LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
TSEQVSLDTIK
>C4
MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN
NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS
VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK
TAEQVSLDSIK
>C5
MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER
LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK
VPEEVSLDSVK
>C6
MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER
LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK
KSSEVSLDSVK
>C7
MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER
LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS
VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK
VPEQVSLDSVK

FORMAT of file /tmp/tmp3017220430560137762aln Not Supported[FATAL:T-COFFEE]
>C1
MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK
TSEHVSLDTIK
>C2
MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER
LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
TSEQVSLDTIK
>C3
MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER
LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
TSEQVSLDTIK
>C4
MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN
NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS
VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK
TAEQVSLDSIK
>C5
MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER
LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK
VPEEVSLDSVK
>C6
MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER
LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK
KSSEVSLDSVK
>C7
MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER
LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS
VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK
VPEQVSLDSVK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:261 S:100 BS:261
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.55 C1	 C2	 96.55
TOP	    1    0	 96.55 C2	 C1	 96.55
BOT	    0    2	 96.17 C1	 C3	 96.17
TOP	    2    0	 96.17 C3	 C1	 96.17
BOT	    0    3	 92.34 C1	 C4	 92.34
TOP	    3    0	 92.34 C4	 C1	 92.34
BOT	    0    4	 92.34 C1	 C5	 92.34
TOP	    4    0	 92.34 C5	 C1	 92.34
BOT	    0    5	 92.72 C1	 C6	 92.72
TOP	    5    0	 92.72 C6	 C1	 92.72
BOT	    0    6	 91.57 C1	 C7	 91.57
TOP	    6    0	 91.57 C7	 C1	 91.57
BOT	    1    2	 99.62 C2	 C3	 99.62
TOP	    2    1	 99.62 C3	 C2	 99.62
BOT	    1    3	 90.80 C2	 C4	 90.80
TOP	    3    1	 90.80 C4	 C2	 90.80
BOT	    1    4	 90.80 C2	 C5	 90.80
TOP	    4    1	 90.80 C5	 C2	 90.80
BOT	    1    5	 91.19 C2	 C6	 91.19
TOP	    5    1	 91.19 C6	 C2	 91.19
BOT	    1    6	 91.19 C2	 C7	 91.19
TOP	    6    1	 91.19 C7	 C2	 91.19
BOT	    2    3	 90.42 C3	 C4	 90.42
TOP	    3    2	 90.42 C4	 C3	 90.42
BOT	    2    4	 90.42 C3	 C5	 90.42
TOP	    4    2	 90.42 C5	 C3	 90.42
BOT	    2    5	 90.80 C3	 C6	 90.80
TOP	    5    2	 90.80 C6	 C3	 90.80
BOT	    2    6	 90.80 C3	 C7	 90.80
TOP	    6    2	 90.80 C7	 C3	 90.80
BOT	    3    4	 90.80 C4	 C5	 90.80
TOP	    4    3	 90.80 C5	 C4	 90.80
BOT	    3    5	 90.42 C4	 C6	 90.42
TOP	    5    3	 90.42 C6	 C4	 90.42
BOT	    3    6	 91.57 C4	 C7	 91.57
TOP	    6    3	 91.57 C7	 C4	 91.57
BOT	    4    5	 94.25 C5	 C6	 94.25
TOP	    5    4	 94.25 C6	 C5	 94.25
BOT	    4    6	 94.25 C5	 C7	 94.25
TOP	    6    4	 94.25 C7	 C5	 94.25
BOT	    5    6	 93.49 C6	 C7	 93.49
TOP	    6    5	 93.49 C7	 C6	 93.49
AVG	 0	 C1	  *	 93.61
AVG	 1	 C2	  *	 93.36
AVG	 2	 C3	  *	 93.04
AVG	 3	 C4	  *	 91.06
AVG	 4	 C5	  *	 92.15
AVG	 5	 C6	  *	 92.15
AVG	 6	 C7	  *	 92.15
TOT	 TOT	  *	 92.50
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAATTTTCTGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC
C2              ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC
C3              ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC
C4              ATGAATTTTCTGTGGAAAGGCCGTCGGTTTCTGATCGCAGGTATCCTGCC
C5              ATGAGTTTCTTGTGGAAAGGACGCCGGTTTCTGATCGCCGGGATCCTGCC
C6              ATGAGTTTCTTGTGGAAAGGACGACGGTTTTTGATTGCCGGCATTCTGCC
C7              ATGAGTTTTTTGTTGAAAGGACGCCGGTTTTTGATCGCCGGCATCCTGCC
                ****.***  *** ******.** ****** **** **.** ** *****

C1              AACATTCGAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAACAAAACAT
C2              AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT
C3              AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT
C4              AACATTTGACGGCAGCTCAGACGACATAATCGACAAGGAAAGCAAAACTT
C5              GATCATGGAAAACGGCGCCGACGACATAAAGGACAAGGAAAACAAGACCT
C6              AGTCCTAGAACGCGGCGCAGATGACATAGTGGATAAGGAAAACAAGACCT
C7              AGCTTTTGAACGCGGCCCAGACGACATAGTGGATAAGGAAAACAAGACTT
                ..   *  *. .*. * *.** **.***.: ** *******. **.** *

C1              ACAAGGCCTTTCTGGCCAGTAAACCACCAGAGGAAACAGGACTGGAGCGC
C2              ACAAGGCATTTCTGGACAGTAAACTACCAGAAGAAACGGGACTGGAGCGC
C3              ACAAGGCCTTTCTGGACCGTAAACTACCAGAGGAAACGGGACTGGAGCGC
C4              ACAAGGCCTTCCTGGCCAGTAAACCACCAGAGGAAACGGGACTGGAGCGC
C5              ACAAGGCTTTCCTGGCCAGTAAACCGCCGGAGGAAACGGGTCTGGAGCGC
C6              ACAAGGCATTCCTAGCCAGTAAACCACCAGAGGAAACAGGAATGGAGCGC
C7              ATAAGGCATTCCTGGCCAGTAAACCGCCAGAGGAAACGGGACTGGAGCGC
                * ***** ** **.*.*.****** .**.**.*****.**:.********

C1              CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCCTCCGAGCT
C2              CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT
C3              CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT
C4              CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCGTCCGAACT
C5              CTCAAACAAATGTTTTCCATCGACGAGTTTGGAAGCATATCCTCCGAGTT
C6              CTTAAACATATGTTTACAATCGACGAGTTCGGTAGTATATCCTCTGAACT
C7              CTCAAACAAATGTTTTCAATTGACGAGTTTGGTAGTATATCTTCCGAGCT
                ** **.**:******:*.** ******** ** ** ***** ** **. *

C1              TAACTCGGTTTACCAGGCCGGCTTCCTAGGATTCCTTATTGGAGCTATTT
C2              TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT
C3              TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT
C4              TAACTCTGTTTACCAGGCTGGCTTCCTGGGATTCCTCGTTGGAGCAATTT
C5              GAACTCCATTTACCAGGCCGGCTTCCTGGGCTTCCTCATTGGAGCCATTT
C6              GAATTCAATTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCGATTT
C7              GAATTCAATTTACCAGGCCGGTTTCCTGGGATTCCTCATTGGAGCGATTT
                 ** ** .**** ***** ** *****.**.***** .******* ****

C1              ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC
C2              ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC
C3              ACGGCGGAGTTACACAATCGCGCGTGGCTTATATGAATTTCATGGAGAAC
C4              ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
C5              ATGGAGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
C6              ACGGTGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
C7              ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
                * ** **********************  ** ******************

C1              AACCAGGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
C2              AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
C3              AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
C4              AACGAAGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
C5              AACCAGGCGACAGCCTTCAAATCTCACTTTGATGCCAAGAAAAAGCTGCA
C6              AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTTCA
C7              AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTACA
                *** *.** ***** ** ***** *********************** **

C1              AGATCAATTCACAGTCAACTTTGCCAAAGGCGGCTTCAAATGGGGCTGGC
C2              AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC
C3              AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC
C4              AGATCAATTCACAGTCAACTTCGCCAAAGGCGGTTTCAAATGGGGCTGGC
C5              GGATGAGTTCACAGTCAACTTTGCCAAGGGTGGTTTCAAATGGGGCTGGC
C6              GGACCAATTTACTGTTAACTTTGCCAAAGGCGGCTTTAAATGGGGTTGGC
C7              GGACCAATTTACGGTCAACTTTGCCAAGGGCGGCTTCAAATGGGGCTGGC
                .**  *.** ** ** ***** *****.** ** ** ******** ****

C1              GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACTTGTATGTCG
C2              GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG
C3              GAGTAGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG
C4              GAGTGGGACTTTTTACCACATCCTACCTCGGCATCATCACCTGCATTTCG
C5              GCGTGGGCCTCTTTACCACCTCCTACTTTGGGATCATCACCTGCATGTCG
C6              GAGTGGGACTTTTCACCACTTCCTACTTTGGCATCATTACGTGCATGTCG
C7              GAGTGGGACTTTTTACAACTTCCTACTTCGGCATCATCACCTGCATATCT
                *.**.**.** ** **.** ****** * ** ***** ** ** ** ** 

C1              GTGTACCGTGGAAAATCCTCAATCTACGAATACTTGGCCGCTGGTTCCAT
C2              GTGTACCGTGGAAAATCCTCAATATACGAATACTTGGCCGCTGGCTCCGT
C3              GTGTACCGTGGAAAATCCTCAATTTACGAATACTTGGCCGCTGGTTCCGT
C4              GTGTACCGTGGAAAGTCCTCAATTTATGAGTACTTGGCCGCTGGTTCCAT
C5              GTGTACCGTGGCAAATCCTCGATCTACGAGTACCTGGCCGCCGGTTCCAT
C6              GTGTACCGTGGAAAATCATCTATCTACGAGTACTTGGCCGCTGGATCCGT
C7              GTGTATCGTGGAAAATCGTCGATCTACGAGTACTTGGCCGCAGGTTCCGT
                ***** *****.**.** ** ** ** **.*** ******* ** ***.*

C1              CACCGGCTCGCTTTACAAAGTGAGTCTTGGTCTGCGGGGCATGGCGGCAG
C2              CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG
C3              CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG
C4              CACCGGCTCACTTTACAAAATGAATCTTGGTCTGCGGGGCATGGCGGCAG
C5              CACCGGCTCGCTCTACAAGATGAATTTGGGACTGCGCGGCATGGCGGCAG
C6              CACCGGCTCCCTTTACAAAGTAAATCTGGGACTACGGGGTATGGCAGCAG
C7              CACCGGCTCCCTTTACAAAATGAATCTGGGACTGCGAGGCATGGCGGCAG
                ********* ** *****..*.*.* * **:**.** ** *****.****

C1              GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG
C2              GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG
C3              GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGTTG
C4              GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGGTGGTGTAACGTCCCTG
C5              GTGGAATCATTGGAGGCTTCCTGGGCGGAGTGGCTGGCGTGACCTCGCTG
C6              GCGGGATCATTGGTGGCTTCTTGGGCGGAGTCGCTGGAGTCACCTCCCTG
C7              GCGGGATCATTGGCGGCTTCTTGGGCGGAGTGGCTGGAGTCACCTCCCTG
                * **.******** ** *** *******.** * *** ** ** **  **

C1              CTGCTGATGAAAGCATCAGGGACCTCGATGGAAGAGGTTCGCTACTGGCA
C2              CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA
C3              CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA
C4              CTGCTGATGAAGGCATCCGGGACTTCGATGGAGGAGGTTCGCTACTGGCA
C5              CTGCTGATGAAGGCTTCCGGCACCTCGATGGAGGAGGTGCGCTACTGGCA
C6              CTGCTGATGAAGGCATCCGGCACTTCGATGGAGGAAGTGCGCTACTGGCA
C7              CTACTGATGAAGGCATCCGGCACTTCGATGGAGGAGGTGCGCTATTGGCA
                **.********.**:**.** ** ********.**.** ***** *****

C1              GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA
C2              GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA
C3              GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA
C4              GTACAAATGGCGACTCGATCGCGACGAGAACATTCAACTGGCGTTCAAAA
C5              GTACAAGTGGCGACTCGACCGCGACGAAAACATCCAGCTGGCCTTCAAAA
C6              GTACAAGTGGCGACTGGATCGCGACGAAAACATTCAGCTGGCGTTCAAAA
C7              GTACAAGTGGCGGCTCGATCGCGATGATAACATCCAGCAGGCCTTCAAAA
                ******.*****.** ** ***** ** ***** **.*:*** *******

C1              AACTGACAGAGGACGAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA
C2              AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA
C3              AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA
C4              AACTGACAGAGGATGAAACCCCAGAACTTTTCAAGGTCCACGACGAAAAA
C5              AGCTGACGGAAGACGAAAACCCAGCGCTCTTCAAGGCGCACGACGAAAAA
C6              AACTGACGGAGGATGAAACCCCTGAGTTGTTTAAGGCCCATGATGAAAAG
C7              AACTGACAGAGGATGAACAACCGGAGCTGTTCAAGGTCCATGACGAAAAG
                *.*****.**.**  **...** *.. * ** ****  ** ** **.**.

C1              ACATCCGAACATGTATCGCTGGACACGATCAAG
C2              ACATCCGAACAGGTATCGCTGGACACGATCAAG
C3              ACATCCGAACAGGTATCGCTGGACACGATCAAG
C4              ACAGCCGAACAGGTATCGCTGGACTCGATCAAG
C5              GTACCCGAAGAGGTGTCCCTGGACTCGGTCAAG
C6              AAATCCTCTGAGGTATCCCTCGACTCGGTCAAG
C7              GTACCCGAACAGGTATCCCTGGACTCGGTCAAG
                . * ** .: * **.** ** ***:**.*****



>C1
ATGAATTTTCTGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC
AACATTCGAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAACAAAACAT
ACAAGGCCTTTCTGGCCAGTAAACCACCAGAGGAAACAGGACTGGAGCGC
CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCCTCCGAGCT
TAACTCGGTTTACCAGGCCGGCTTCCTAGGATTCCTTATTGGAGCTATTT
ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC
AACCAGGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
AGATCAATTCACAGTCAACTTTGCCAAAGGCGGCTTCAAATGGGGCTGGC
GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACTTGTATGTCG
GTGTACCGTGGAAAATCCTCAATCTACGAATACTTGGCCGCTGGTTCCAT
CACCGGCTCGCTTTACAAAGTGAGTCTTGGTCTGCGGGGCATGGCGGCAG
GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG
CTGCTGATGAAAGCATCAGGGACCTCGATGGAAGAGGTTCGCTACTGGCA
GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA
AACTGACAGAGGACGAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA
ACATCCGAACATGTATCGCTGGACACGATCAAG
>C2
ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC
AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT
ACAAGGCATTTCTGGACAGTAAACTACCAGAAGAAACGGGACTGGAGCGC
CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT
TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT
ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC
AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC
GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG
GTGTACCGTGGAAAATCCTCAATATACGAATACTTGGCCGCTGGCTCCGT
CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG
GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG
CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA
GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA
AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA
ACATCCGAACAGGTATCGCTGGACACGATCAAG
>C3
ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC
AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT
ACAAGGCCTTTCTGGACCGTAAACTACCAGAGGAAACGGGACTGGAGCGC
CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT
TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT
ACGGCGGAGTTACACAATCGCGCGTGGCTTATATGAATTTCATGGAGAAC
AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC
GAGTAGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG
GTGTACCGTGGAAAATCCTCAATTTACGAATACTTGGCCGCTGGTTCCGT
CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG
GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGTTG
CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA
GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA
AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA
ACATCCGAACAGGTATCGCTGGACACGATCAAG
>C4
ATGAATTTTCTGTGGAAAGGCCGTCGGTTTCTGATCGCAGGTATCCTGCC
AACATTTGACGGCAGCTCAGACGACATAATCGACAAGGAAAGCAAAACTT
ACAAGGCCTTCCTGGCCAGTAAACCACCAGAGGAAACGGGACTGGAGCGC
CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCGTCCGAACT
TAACTCTGTTTACCAGGCTGGCTTCCTGGGATTCCTCGTTGGAGCAATTT
ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
AACGAAGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
AGATCAATTCACAGTCAACTTCGCCAAAGGCGGTTTCAAATGGGGCTGGC
GAGTGGGACTTTTTACCACATCCTACCTCGGCATCATCACCTGCATTTCG
GTGTACCGTGGAAAGTCCTCAATTTATGAGTACTTGGCCGCTGGTTCCAT
CACCGGCTCACTTTACAAAATGAATCTTGGTCTGCGGGGCATGGCGGCAG
GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGGTGGTGTAACGTCCCTG
CTGCTGATGAAGGCATCCGGGACTTCGATGGAGGAGGTTCGCTACTGGCA
GTACAAATGGCGACTCGATCGCGACGAGAACATTCAACTGGCGTTCAAAA
AACTGACAGAGGATGAAACCCCAGAACTTTTCAAGGTCCACGACGAAAAA
ACAGCCGAACAGGTATCGCTGGACTCGATCAAG
>C5
ATGAGTTTCTTGTGGAAAGGACGCCGGTTTCTGATCGCCGGGATCCTGCC
GATCATGGAAAACGGCGCCGACGACATAAAGGACAAGGAAAACAAGACCT
ACAAGGCTTTCCTGGCCAGTAAACCGCCGGAGGAAACGGGTCTGGAGCGC
CTCAAACAAATGTTTTCCATCGACGAGTTTGGAAGCATATCCTCCGAGTT
GAACTCCATTTACCAGGCCGGCTTCCTGGGCTTCCTCATTGGAGCCATTT
ATGGAGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
AACCAGGCGACAGCCTTCAAATCTCACTTTGATGCCAAGAAAAAGCTGCA
GGATGAGTTCACAGTCAACTTTGCCAAGGGTGGTTTCAAATGGGGCTGGC
GCGTGGGCCTCTTTACCACCTCCTACTTTGGGATCATCACCTGCATGTCG
GTGTACCGTGGCAAATCCTCGATCTACGAGTACCTGGCCGCCGGTTCCAT
CACCGGCTCGCTCTACAAGATGAATTTGGGACTGCGCGGCATGGCGGCAG
GTGGAATCATTGGAGGCTTCCTGGGCGGAGTGGCTGGCGTGACCTCGCTG
CTGCTGATGAAGGCTTCCGGCACCTCGATGGAGGAGGTGCGCTACTGGCA
GTACAAGTGGCGACTCGACCGCGACGAAAACATCCAGCTGGCCTTCAAAA
AGCTGACGGAAGACGAAAACCCAGCGCTCTTCAAGGCGCACGACGAAAAA
GTACCCGAAGAGGTGTCCCTGGACTCGGTCAAG
>C6
ATGAGTTTCTTGTGGAAAGGACGACGGTTTTTGATTGCCGGCATTCTGCC
AGTCCTAGAACGCGGCGCAGATGACATAGTGGATAAGGAAAACAAGACCT
ACAAGGCATTCCTAGCCAGTAAACCACCAGAGGAAACAGGAATGGAGCGC
CTTAAACATATGTTTACAATCGACGAGTTCGGTAGTATATCCTCTGAACT
GAATTCAATTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCGATTT
ACGGTGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTTCA
GGACCAATTTACTGTTAACTTTGCCAAAGGCGGCTTTAAATGGGGTTGGC
GAGTGGGACTTTTCACCACTTCCTACTTTGGCATCATTACGTGCATGTCG
GTGTACCGTGGAAAATCATCTATCTACGAGTACTTGGCCGCTGGATCCGT
CACCGGCTCCCTTTACAAAGTAAATCTGGGACTACGGGGTATGGCAGCAG
GCGGGATCATTGGTGGCTTCTTGGGCGGAGTCGCTGGAGTCACCTCCCTG
CTGCTGATGAAGGCATCCGGCACTTCGATGGAGGAAGTGCGCTACTGGCA
GTACAAGTGGCGACTGGATCGCGACGAAAACATTCAGCTGGCGTTCAAAA
AACTGACGGAGGATGAAACCCCTGAGTTGTTTAAGGCCCATGATGAAAAG
AAATCCTCTGAGGTATCCCTCGACTCGGTCAAG
>C7
ATGAGTTTTTTGTTGAAAGGACGCCGGTTTTTGATCGCCGGCATCCTGCC
AGCTTTTGAACGCGGCCCAGACGACATAGTGGATAAGGAAAACAAGACTT
ATAAGGCATTCCTGGCCAGTAAACCGCCAGAGGAAACGGGACTGGAGCGC
CTCAAACAAATGTTTTCAATTGACGAGTTTGGTAGTATATCTTCCGAGCT
GAATTCAATTTACCAGGCCGGTTTCCTGGGATTCCTCATTGGAGCGATTT
ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTACA
GGACCAATTTACGGTCAACTTTGCCAAGGGCGGCTTCAAATGGGGCTGGC
GAGTGGGACTTTTTACAACTTCCTACTTCGGCATCATCACCTGCATATCT
GTGTATCGTGGAAAATCGTCGATCTACGAGTACTTGGCCGCAGGTTCCGT
CACCGGCTCCCTTTACAAAATGAATCTGGGACTGCGAGGCATGGCGGCAG
GCGGGATCATTGGCGGCTTCTTGGGCGGAGTGGCTGGAGTCACCTCCCTG
CTACTGATGAAGGCATCCGGCACTTCGATGGAGGAGGTGCGCTATTGGCA
GTACAAGTGGCGGCTCGATCGCGATGATAACATCCAGCAGGCCTTCAAAA
AACTGACAGAGGATGAACAACCGGAGCTGTTCAAGGTCCATGACGAAAAG
GTACCCGAACAGGTATCCCTGGACTCGGTCAAG
>C1
MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK
TSEHVSLDTIK
>C2
MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER
LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
TSEQVSLDTIK
>C3
MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER
LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
TSEQVSLDTIK
>C4
MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN
NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS
VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK
TAEQVSLDSIK
>C5
MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER
LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK
VPEEVSLDSVK
>C6
MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER
LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK
KSSEVSLDSVK
>C7
MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER
LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS
VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK
VPEQVSLDSVK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 7 taxa and 783 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Taxon 7 -> C7
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480087610
      Setting output file names to "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1942935382
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 7445175374
      Seed = 1411937477
      Swapseed = 1480087610
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 34 unique site patterns
      Division 2 has 21 unique site patterns
      Division 3 has 97 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3057.137270 -- -24.557203
         Chain 2 -- -3017.143072 -- -24.557203
         Chain 3 -- -3077.183432 -- -24.557203
         Chain 4 -- -3043.100524 -- -24.557203

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3106.513707 -- -24.557203
         Chain 2 -- -3067.588346 -- -24.557203
         Chain 3 -- -3011.270554 -- -24.557203
         Chain 4 -- -3087.423172 -- -24.557203


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3057.137] (-3017.143) (-3077.183) (-3043.101) * [-3106.514] (-3067.588) (-3011.271) (-3087.423) 
        500 -- [-2497.656] (-2501.302) (-2521.687) (-2522.326) * (-2523.408) (-2508.427) (-2518.942) [-2498.150] -- 0:33:19
       1000 -- [-2473.464] (-2466.963) (-2496.718) (-2511.027) * (-2467.864) [-2475.865] (-2510.012) (-2479.840) -- 0:16:39
       1500 -- [-2437.352] (-2424.769) (-2439.185) (-2467.864) * (-2451.429) [-2441.104] (-2476.704) (-2431.795) -- 0:11:05
       2000 -- (-2411.857) [-2404.903] (-2417.298) (-2445.613) * [-2434.211] (-2424.379) (-2456.097) (-2441.274) -- 0:08:19
       2500 -- [-2407.372] (-2412.336) (-2411.649) (-2428.464) * (-2412.344) (-2418.371) (-2438.216) [-2407.337] -- 0:06:39
       3000 -- (-2415.450) (-2412.528) [-2409.746] (-2414.635) * (-2401.834) (-2409.261) (-2420.951) [-2401.683] -- 0:05:32
       3500 -- (-2406.691) (-2404.278) (-2400.217) [-2404.753] * (-2398.152) (-2403.925) [-2406.352] (-2399.377) -- 0:09:29
       4000 -- (-2410.538) (-2403.910) [-2396.709] (-2403.579) * (-2408.655) [-2408.019] (-2412.533) (-2405.219) -- 0:08:18
       4500 -- (-2408.440) (-2403.216) (-2405.902) [-2412.268] * (-2403.539) (-2416.441) (-2406.630) [-2395.410] -- 0:07:22
       5000 -- [-2408.919] (-2405.708) (-2402.771) (-2405.908) * (-2400.718) (-2413.132) [-2406.026] (-2400.791) -- 0:06:38

      Average standard deviation of split frequencies: 0.125708

       5500 -- (-2408.958) (-2400.816) [-2403.056] (-2400.501) * [-2403.091] (-2408.292) (-2400.187) (-2404.684) -- 0:06:01
       6000 -- [-2405.249] (-2410.619) (-2404.271) (-2400.318) * (-2400.620) (-2404.927) (-2397.567) [-2402.042] -- 0:05:31
       6500 -- (-2399.891) [-2401.726] (-2406.147) (-2410.857) * (-2404.796) [-2404.726] (-2407.140) (-2408.638) -- 0:07:38
       7000 -- (-2396.493) (-2407.079) [-2403.604] (-2405.399) * (-2403.042) [-2406.643] (-2399.664) (-2406.921) -- 0:07:05
       7500 -- (-2403.503) [-2403.968] (-2398.724) (-2407.985) * (-2403.450) (-2410.532) [-2400.058] (-2406.564) -- 0:06:37
       8000 -- (-2401.222) (-2412.906) (-2402.545) [-2401.452] * [-2399.405] (-2400.200) (-2404.615) (-2402.990) -- 0:06:12
       8500 -- [-2403.171] (-2408.040) (-2397.995) (-2409.741) * (-2399.335) (-2403.695) [-2400.915] (-2403.308) -- 0:05:49
       9000 -- (-2402.481) (-2414.318) (-2400.907) [-2398.027] * [-2402.883] (-2409.599) (-2401.084) (-2404.211) -- 0:07:20
       9500 -- [-2404.557] (-2416.882) (-2401.188) (-2399.724) * (-2412.764) (-2401.790) (-2402.875) [-2400.260] -- 0:06:57
      10000 -- [-2400.179] (-2408.943) (-2404.376) (-2404.447) * (-2407.814) [-2400.001] (-2404.309) (-2406.107) -- 0:06:36

      Average standard deviation of split frequencies: 0.070711

      10500 -- [-2405.416] (-2410.893) (-2403.151) (-2405.869) * [-2404.928] (-2399.478) (-2408.056) (-2413.745) -- 0:06:16
      11000 -- (-2403.531) (-2401.874) (-2402.252) [-2399.389] * (-2404.534) (-2401.187) [-2398.594] (-2402.221) -- 0:05:59
      11500 -- [-2406.904] (-2400.911) (-2400.065) (-2402.065) * (-2407.016) [-2401.420] (-2407.541) (-2406.873) -- 0:05:43
      12000 -- (-2405.910) (-2396.546) (-2405.481) [-2404.942] * (-2406.917) (-2400.391) [-2405.134] (-2397.467) -- 0:06:51
      12500 -- (-2403.584) (-2406.768) [-2405.263] (-2404.318) * [-2397.011] (-2399.445) (-2409.834) (-2404.883) -- 0:06:35
      13000 -- (-2402.070) (-2404.932) [-2402.501] (-2407.177) * [-2401.389] (-2405.290) (-2407.623) (-2402.766) -- 0:06:19
      13500 -- [-2401.925] (-2397.574) (-2406.014) (-2407.489) * (-2406.528) [-2405.370] (-2412.994) (-2404.018) -- 0:06:05
      14000 -- [-2399.506] (-2404.556) (-2398.931) (-2403.125) * (-2398.739) (-2403.402) [-2403.558] (-2408.023) -- 0:05:52
      14500 -- [-2396.969] (-2403.999) (-2409.338) (-2401.816) * (-2412.018) (-2409.106) [-2406.688] (-2407.017) -- 0:05:39
      15000 -- (-2405.543) (-2408.207) (-2402.285) [-2398.376] * (-2411.880) (-2399.383) (-2407.796) [-2400.735] -- 0:06:34

      Average standard deviation of split frequencies: 0.035355

      15500 -- (-2401.175) (-2403.832) (-2410.951) [-2397.426] * (-2408.487) [-2396.512] (-2415.664) (-2405.378) -- 0:06:21
      16000 -- (-2403.572) [-2405.975] (-2404.995) (-2411.173) * [-2409.213] (-2409.817) (-2405.139) (-2403.642) -- 0:06:09
      16500 -- (-2403.960) (-2404.668) [-2402.149] (-2401.800) * (-2409.851) (-2408.724) [-2399.861] (-2409.296) -- 0:05:57
      17000 -- [-2400.390] (-2402.744) (-2400.147) (-2404.344) * [-2409.620] (-2403.204) (-2403.507) (-2405.275) -- 0:05:46
      17500 -- (-2401.769) (-2410.579) [-2402.095] (-2405.049) * (-2409.930) (-2411.931) (-2409.405) [-2406.164] -- 0:05:36
      18000 -- (-2396.658) (-2408.855) [-2403.265] (-2400.274) * (-2407.905) (-2408.354) (-2408.888) [-2406.400] -- 0:06:21
      18500 -- (-2414.690) (-2408.763) [-2404.861] (-2399.402) * (-2418.547) (-2401.695) (-2400.383) [-2406.021] -- 0:06:11
      19000 -- (-2401.889) (-2404.373) [-2402.062] (-2401.988) * (-2407.705) [-2399.421] (-2406.081) (-2415.933) -- 0:06:01
      19500 -- (-2407.225) (-2400.091) [-2411.683] (-2403.921) * (-2406.868) [-2400.842] (-2405.588) (-2407.522) -- 0:05:51
      20000 -- (-2402.633) [-2404.559] (-2403.849) (-2403.422) * [-2400.151] (-2403.185) (-2404.750) (-2401.298) -- 0:05:43

      Average standard deviation of split frequencies: 0.045620

      20500 -- (-2409.764) (-2415.370) [-2399.656] (-2408.850) * (-2404.276) (-2411.182) [-2407.066] (-2401.317) -- 0:05:34
      21000 -- [-2394.590] (-2406.891) (-2409.154) (-2408.486) * (-2402.474) (-2413.082) (-2402.197) [-2400.594] -- 0:06:12
      21500 -- [-2403.998] (-2406.277) (-2405.535) (-2411.150) * (-2397.432) (-2403.464) (-2402.065) [-2400.380] -- 0:06:04
      22000 -- [-2397.083] (-2415.402) (-2404.297) (-2405.527) * (-2403.836) (-2399.338) [-2402.516] (-2401.037) -- 0:05:55
      22500 -- (-2402.546) (-2414.778) [-2401.819] (-2410.808) * (-2399.773) (-2408.151) [-2400.180] (-2401.079) -- 0:05:47
      23000 -- [-2405.507] (-2408.608) (-2415.676) (-2403.747) * (-2404.215) (-2402.443) (-2403.576) [-2400.867] -- 0:05:39
      23500 -- (-2408.500) [-2407.639] (-2397.791) (-2407.508) * (-2406.532) (-2398.583) (-2398.268) [-2401.579] -- 0:05:32
      24000 -- (-2399.863) (-2401.748) (-2405.561) [-2397.593] * (-2398.062) (-2412.269) (-2402.938) [-2401.239] -- 0:06:06
      24500 -- [-2399.069] (-2400.519) (-2404.829) (-2403.666) * [-2402.894] (-2400.516) (-2408.286) (-2407.182) -- 0:05:58
      25000 -- (-2405.161) (-2406.038) (-2406.456) [-2400.643] * (-2405.091) (-2408.008) [-2401.496] (-2398.602) -- 0:05:51

      Average standard deviation of split frequencies: 0.029010

      25500 -- [-2398.856] (-2412.060) (-2398.413) (-2405.673) * [-2402.943] (-2407.625) (-2411.722) (-2407.528) -- 0:05:43
      26000 -- (-2403.115) (-2410.923) [-2402.091] (-2403.279) * (-2403.295) [-2402.810] (-2410.408) (-2406.888) -- 0:05:37
      26500 -- [-2398.162] (-2417.103) (-2402.702) (-2407.557) * (-2406.974) (-2399.020) (-2406.976) [-2403.887] -- 0:06:07
      27000 -- (-2400.285) (-2405.978) [-2401.810] (-2407.241) * (-2403.085) (-2402.506) [-2404.406] (-2406.376) -- 0:06:00
      27500 -- [-2404.651] (-2405.270) (-2401.179) (-2401.872) * [-2405.564] (-2399.479) (-2407.283) (-2407.876) -- 0:05:53
      28000 -- [-2408.133] (-2405.850) (-2405.927) (-2402.905) * (-2398.045) [-2403.913] (-2403.504) (-2402.313) -- 0:05:47
      28500 -- (-2401.640) (-2403.512) [-2402.488] (-2400.676) * (-2403.330) [-2401.171] (-2406.776) (-2404.297) -- 0:05:40
      29000 -- (-2408.341) (-2401.494) (-2409.370) [-2402.730] * (-2403.159) [-2399.664] (-2400.481) (-2403.178) -- 0:05:34
      29500 -- (-2410.267) (-2402.163) [-2405.872] (-2408.659) * [-2402.215] (-2411.425) (-2406.977) (-2407.462) -- 0:06:01
      30000 -- (-2401.835) [-2401.015] (-2404.721) (-2401.813) * (-2404.769) (-2407.727) (-2402.868) [-2404.234] -- 0:05:55

      Average standard deviation of split frequencies: 0.018446

      30500 -- (-2405.595) (-2404.020) (-2402.335) [-2397.854] * (-2407.429) (-2404.272) (-2400.395) [-2400.643] -- 0:05:49
      31000 -- (-2409.798) [-2402.079] (-2405.568) (-2412.306) * (-2405.676) (-2406.376) (-2412.223) [-2401.279] -- 0:05:43
      31500 -- (-2402.502) (-2401.581) (-2411.456) [-2408.057] * (-2403.451) (-2405.906) [-2402.611] (-2402.384) -- 0:05:38
      32000 -- (-2401.262) (-2407.670) [-2407.617] (-2410.622) * (-2407.224) (-2410.142) (-2401.964) [-2405.931] -- 0:05:32
      32500 -- [-2398.169] (-2408.243) (-2403.712) (-2417.381) * [-2407.562] (-2415.201) (-2406.174) (-2403.727) -- 0:05:57
      33000 -- [-2403.804] (-2403.634) (-2403.001) (-2412.463) * (-2403.819) (-2409.486) [-2401.408] (-2405.511) -- 0:05:51
      33500 -- (-2403.479) (-2403.524) [-2402.109] (-2407.417) * (-2409.615) (-2404.660) (-2402.415) [-2404.907] -- 0:05:46
      34000 -- (-2402.305) (-2407.823) (-2401.628) [-2404.714] * [-2400.695] (-2405.188) (-2405.181) (-2405.281) -- 0:05:40
      34500 -- [-2397.675] (-2407.503) (-2404.698) (-2407.109) * (-2408.956) (-2405.827) [-2399.219] (-2405.776) -- 0:05:35
      35000 -- (-2403.362) (-2396.968) [-2405.014] (-2406.885) * (-2408.704) [-2407.403] (-2406.116) (-2409.542) -- 0:05:30

      Average standard deviation of split frequencies: 0.015713

      35500 -- (-2409.201) [-2397.623] (-2401.026) (-2409.299) * [-2401.973] (-2414.011) (-2400.704) (-2418.702) -- 0:05:53
      36000 -- (-2408.871) [-2409.017] (-2415.125) (-2405.947) * (-2413.363) (-2407.630) [-2400.751] (-2414.936) -- 0:05:48
      36500 -- (-2404.200) (-2406.191) (-2409.479) [-2401.722] * (-2411.991) [-2403.356] (-2396.903) (-2413.142) -- 0:05:43
      37000 -- [-2400.796] (-2408.116) (-2407.346) (-2413.389) * (-2398.530) (-2412.146) [-2402.165] (-2415.718) -- 0:05:38
      37500 -- (-2402.852) [-2401.998] (-2413.246) (-2410.526) * (-2404.376) (-2409.238) [-2401.185] (-2414.139) -- 0:05:33
      38000 -- [-2408.623] (-2404.984) (-2413.293) (-2411.735) * (-2403.545) (-2404.450) [-2401.407] (-2404.803) -- 0:05:54
      38500 -- [-2409.202] (-2408.251) (-2408.888) (-2407.944) * (-2407.016) (-2402.678) [-2401.717] (-2403.174) -- 0:05:49
      39000 -- (-2411.076) [-2402.753] (-2407.948) (-2403.357) * [-2402.963] (-2404.153) (-2410.241) (-2405.376) -- 0:05:44
      39500 -- (-2404.147) (-2397.680) (-2398.680) [-2408.114] * [-2400.613] (-2403.256) (-2406.391) (-2404.667) -- 0:05:40
      40000 -- [-2400.934] (-2405.834) (-2402.126) (-2406.251) * [-2405.499] (-2413.362) (-2409.718) (-2399.696) -- 0:05:36

      Average standard deviation of split frequencies: 0.027821

      40500 -- [-2402.159] (-2409.312) (-2412.023) (-2400.132) * (-2405.113) (-2409.607) (-2402.095) [-2410.078] -- 0:05:55
      41000 -- (-2407.744) [-2402.913] (-2402.945) (-2405.675) * (-2404.383) (-2403.977) (-2406.640) [-2408.846] -- 0:05:50
      41500 -- (-2407.644) (-2400.165) (-2402.172) [-2405.908] * [-2405.968] (-2406.054) (-2407.246) (-2402.395) -- 0:05:46
      42000 -- (-2410.981) (-2408.744) (-2410.323) [-2399.657] * (-2409.414) (-2406.802) [-2401.824] (-2409.923) -- 0:05:42
      42500 -- (-2402.183) (-2406.837) [-2403.137] (-2403.741) * (-2404.288) (-2410.276) (-2405.700) [-2405.816] -- 0:05:37
      43000 -- (-2405.276) (-2400.584) [-2403.955] (-2406.187) * [-2402.279] (-2402.443) (-2401.314) (-2410.655) -- 0:05:33
      43500 -- (-2400.834) (-2406.426) (-2408.076) [-2401.529] * (-2404.349) (-2399.347) [-2405.591] (-2398.040) -- 0:05:51
      44000 -- (-2405.829) (-2396.385) [-2405.027] (-2402.755) * (-2407.097) (-2403.003) (-2402.934) [-2402.027] -- 0:05:47
      44500 -- (-2403.783) (-2397.997) [-2395.903] (-2404.563) * (-2404.306) (-2407.416) [-2403.860] (-2400.705) -- 0:05:43
      45000 -- (-2410.976) [-2406.083] (-2405.833) (-2401.471) * (-2404.673) [-2403.650] (-2405.823) (-2400.071) -- 0:05:39

      Average standard deviation of split frequencies: 0.024595

      45500 -- (-2402.183) [-2407.897] (-2400.887) (-2404.975) * (-2406.874) [-2403.031] (-2405.569) (-2405.816) -- 0:05:35
      46000 -- (-2402.544) (-2406.426) [-2407.328] (-2410.814) * (-2403.281) (-2399.661) [-2401.821] (-2404.544) -- 0:05:31
      46500 -- (-2403.626) (-2403.481) [-2403.702] (-2405.146) * (-2407.415) [-2404.221] (-2400.515) (-2398.044) -- 0:05:48
      47000 -- (-2403.153) [-2409.726] (-2410.372) (-2403.816) * (-2404.589) (-2402.316) [-2405.556] (-2400.947) -- 0:05:44
      47500 -- [-2399.221] (-2412.369) (-2408.636) (-2402.668) * (-2397.600) (-2399.785) [-2405.366] (-2404.698) -- 0:05:40
      48000 -- (-2403.310) (-2412.713) (-2402.448) [-2400.615] * (-2403.276) [-2399.059] (-2407.912) (-2409.179) -- 0:05:37
      48500 -- (-2401.319) [-2402.668] (-2401.796) (-2409.817) * [-2402.863] (-2407.019) (-2408.653) (-2405.896) -- 0:05:33
      49000 -- (-2399.276) (-2404.075) (-2405.223) [-2404.553] * (-2403.762) (-2407.718) (-2403.653) [-2403.000] -- 0:05:49
      49500 -- (-2402.228) [-2402.052] (-2400.349) (-2397.548) * (-2397.106) (-2400.865) (-2400.478) [-2402.183] -- 0:05:45
      50000 -- [-2404.114] (-2418.693) (-2412.739) (-2408.678) * (-2401.287) (-2408.876) [-2398.673] (-2400.234) -- 0:05:42

      Average standard deviation of split frequencies: 0.026051

      50500 -- [-2400.972] (-2403.652) (-2408.605) (-2407.595) * (-2397.492) (-2407.173) [-2404.344] (-2400.888) -- 0:05:38
      51000 -- (-2397.984) [-2399.460] (-2401.329) (-2404.706) * (-2399.860) [-2399.330] (-2401.203) (-2404.590) -- 0:05:34
      51500 -- (-2400.089) (-2407.021) (-2406.313) [-2410.428] * (-2402.721) [-2401.698] (-2401.017) (-2410.991) -- 0:05:31
      52000 -- (-2399.366) (-2403.566) (-2403.700) [-2403.272] * [-2407.027] (-2401.743) (-2399.553) (-2404.840) -- 0:05:46
      52500 -- (-2405.741) (-2404.596) (-2402.050) [-2402.990] * (-2402.361) (-2401.994) [-2403.179] (-2409.227) -- 0:05:42
      53000 -- [-2400.751] (-2404.982) (-2402.420) (-2406.469) * [-2401.863] (-2399.445) (-2401.349) (-2402.550) -- 0:05:39
      53500 -- (-2404.282) [-2404.671] (-2411.693) (-2408.465) * [-2405.231] (-2405.935) (-2407.949) (-2400.836) -- 0:05:36
      54000 -- (-2399.320) (-2404.492) [-2409.045] (-2408.413) * (-2408.158) [-2400.818] (-2409.245) (-2407.599) -- 0:05:32
      54500 -- (-2406.995) (-2398.730) (-2412.003) [-2404.147] * (-2398.769) (-2401.590) (-2412.897) [-2399.888] -- 0:05:29
      55000 -- (-2404.423) (-2404.314) [-2405.183] (-2405.027) * (-2406.303) (-2403.401) [-2406.883] (-2399.139) -- 0:05:43

      Average standard deviation of split frequencies: 0.033672

      55500 -- (-2406.905) (-2403.691) (-2398.714) [-2399.342] * [-2400.956] (-2399.422) (-2403.952) (-2405.458) -- 0:05:40
      56000 -- (-2402.710) (-2410.071) (-2402.723) [-2403.676] * (-2402.436) (-2398.952) (-2410.615) [-2403.697] -- 0:05:37
      56500 -- (-2407.461) (-2401.137) (-2406.288) [-2406.733] * [-2401.049] (-2405.213) (-2409.824) (-2399.532) -- 0:05:33
      57000 -- (-2408.245) (-2404.122) [-2402.205] (-2405.305) * (-2406.021) (-2405.256) [-2403.662] (-2413.643) -- 0:05:30
      57500 -- (-2412.375) [-2405.444] (-2401.994) (-2406.355) * [-2406.389] (-2406.780) (-2409.870) (-2407.665) -- 0:05:27
      58000 -- [-2401.552] (-2408.393) (-2401.476) (-2407.098) * (-2402.931) (-2404.216) (-2401.308) [-2399.526] -- 0:05:41
      58500 -- (-2404.273) (-2405.551) [-2403.864] (-2408.423) * [-2397.560] (-2409.458) (-2407.560) (-2399.283) -- 0:05:37
      59000 -- (-2403.219) (-2415.211) (-2406.799) [-2399.808] * [-2407.079] (-2399.590) (-2408.073) (-2413.476) -- 0:05:34
      59500 -- (-2399.251) (-2408.142) (-2403.891) [-2404.677] * (-2414.606) (-2401.736) [-2405.370] (-2404.571) -- 0:05:31
      60000 -- [-2405.421] (-2407.693) (-2405.047) (-2409.076) * (-2413.921) [-2409.931] (-2401.023) (-2399.719) -- 0:05:29

      Average standard deviation of split frequencies: 0.024865

      60500 -- (-2402.835) (-2404.478) [-2409.247] (-2406.734) * (-2405.761) (-2401.708) [-2400.752] (-2405.741) -- 0:05:41
      61000 -- [-2400.491] (-2404.135) (-2403.036) (-2407.393) * (-2406.500) (-2400.000) (-2402.741) [-2402.275] -- 0:05:38
      61500 -- (-2410.382) (-2402.091) [-2406.712] (-2399.930) * [-2402.436] (-2407.076) (-2406.575) (-2402.545) -- 0:05:35
      62000 -- (-2406.267) [-2402.288] (-2402.547) (-2398.095) * (-2399.432) (-2409.330) (-2417.941) [-2408.313] -- 0:05:32
      62500 -- (-2399.055) (-2400.073) (-2399.173) [-2399.455] * [-2401.536] (-2403.050) (-2410.010) (-2407.089) -- 0:05:30
      63000 -- (-2399.909) (-2402.921) [-2403.458] (-2407.956) * (-2403.657) [-2401.831] (-2404.384) (-2407.199) -- 0:05:27
      63500 -- [-2401.401] (-2399.822) (-2405.534) (-2406.535) * [-2398.192] (-2407.732) (-2403.980) (-2411.245) -- 0:05:39
      64000 -- (-2403.130) (-2412.379) [-2416.897] (-2403.977) * [-2403.719] (-2399.250) (-2408.898) (-2400.388) -- 0:05:36
      64500 -- (-2411.030) (-2396.061) [-2401.147] (-2397.077) * (-2399.457) (-2403.643) [-2402.633] (-2405.699) -- 0:05:33
      65000 -- (-2403.541) [-2395.861] (-2405.991) (-2398.341) * (-2403.973) (-2410.805) [-2398.384] (-2417.072) -- 0:05:30

      Average standard deviation of split frequencies: 0.025713

      65500 -- (-2403.268) (-2401.578) (-2401.929) [-2400.311] * (-2399.803) (-2404.329) [-2399.742] (-2404.256) -- 0:05:28
      66000 -- [-2404.643] (-2400.622) (-2404.841) (-2402.243) * (-2406.410) (-2407.964) [-2401.702] (-2408.890) -- 0:05:25
      66500 -- (-2407.060) (-2400.883) (-2404.221) [-2398.489] * [-2400.245] (-2411.421) (-2405.983) (-2409.260) -- 0:05:36
      67000 -- (-2409.278) (-2406.014) [-2400.423] (-2400.715) * [-2402.732] (-2411.143) (-2403.756) (-2412.366) -- 0:05:34
      67500 -- [-2401.308] (-2397.718) (-2421.688) (-2405.461) * (-2402.705) (-2412.599) [-2406.427] (-2411.824) -- 0:05:31
      68000 -- [-2406.271] (-2399.322) (-2405.152) (-2410.889) * (-2411.675) (-2411.388) [-2402.602] (-2410.413) -- 0:05:28
      68500 -- (-2406.024) (-2399.568) [-2404.877] (-2402.033) * (-2404.753) (-2399.653) [-2402.624] (-2402.916) -- 0:05:26
      69000 -- (-2402.867) [-2398.749] (-2404.545) (-2407.645) * [-2405.864] (-2404.350) (-2401.177) (-2410.253) -- 0:05:37
      69500 -- (-2399.499) (-2401.061) [-2399.896] (-2399.814) * (-2405.558) (-2406.611) (-2406.389) [-2405.959] -- 0:05:34
      70000 -- (-2403.255) (-2410.567) [-2405.052] (-2399.436) * (-2408.103) (-2404.662) (-2401.540) [-2407.276] -- 0:05:32

      Average standard deviation of split frequencies: 0.025349

      70500 -- (-2403.447) [-2410.743] (-2408.370) (-2406.894) * (-2397.682) (-2406.176) (-2400.932) [-2401.144] -- 0:05:29
      71000 -- (-2401.199) (-2401.761) [-2405.894] (-2412.873) * (-2410.107) (-2404.590) [-2398.611] (-2402.558) -- 0:05:27
      71500 -- (-2407.826) (-2402.036) [-2410.107] (-2408.913) * (-2409.167) (-2409.999) (-2401.779) [-2400.297] -- 0:05:24
      72000 -- [-2399.301] (-2400.381) (-2401.663) (-2403.746) * (-2403.517) (-2404.624) [-2403.878] (-2410.172) -- 0:05:35
      72500 -- [-2405.923] (-2407.908) (-2403.719) (-2406.614) * (-2405.376) [-2399.526] (-2412.685) (-2400.692) -- 0:05:32
      73000 -- (-2406.856) (-2398.031) [-2407.013] (-2399.681) * (-2405.816) [-2401.558] (-2404.387) (-2400.665) -- 0:05:30
      73500 -- [-2403.017] (-2399.301) (-2400.584) (-2401.710) * (-2403.495) (-2403.786) (-2399.942) [-2401.901] -- 0:05:27
      74000 -- (-2404.985) (-2406.540) [-2402.195] (-2402.111) * (-2397.963) (-2405.523) (-2401.347) [-2407.800] -- 0:05:25
      74500 -- (-2407.530) (-2412.414) (-2404.157) [-2403.268] * [-2397.961] (-2402.484) (-2402.136) (-2401.812) -- 0:05:22
      75000 -- [-2400.153] (-2409.426) (-2403.085) (-2408.529) * [-2403.871] (-2404.607) (-2401.236) (-2402.409) -- 0:05:33

      Average standard deviation of split frequencies: 0.028532

      75500 -- (-2403.563) [-2406.912] (-2403.306) (-2410.911) * [-2401.426] (-2401.964) (-2401.530) (-2401.747) -- 0:05:30
      76000 -- (-2411.916) (-2405.061) [-2401.812] (-2409.317) * (-2405.795) (-2401.754) (-2404.299) [-2407.209] -- 0:05:28
      76500 -- [-2400.464] (-2399.188) (-2399.739) (-2413.003) * (-2403.224) (-2405.353) (-2404.103) [-2410.234] -- 0:05:25
      77000 -- (-2400.029) [-2403.149] (-2403.929) (-2405.158) * (-2409.426) [-2398.048] (-2401.913) (-2405.220) -- 0:05:23
      77500 -- [-2402.896] (-2405.277) (-2407.251) (-2405.604) * (-2402.492) (-2399.346) [-2407.082] (-2406.403) -- 0:05:21
      78000 -- [-2397.661] (-2403.700) (-2398.999) (-2406.336) * (-2402.807) [-2401.178] (-2402.144) (-2403.404) -- 0:05:30
      78500 -- (-2410.497) [-2401.869] (-2399.085) (-2399.714) * (-2400.004) [-2400.133] (-2406.006) (-2403.706) -- 0:05:28
      79000 -- (-2399.188) [-2403.230] (-2404.436) (-2405.741) * (-2406.022) [-2404.382] (-2401.230) (-2404.491) -- 0:05:26
      79500 -- (-2405.982) (-2408.660) [-2401.582] (-2401.936) * [-2401.074] (-2397.547) (-2400.893) (-2403.903) -- 0:05:24
      80000 -- (-2413.413) (-2395.873) (-2399.030) [-2405.059] * (-2405.021) [-2398.780] (-2400.717) (-2401.487) -- 0:05:22

      Average standard deviation of split frequencies: 0.024544

      80500 -- (-2410.657) [-2403.366] (-2410.233) (-2405.451) * (-2404.929) (-2402.482) (-2406.768) [-2400.470] -- 0:05:31
      81000 -- (-2411.333) (-2402.409) [-2404.547] (-2405.433) * [-2404.708] (-2401.714) (-2400.652) (-2398.433) -- 0:05:29
      81500 -- [-2408.159] (-2409.961) (-2405.868) (-2403.853) * (-2410.038) (-2405.141) (-2409.142) [-2402.233] -- 0:05:26
      82000 -- (-2410.490) [-2402.057] (-2411.962) (-2398.809) * [-2406.463] (-2401.515) (-2405.103) (-2408.874) -- 0:05:24
      82500 -- [-2400.012] (-2401.798) (-2403.665) (-2411.175) * (-2410.678) [-2404.240] (-2410.983) (-2415.865) -- 0:05:22
      83000 -- (-2407.537) [-2397.759] (-2408.307) (-2398.125) * [-2401.712] (-2408.205) (-2402.990) (-2402.470) -- 0:05:20
      83500 -- (-2410.328) (-2401.239) (-2400.593) [-2401.880] * (-2407.220) (-2407.464) [-2407.694] (-2396.191) -- 0:05:29
      84000 -- (-2412.292) (-2402.423) (-2403.948) [-2404.295] * (-2407.358) [-2404.644] (-2405.742) (-2400.663) -- 0:05:27
      84500 -- (-2404.608) [-2403.826] (-2403.554) (-2405.005) * (-2410.628) (-2405.960) [-2398.703] (-2402.237) -- 0:05:25
      85000 -- (-2415.841) (-2405.711) [-2401.922] (-2405.996) * (-2402.461) (-2398.909) [-2399.572] (-2405.379) -- 0:05:22

      Average standard deviation of split frequencies: 0.029600

      85500 -- [-2407.373] (-2404.249) (-2401.458) (-2408.210) * [-2404.796] (-2403.374) (-2400.203) (-2401.606) -- 0:05:20
      86000 -- [-2407.226] (-2401.467) (-2395.884) (-2403.448) * (-2411.854) (-2401.398) (-2403.664) [-2402.224] -- 0:05:18
      86500 -- [-2407.573] (-2401.200) (-2399.636) (-2409.643) * (-2412.491) (-2403.518) (-2405.215) [-2404.735] -- 0:05:27
      87000 -- (-2399.554) [-2401.651] (-2399.851) (-2406.261) * (-2400.369) [-2405.007] (-2411.233) (-2401.600) -- 0:05:25
      87500 -- (-2405.293) [-2400.636] (-2403.018) (-2406.431) * [-2398.768] (-2400.898) (-2401.876) (-2405.074) -- 0:05:23
      88000 -- (-2406.224) (-2405.324) [-2400.910] (-2408.943) * (-2400.417) (-2405.092) [-2409.125] (-2402.532) -- 0:05:21
      88500 -- (-2403.222) (-2410.495) (-2396.018) [-2397.416] * (-2399.436) [-2403.329] (-2401.539) (-2408.222) -- 0:05:19
      89000 -- (-2420.319) [-2402.978] (-2402.085) (-2398.328) * [-2405.081] (-2402.865) (-2403.450) (-2396.665) -- 0:05:27
      89500 -- (-2400.006) [-2398.030] (-2398.277) (-2403.287) * (-2405.883) (-2402.359) (-2400.937) [-2398.532] -- 0:05:25
      90000 -- (-2400.358) (-2397.496) [-2397.315] (-2405.506) * (-2404.824) (-2404.466) [-2409.548] (-2405.222) -- 0:05:23

      Average standard deviation of split frequencies: 0.028076

      90500 -- (-2414.230) (-2403.771) (-2396.589) [-2403.029] * (-2416.048) (-2401.596) [-2401.647] (-2398.392) -- 0:05:21
      91000 -- (-2402.148) (-2401.716) (-2402.078) [-2400.274] * (-2401.442) [-2405.245] (-2404.890) (-2409.382) -- 0:05:19
      91500 -- (-2399.698) [-2401.448] (-2403.394) (-2398.965) * (-2407.496) (-2403.835) (-2400.852) [-2405.225] -- 0:05:17
      92000 -- (-2406.849) (-2400.716) [-2402.824] (-2405.881) * (-2406.262) [-2405.770] (-2399.211) (-2397.214) -- 0:05:25
      92500 -- [-2403.818] (-2410.028) (-2405.246) (-2406.516) * (-2410.676) (-2401.430) [-2397.123] (-2403.592) -- 0:05:23
      93000 -- (-2405.292) [-2399.036] (-2403.737) (-2410.114) * (-2413.494) [-2404.158] (-2413.681) (-2410.345) -- 0:05:21
      93500 -- (-2407.176) [-2401.735] (-2400.593) (-2401.041) * (-2404.290) (-2400.689) (-2404.568) [-2402.197] -- 0:05:19
      94000 -- (-2408.494) (-2399.491) [-2408.093] (-2402.335) * (-2403.323) [-2405.179] (-2404.910) (-2400.452) -- 0:05:18
      94500 -- (-2423.668) (-2405.806) (-2400.109) [-2403.582] * [-2401.206] (-2407.862) (-2399.963) (-2406.663) -- 0:05:16
      95000 -- (-2406.279) (-2398.743) (-2399.320) [-2405.845] * (-2405.038) (-2407.497) [-2403.868] (-2402.643) -- 0:05:23

      Average standard deviation of split frequencies: 0.026517

      95500 -- (-2403.205) [-2400.548] (-2400.460) (-2402.191) * (-2407.870) (-2411.322) (-2404.672) [-2403.419] -- 0:05:22
      96000 -- (-2415.945) [-2403.506] (-2399.672) (-2401.700) * [-2398.366] (-2403.822) (-2406.934) (-2403.474) -- 0:05:20
      96500 -- (-2402.424) (-2402.396) [-2401.948] (-2413.334) * (-2402.705) [-2405.871] (-2415.359) (-2400.536) -- 0:05:18
      97000 -- [-2402.852] (-2406.075) (-2401.529) (-2403.272) * (-2403.562) [-2408.231] (-2400.803) (-2407.238) -- 0:05:16
      97500 -- (-2405.781) (-2404.756) [-2407.704] (-2398.813) * [-2402.328] (-2398.282) (-2404.034) (-2410.997) -- 0:05:14
      98000 -- (-2409.138) [-2400.242] (-2401.620) (-2406.141) * (-2406.968) (-2399.940) (-2406.754) [-2406.337] -- 0:05:22
      98500 -- (-2409.197) (-2399.448) (-2402.321) [-2403.475] * (-2407.679) [-2407.398] (-2402.058) (-2400.964) -- 0:05:20
      99000 -- (-2403.343) [-2402.927] (-2405.816) (-2404.102) * [-2399.340] (-2407.213) (-2401.279) (-2404.704) -- 0:05:18
      99500 -- (-2406.706) [-2402.723] (-2399.070) (-2404.880) * (-2405.402) (-2404.762) [-2403.938] (-2403.352) -- 0:05:16
      100000 -- (-2404.412) [-2402.318] (-2401.330) (-2402.631) * (-2410.862) (-2400.053) [-2400.245] (-2406.485) -- 0:05:15

      Average standard deviation of split frequencies: 0.032780

      100500 -- [-2407.434] (-2403.228) (-2402.991) (-2400.256) * (-2402.966) [-2405.599] (-2403.925) (-2409.729) -- 0:05:22
      101000 -- (-2407.134) [-2402.833] (-2408.545) (-2407.689) * (-2400.375) [-2402.923] (-2405.118) (-2407.457) -- 0:05:20
      101500 -- (-2409.243) (-2410.738) (-2407.469) [-2400.943] * [-2402.465] (-2405.693) (-2405.825) (-2407.125) -- 0:05:18
      102000 -- (-2403.304) (-2407.749) (-2407.133) [-2396.678] * [-2403.266] (-2405.651) (-2401.032) (-2401.972) -- 0:05:16
      102500 -- (-2402.301) (-2405.647) [-2404.459] (-2402.700) * (-2408.032) [-2404.186] (-2406.126) (-2409.705) -- 0:05:15
      103000 -- (-2404.093) (-2411.444) [-2399.491] (-2402.087) * (-2406.146) (-2401.334) (-2404.188) [-2406.398] -- 0:05:13
      103500 -- (-2402.901) [-2408.261] (-2401.262) (-2406.210) * (-2406.171) (-2403.277) [-2407.494] (-2407.302) -- 0:05:20
      104000 -- [-2405.425] (-2400.510) (-2399.546) (-2410.667) * [-2401.379] (-2396.430) (-2412.329) (-2406.363) -- 0:05:18
      104500 -- (-2405.806) [-2403.748] (-2409.460) (-2403.461) * (-2402.764) (-2399.655) [-2402.418] (-2400.064) -- 0:05:17
      105000 -- (-2401.910) [-2405.042] (-2410.760) (-2402.152) * (-2395.721) (-2411.095) (-2403.929) [-2399.964] -- 0:05:15

      Average standard deviation of split frequencies: 0.032020

      105500 -- (-2408.879) (-2410.178) (-2405.391) [-2403.807] * (-2403.738) [-2404.156] (-2398.586) (-2405.635) -- 0:05:13
      106000 -- [-2399.786] (-2414.610) (-2407.524) (-2403.203) * (-2404.147) [-2401.759] (-2405.752) (-2411.400) -- 0:05:12
      106500 -- [-2407.251] (-2403.681) (-2397.322) (-2399.981) * (-2409.959) [-2398.857] (-2400.714) (-2394.451) -- 0:05:18
      107000 -- (-2408.480) [-2403.086] (-2403.030) (-2406.459) * (-2403.208) [-2398.815] (-2402.796) (-2403.340) -- 0:05:17
      107500 -- (-2402.960) [-2401.133] (-2402.061) (-2411.636) * (-2407.210) (-2402.696) [-2405.291] (-2405.353) -- 0:05:15
      108000 -- [-2405.310] (-2405.415) (-2406.009) (-2399.858) * (-2405.175) (-2402.844) [-2405.917] (-2406.460) -- 0:05:13
      108500 -- (-2411.421) [-2402.751] (-2417.533) (-2404.525) * (-2407.561) (-2400.250) [-2401.666] (-2410.611) -- 0:05:12
      109000 -- (-2400.374) (-2401.090) [-2407.500] (-2401.777) * (-2406.517) (-2401.823) (-2406.817) [-2398.966] -- 0:05:10
      109500 -- (-2405.946) (-2404.907) (-2403.789) [-2401.284] * (-2402.850) (-2401.245) (-2402.627) [-2404.135] -- 0:05:17
      110000 -- (-2407.384) [-2405.781] (-2400.679) (-2403.489) * [-2402.149] (-2402.894) (-2396.340) (-2399.972) -- 0:05:15

      Average standard deviation of split frequencies: 0.030670

      110500 -- (-2401.748) (-2403.863) [-2403.199] (-2404.842) * [-2399.724] (-2400.590) (-2402.796) (-2401.766) -- 0:05:13
      111000 -- (-2402.151) (-2402.880) (-2402.740) [-2401.730] * (-2408.008) [-2401.247] (-2406.878) (-2410.585) -- 0:05:12
      111500 -- [-2396.816] (-2402.787) (-2398.498) (-2403.170) * (-2405.373) (-2414.472) (-2401.058) [-2404.716] -- 0:05:10
      112000 -- (-2398.543) (-2406.416) [-2399.669] (-2405.849) * (-2404.846) (-2405.023) (-2407.110) [-2402.041] -- 0:05:17
      112500 -- (-2406.461) [-2404.793] (-2403.142) (-2403.524) * (-2402.648) [-2400.618] (-2409.099) (-2409.040) -- 0:05:15
      113000 -- [-2406.822] (-2401.141) (-2401.239) (-2411.289) * (-2402.576) (-2400.856) (-2401.755) [-2404.159] -- 0:05:13
      113500 -- (-2403.152) (-2407.269) [-2404.679] (-2402.514) * (-2394.401) [-2402.189] (-2411.904) (-2408.373) -- 0:05:12
      114000 -- (-2402.552) (-2401.836) (-2404.800) [-2399.083] * [-2401.438] (-2400.536) (-2405.912) (-2411.726) -- 0:05:10
      114500 -- (-2398.500) (-2403.805) (-2398.437) [-2401.714] * (-2400.399) (-2400.853) (-2404.323) [-2407.514] -- 0:05:09
      115000 -- (-2411.483) (-2401.240) [-2395.246] (-2403.434) * (-2399.775) (-2401.674) [-2396.963] (-2405.173) -- 0:05:15

      Average standard deviation of split frequencies: 0.026009

      115500 -- (-2409.293) (-2402.507) [-2403.729] (-2401.421) * (-2409.523) [-2399.629] (-2400.632) (-2403.302) -- 0:05:13
      116000 -- (-2418.787) (-2404.105) [-2402.067] (-2408.381) * (-2406.090) [-2403.331] (-2411.973) (-2401.753) -- 0:05:12
      116500 -- (-2404.328) (-2398.360) (-2402.699) [-2406.065] * (-2416.906) (-2405.482) [-2404.136] (-2399.784) -- 0:05:10
      117000 -- (-2413.756) (-2410.728) [-2403.738] (-2402.260) * (-2411.948) (-2398.615) (-2401.730) [-2405.351] -- 0:05:09
      117500 -- (-2406.492) [-2405.343] (-2395.307) (-2402.813) * (-2412.133) (-2403.769) [-2398.112] (-2405.598) -- 0:05:15
      118000 -- (-2403.592) [-2402.562] (-2399.810) (-2399.873) * (-2404.561) [-2399.640] (-2395.947) (-2413.797) -- 0:05:13
      118500 -- (-2406.497) [-2399.236] (-2404.958) (-2398.698) * (-2401.099) [-2408.365] (-2405.773) (-2407.320) -- 0:05:12
      119000 -- (-2406.031) (-2408.491) [-2399.642] (-2405.507) * (-2401.877) (-2414.633) [-2402.416] (-2401.318) -- 0:05:10
      119500 -- (-2405.835) (-2403.488) [-2401.895] (-2406.630) * (-2407.415) (-2416.788) (-2404.753) [-2407.415] -- 0:05:09
      120000 -- [-2402.298] (-2416.145) (-2408.789) (-2408.857) * (-2403.379) (-2404.877) (-2397.535) [-2404.077] -- 0:05:08

      Average standard deviation of split frequencies: 0.025003

      120500 -- [-2407.094] (-2400.319) (-2399.964) (-2398.546) * (-2413.277) [-2405.145] (-2401.274) (-2402.712) -- 0:05:13
      121000 -- (-2403.016) [-2403.133] (-2405.259) (-2406.157) * (-2402.730) [-2404.147] (-2406.264) (-2400.124) -- 0:05:12
      121500 -- (-2400.922) [-2398.509] (-2403.932) (-2408.601) * (-2403.586) (-2405.890) [-2400.677] (-2400.809) -- 0:05:10
      122000 -- (-2404.879) (-2399.531) [-2402.731] (-2401.484) * [-2406.274] (-2414.161) (-2407.010) (-2408.122) -- 0:05:09
      122500 -- (-2397.019) [-2400.251] (-2406.341) (-2403.686) * (-2404.643) (-2409.193) (-2408.269) [-2405.587] -- 0:05:08
      123000 -- (-2399.815) [-2398.533] (-2403.766) (-2405.679) * (-2402.660) [-2405.933] (-2401.270) (-2401.492) -- 0:05:06
      123500 -- (-2398.970) [-2398.908] (-2403.003) (-2404.262) * (-2416.424) (-2409.008) (-2401.655) [-2399.866] -- 0:05:12
      124000 -- (-2402.620) (-2400.189) (-2397.640) [-2401.108] * [-2406.998] (-2404.502) (-2399.250) (-2403.517) -- 0:05:10
      124500 -- (-2405.141) (-2403.507) [-2404.587] (-2404.055) * (-2410.784) (-2404.348) (-2400.862) [-2397.815] -- 0:05:09
      125000 -- (-2409.708) (-2397.195) [-2402.094] (-2417.523) * (-2409.006) (-2412.906) [-2407.433] (-2404.316) -- 0:05:08

      Average standard deviation of split frequencies: 0.011972

      125500 -- (-2402.732) [-2404.866] (-2406.146) (-2405.858) * [-2405.931] (-2407.702) (-2401.735) (-2408.227) -- 0:05:06
      126000 -- (-2397.217) [-2399.577] (-2408.557) (-2405.174) * (-2407.768) (-2404.304) (-2404.127) [-2405.284] -- 0:05:12
      126500 -- (-2402.897) [-2407.570] (-2404.431) (-2400.563) * [-2410.956] (-2413.632) (-2405.299) (-2405.484) -- 0:05:10
      127000 -- [-2405.995] (-2403.662) (-2400.524) (-2407.908) * (-2400.789) [-2404.643] (-2397.388) (-2402.445) -- 0:05:09
      127500 -- (-2408.222) (-2415.398) (-2404.611) [-2408.739] * (-2404.218) (-2407.386) (-2403.965) [-2417.593] -- 0:05:07
      128000 -- (-2399.508) [-2400.744] (-2405.358) (-2400.706) * (-2406.734) [-2405.501] (-2405.125) (-2411.780) -- 0:05:06
      128500 -- (-2405.096) (-2407.339) [-2405.959] (-2401.992) * [-2398.724] (-2406.760) (-2402.240) (-2403.828) -- 0:05:05
      129000 -- (-2403.876) (-2402.359) (-2405.412) [-2399.678] * (-2402.693) [-2397.892] (-2406.885) (-2410.399) -- 0:05:10
      129500 -- [-2399.078] (-2406.241) (-2407.657) (-2399.603) * (-2399.827) (-2399.942) (-2402.133) [-2407.254] -- 0:05:09
      130000 -- (-2405.246) (-2401.104) (-2402.590) [-2401.632] * (-2414.081) (-2399.841) [-2404.518] (-2405.631) -- 0:05:07

      Average standard deviation of split frequencies: 0.008658

      130500 -- (-2400.182) (-2400.292) (-2401.045) [-2400.721] * [-2406.578] (-2399.892) (-2403.499) (-2402.946) -- 0:05:06
      131000 -- (-2404.432) [-2404.768] (-2400.732) (-2408.608) * (-2406.541) (-2402.093) (-2403.853) [-2397.339] -- 0:05:05
      131500 -- [-2411.183] (-2403.843) (-2407.014) (-2405.170) * (-2409.567) (-2405.218) [-2396.072] (-2398.516) -- 0:05:03
      132000 -- (-2405.042) [-2401.263] (-2403.176) (-2405.092) * (-2404.227) [-2403.857] (-2397.359) (-2409.684) -- 0:05:09
      132500 -- (-2407.876) [-2402.919] (-2402.151) (-2411.001) * (-2408.504) (-2411.659) [-2403.308] (-2404.158) -- 0:05:07
      133000 -- (-2412.313) (-2398.251) [-2400.137] (-2407.019) * (-2401.254) [-2403.774] (-2406.759) (-2406.130) -- 0:05:06
      133500 -- (-2402.400) [-2403.893] (-2402.259) (-2404.382) * [-2401.235] (-2402.622) (-2411.800) (-2403.660) -- 0:05:05
      134000 -- (-2400.350) (-2403.904) [-2402.071] (-2414.851) * (-2408.790) [-2406.728] (-2410.978) (-2412.504) -- 0:05:03
      134500 -- (-2401.693) (-2405.843) [-2401.176] (-2401.761) * (-2414.022) (-2405.898) [-2407.756] (-2401.606) -- 0:05:08
      135000 -- [-2411.958] (-2402.619) (-2408.147) (-2401.556) * (-2415.781) (-2399.890) [-2401.866] (-2407.080) -- 0:05:07

      Average standard deviation of split frequencies: 0.009705

      135500 -- (-2403.277) [-2407.290] (-2402.421) (-2403.986) * (-2411.666) (-2402.644) [-2400.923] (-2415.007) -- 0:05:06
      136000 -- [-2404.883] (-2407.702) (-2404.552) (-2405.657) * (-2404.615) (-2406.906) [-2403.613] (-2408.716) -- 0:05:04
      136500 -- [-2397.834] (-2405.717) (-2399.389) (-2404.669) * (-2409.021) (-2406.231) [-2403.623] (-2405.019) -- 0:05:03
      137000 -- (-2405.048) [-2403.077] (-2399.899) (-2403.550) * (-2407.898) (-2407.309) (-2409.830) [-2403.185] -- 0:05:02
      137500 -- [-2405.336] (-2405.981) (-2403.856) (-2406.048) * (-2409.564) (-2406.608) (-2407.396) [-2399.475] -- 0:05:07
      138000 -- (-2402.244) [-2406.618] (-2399.090) (-2397.211) * (-2402.637) (-2398.851) (-2404.974) [-2400.898] -- 0:05:06
      138500 -- (-2402.207) [-2404.151] (-2404.119) (-2400.492) * (-2404.475) (-2404.358) [-2402.424] (-2405.980) -- 0:05:04
      139000 -- [-2402.014] (-2404.378) (-2400.321) (-2405.567) * [-2406.203] (-2401.724) (-2400.170) (-2399.108) -- 0:05:03
      139500 -- (-2404.007) [-2397.675] (-2400.939) (-2413.085) * (-2402.435) [-2400.087] (-2400.548) (-2396.283) -- 0:05:02
      140000 -- (-2402.503) [-2401.952] (-2397.798) (-2406.025) * (-2404.449) (-2408.000) (-2407.593) [-2403.348] -- 0:05:01

      Average standard deviation of split frequencies: 0.012064

      140500 -- [-2402.906] (-2410.669) (-2404.212) (-2403.436) * (-2403.389) (-2409.108) [-2403.838] (-2408.387) -- 0:05:05
      141000 -- [-2409.124] (-2422.769) (-2406.621) (-2408.459) * (-2402.752) (-2402.205) [-2402.764] (-2400.716) -- 0:05:04
      141500 -- (-2409.154) [-2408.424] (-2410.580) (-2404.293) * (-2406.615) (-2402.241) [-2399.274] (-2407.506) -- 0:05:03
      142000 -- (-2404.435) (-2405.555) [-2408.288] (-2403.704) * [-2399.897] (-2403.679) (-2403.695) (-2401.554) -- 0:05:02
      142500 -- [-2405.017] (-2404.291) (-2406.199) (-2399.677) * (-2407.736) (-2401.673) [-2403.617] (-2401.606) -- 0:05:00
      143000 -- [-2403.437] (-2402.966) (-2402.127) (-2404.231) * (-2412.411) (-2402.233) [-2398.254] (-2407.544) -- 0:04:59
      143500 -- (-2402.038) (-2406.504) (-2404.792) [-2404.500] * (-2411.905) (-2407.165) (-2402.634) [-2411.605] -- 0:05:04
      144000 -- (-2402.343) (-2404.525) (-2397.313) [-2401.673] * (-2402.437) [-2405.906] (-2406.677) (-2405.124) -- 0:05:03
      144500 -- [-2407.272] (-2407.208) (-2399.282) (-2402.970) * (-2409.721) [-2410.384] (-2412.313) (-2407.437) -- 0:05:01
      145000 -- (-2404.855) (-2400.688) (-2408.905) [-2400.423] * (-2406.105) (-2416.064) [-2405.391] (-2410.127) -- 0:05:00

      Average standard deviation of split frequencies: 0.011624

      145500 -- (-2404.878) (-2405.634) [-2405.735] (-2410.193) * (-2401.887) [-2403.470] (-2407.346) (-2401.363) -- 0:04:59
      146000 -- (-2415.060) (-2405.225) [-2402.290] (-2408.271) * (-2403.892) [-2404.318] (-2404.195) (-2406.398) -- 0:05:04
      146500 -- (-2407.604) (-2407.732) [-2396.983] (-2404.610) * (-2398.552) (-2408.939) (-2413.176) [-2401.257] -- 0:05:02
      147000 -- (-2402.437) (-2404.919) [-2399.782] (-2404.741) * (-2404.791) [-2403.902] (-2406.015) (-2401.845) -- 0:05:01
      147500 -- (-2402.035) (-2407.578) [-2400.195] (-2398.739) * (-2401.110) [-2406.996] (-2408.185) (-2398.011) -- 0:05:00
      148000 -- [-2402.284] (-2403.512) (-2401.111) (-2411.993) * (-2401.246) (-2400.188) (-2402.860) [-2397.436] -- 0:04:59
      148500 -- (-2400.470) (-2402.865) (-2402.618) [-2398.886] * (-2398.814) (-2402.286) (-2407.584) [-2404.073] -- 0:04:58
      149000 -- (-2408.482) [-2403.948] (-2406.042) (-2402.354) * (-2405.156) [-2402.122] (-2405.960) (-2409.847) -- 0:05:02
      149500 -- (-2405.598) [-2403.451] (-2407.409) (-2402.978) * (-2409.121) (-2406.375) (-2408.838) [-2408.465] -- 0:05:01
      150000 -- [-2400.097] (-2407.530) (-2406.171) (-2406.485) * [-2400.693] (-2406.583) (-2407.729) (-2406.665) -- 0:05:00

      Average standard deviation of split frequencies: 0.005006

      150500 -- (-2409.411) [-2405.074] (-2401.385) (-2402.379) * (-2412.835) (-2402.738) [-2402.054] (-2401.034) -- 0:04:59
      151000 -- [-2404.731] (-2401.250) (-2406.484) (-2402.070) * [-2404.956] (-2404.500) (-2409.935) (-2410.113) -- 0:04:57
      151500 -- [-2399.947] (-2412.854) (-2400.489) (-2397.660) * (-2407.235) [-2399.032] (-2413.305) (-2407.977) -- 0:04:56
      152000 -- (-2403.000) (-2405.644) [-2404.163] (-2399.364) * (-2404.769) [-2396.031] (-2405.728) (-2402.697) -- 0:05:01
      152500 -- (-2401.868) [-2400.912] (-2411.498) (-2403.729) * [-2402.465] (-2408.398) (-2406.684) (-2405.731) -- 0:05:00
      153000 -- (-2413.338) (-2403.223) (-2401.627) [-2407.608] * (-2404.045) [-2402.173] (-2407.220) (-2403.349) -- 0:04:58
      153500 -- (-2405.223) (-2409.720) [-2401.087] (-2409.621) * [-2400.157] (-2407.572) (-2407.238) (-2408.277) -- 0:04:57
      154000 -- [-2403.987] (-2406.362) (-2403.030) (-2404.488) * (-2401.660) [-2403.773] (-2405.730) (-2403.808) -- 0:04:56
      154500 -- (-2408.988) (-2400.758) [-2402.192] (-2406.526) * (-2408.984) [-2406.565] (-2410.883) (-2399.291) -- 0:04:55
      155000 -- (-2404.646) [-2400.633] (-2403.566) (-2402.494) * (-2411.054) (-2410.667) (-2402.092) [-2396.824] -- 0:04:59

      Average standard deviation of split frequencies: 0.003626

      155500 -- (-2405.603) (-2400.138) [-2399.431] (-2399.416) * (-2402.294) [-2401.075] (-2406.131) (-2400.700) -- 0:04:58
      156000 -- (-2403.392) (-2406.883) [-2403.903] (-2400.602) * (-2402.245) (-2407.215) [-2407.935] (-2401.356) -- 0:04:57
      156500 -- [-2399.698] (-2404.685) (-2418.391) (-2405.460) * (-2405.888) [-2405.136] (-2408.115) (-2404.595) -- 0:04:56
      157000 -- (-2420.810) [-2401.785] (-2410.918) (-2402.725) * (-2404.483) [-2396.028] (-2400.489) (-2400.865) -- 0:04:55
      157500 -- (-2402.152) [-2402.207] (-2410.217) (-2405.589) * (-2407.765) (-2397.944) [-2404.809] (-2405.029) -- 0:04:59
      158000 -- (-2397.907) [-2402.448] (-2403.832) (-2403.621) * (-2405.850) [-2399.231] (-2399.179) (-2406.935) -- 0:04:58
      158500 -- (-2399.793) [-2401.983] (-2402.746) (-2414.850) * (-2401.394) (-2401.119) [-2402.127] (-2408.627) -- 0:04:57
      159000 -- (-2400.874) (-2403.440) [-2405.420] (-2401.109) * (-2404.324) (-2401.128) (-2405.718) [-2411.924] -- 0:04:56
      159500 -- (-2407.693) [-2401.947] (-2409.530) (-2414.491) * (-2399.182) (-2404.597) (-2409.683) [-2402.891] -- 0:04:55
      160000 -- (-2409.950) (-2397.171) (-2403.475) [-2407.534] * (-2398.922) [-2399.920] (-2405.774) (-2419.248) -- 0:04:54

      Average standard deviation of split frequencies: 0.001174

      160500 -- (-2408.408) [-2401.691] (-2410.237) (-2403.466) * (-2400.700) (-2403.385) [-2401.486] (-2400.640) -- 0:04:58
      161000 -- (-2403.447) (-2401.723) [-2400.038] (-2401.199) * (-2405.799) [-2399.995] (-2406.218) (-2404.080) -- 0:04:57
      161500 -- (-2407.288) (-2401.751) (-2405.266) [-2400.999] * (-2405.492) [-2399.995] (-2412.642) (-2403.734) -- 0:04:55
      162000 -- (-2400.341) [-2397.766] (-2403.705) (-2407.142) * [-2410.434] (-2400.971) (-2403.417) (-2409.447) -- 0:04:54
      162500 -- (-2399.788) (-2397.862) [-2402.256] (-2406.497) * (-2402.532) (-2406.486) (-2406.786) [-2408.340] -- 0:04:53
      163000 -- (-2403.746) [-2404.936] (-2404.611) (-2402.190) * (-2400.792) [-2397.248] (-2408.588) (-2404.435) -- 0:04:52
      163500 -- [-2401.335] (-2402.884) (-2403.837) (-2409.334) * [-2403.303] (-2397.916) (-2416.933) (-2403.788) -- 0:04:56
      164000 -- (-2410.201) (-2408.423) [-2406.162] (-2410.038) * (-2399.906) [-2409.766] (-2406.304) (-2399.228) -- 0:04:55
      164500 -- [-2405.772] (-2407.691) (-2397.520) (-2407.961) * [-2399.247] (-2402.817) (-2405.978) (-2404.411) -- 0:04:54
      165000 -- [-2411.596] (-2403.861) (-2405.372) (-2398.136) * [-2403.574] (-2400.565) (-2400.488) (-2401.256) -- 0:04:53

      Average standard deviation of split frequencies: 0.003408

      165500 -- [-2405.608] (-2411.837) (-2403.787) (-2402.181) * [-2401.175] (-2398.668) (-2413.165) (-2404.990) -- 0:04:52
      166000 -- (-2403.594) [-2399.674] (-2401.251) (-2392.938) * (-2400.071) (-2407.892) (-2410.358) [-2397.431] -- 0:04:56
      166500 -- (-2407.905) (-2398.012) (-2403.298) [-2402.811] * [-2401.379] (-2402.749) (-2412.210) (-2402.278) -- 0:04:55
      167000 -- (-2405.424) (-2404.146) (-2398.276) [-2401.595] * (-2400.653) (-2404.890) (-2409.400) [-2400.303] -- 0:04:54
      167500 -- (-2401.927) [-2400.855] (-2400.023) (-2406.591) * [-2409.087] (-2399.737) (-2410.552) (-2409.064) -- 0:04:53
      168000 -- (-2406.847) [-2402.628] (-2416.760) (-2403.998) * (-2403.315) [-2402.220] (-2410.242) (-2404.650) -- 0:04:52
      168500 -- (-2407.190) [-2405.579] (-2407.694) (-2398.737) * (-2399.486) (-2403.190) (-2409.244) [-2401.831] -- 0:04:51
      169000 -- (-2396.497) (-2408.152) [-2399.779] (-2403.414) * [-2399.907] (-2409.482) (-2406.690) (-2409.193) -- 0:04:55
      169500 -- (-2405.168) (-2400.360) (-2404.396) [-2400.292] * [-2406.353] (-2410.165) (-2408.775) (-2402.124) -- 0:04:53
      170000 -- (-2403.311) [-2400.470] (-2403.893) (-2407.144) * (-2405.335) (-2406.805) (-2408.027) [-2400.632] -- 0:04:52

      Average standard deviation of split frequencies: 0.004419

      170500 -- (-2402.407) [-2400.017] (-2400.116) (-2403.528) * (-2408.455) (-2410.068) (-2408.401) [-2404.529] -- 0:04:51
      171000 -- [-2397.459] (-2406.820) (-2405.294) (-2409.592) * (-2407.476) (-2414.939) (-2400.198) [-2399.045] -- 0:04:50
      171500 -- (-2399.375) (-2402.281) [-2401.773] (-2408.351) * (-2409.913) [-2403.626] (-2411.618) (-2410.695) -- 0:04:49
      172000 -- [-2397.503] (-2412.457) (-2406.767) (-2406.358) * [-2403.019] (-2402.214) (-2394.878) (-2406.778) -- 0:04:53
      172500 -- (-2414.219) (-2399.812) [-2399.252] (-2401.747) * (-2414.182) (-2403.006) (-2398.143) [-2407.513] -- 0:04:52
      173000 -- [-2407.781] (-2402.232) (-2403.890) (-2410.691) * (-2413.746) (-2399.048) [-2406.081] (-2407.050) -- 0:04:51
      173500 -- (-2412.774) (-2403.395) [-2402.758] (-2404.219) * (-2407.571) [-2401.317] (-2402.371) (-2407.365) -- 0:04:50
      174000 -- (-2404.514) [-2403.016] (-2401.114) (-2410.891) * (-2408.554) [-2401.855] (-2401.987) (-2406.206) -- 0:04:49
      174500 -- (-2402.947) [-2402.358] (-2404.615) (-2400.059) * (-2407.408) (-2394.556) (-2408.979) [-2399.987] -- 0:04:53
      175000 -- (-2406.434) (-2401.437) (-2411.404) [-2401.531] * (-2408.230) (-2404.377) (-2408.353) [-2401.939] -- 0:04:52

      Average standard deviation of split frequencies: 0.005357

      175500 -- [-2408.502] (-2411.258) (-2398.667) (-2400.207) * (-2402.572) (-2407.206) (-2404.788) [-2405.701] -- 0:04:51
      176000 -- (-2401.477) (-2411.756) (-2408.316) [-2410.430] * (-2419.433) (-2402.813) (-2404.293) [-2409.167] -- 0:04:50
      176500 -- (-2409.258) (-2404.803) (-2399.446) [-2399.883] * (-2401.655) (-2403.881) (-2409.677) [-2411.400] -- 0:04:49
      177000 -- (-2411.814) (-2410.011) (-2403.415) [-2402.775] * (-2413.296) (-2409.331) [-2398.424] (-2403.387) -- 0:04:48
      177500 -- (-2404.548) (-2409.586) (-2397.172) [-2399.030] * [-2402.479] (-2408.717) (-2406.834) (-2403.143) -- 0:04:51
      178000 -- [-2398.780] (-2416.853) (-2403.586) (-2404.892) * (-2402.789) (-2404.236) [-2407.205] (-2410.115) -- 0:04:50
      178500 -- [-2402.506] (-2404.092) (-2397.936) (-2400.598) * (-2408.761) (-2412.116) (-2407.975) [-2413.970] -- 0:04:49
      179000 -- (-2401.743) (-2407.207) (-2406.523) [-2408.540] * (-2396.870) (-2412.257) (-2412.972) [-2401.235] -- 0:04:48
      179500 -- (-2407.469) (-2404.494) [-2405.997] (-2403.430) * (-2406.520) [-2412.596] (-2405.022) (-2396.987) -- 0:04:47
      180000 -- (-2398.298) (-2404.427) [-2409.102] (-2399.666) * (-2400.421) [-2401.116] (-2403.277) (-2400.741) -- 0:04:47

      Average standard deviation of split frequencies: 0.008350

      180500 -- (-2399.904) [-2397.061] (-2401.536) (-2415.463) * (-2399.575) (-2402.906) [-2398.051] (-2402.981) -- 0:04:50
      181000 -- (-2404.149) (-2404.931) [-2401.826] (-2405.153) * (-2401.557) (-2398.539) (-2403.966) [-2397.625] -- 0:04:49
      181500 -- [-2400.735] (-2404.945) (-2404.453) (-2402.488) * (-2400.408) (-2406.750) (-2403.351) [-2399.814] -- 0:04:48
      182000 -- (-2410.599) (-2406.941) [-2397.770] (-2405.345) * (-2407.173) (-2401.836) (-2407.393) [-2399.376] -- 0:04:47
      182500 -- (-2400.750) [-2409.416] (-2401.309) (-2404.591) * (-2403.616) (-2399.218) [-2400.104] (-2400.761) -- 0:04:46
      183000 -- (-2400.478) [-2403.140] (-2402.688) (-2402.997) * (-2405.491) [-2403.297] (-2412.678) (-2400.137) -- 0:04:50
      183500 -- (-2401.940) (-2401.779) (-2394.460) [-2403.326] * (-2398.765) [-2403.548] (-2404.061) (-2401.163) -- 0:04:49
      184000 -- (-2399.290) (-2407.013) [-2402.687] (-2412.461) * [-2400.680] (-2403.867) (-2406.621) (-2405.869) -- 0:04:48
      184500 -- (-2398.669) (-2405.371) (-2402.609) [-2397.126] * (-2411.859) (-2398.538) (-2407.495) [-2408.677] -- 0:04:47
      185000 -- [-2402.138] (-2406.431) (-2413.818) (-2405.575) * (-2411.045) (-2403.424) [-2403.006] (-2407.002) -- 0:04:46

      Average standard deviation of split frequencies: 0.013179

      185500 -- [-2399.440] (-2406.052) (-2406.663) (-2401.058) * (-2410.639) (-2402.470) (-2409.561) [-2402.398] -- 0:04:45
      186000 -- [-2400.144] (-2402.519) (-2405.211) (-2407.065) * (-2408.763) [-2406.763] (-2408.646) (-2400.018) -- 0:04:48
      186500 -- (-2403.544) (-2399.886) (-2405.959) [-2402.678] * (-2401.035) [-2411.141] (-2403.212) (-2403.408) -- 0:04:47
      187000 -- (-2409.490) (-2401.408) (-2404.440) [-2402.427] * (-2402.187) (-2407.114) [-2400.945] (-2403.640) -- 0:04:46
      187500 -- [-2402.085] (-2402.637) (-2413.791) (-2408.895) * (-2403.734) (-2401.041) (-2403.236) [-2403.993] -- 0:04:46
      188000 -- (-2409.541) [-2406.931] (-2403.350) (-2399.128) * (-2409.550) (-2400.619) [-2401.532] (-2400.291) -- 0:04:45
      188500 -- [-2408.692] (-2401.118) (-2402.658) (-2407.700) * (-2417.858) [-2398.012] (-2400.965) (-2398.722) -- 0:04:44
      189000 -- (-2399.871) [-2395.546] (-2408.920) (-2414.178) * (-2402.549) [-2403.083] (-2405.361) (-2410.769) -- 0:04:47
      189500 -- (-2408.085) (-2403.624) [-2401.616] (-2401.116) * [-2410.260] (-2402.351) (-2402.984) (-2404.102) -- 0:04:46
      190000 -- (-2409.382) [-2404.201] (-2400.094) (-2398.600) * (-2409.604) [-2398.511] (-2406.053) (-2401.857) -- 0:04:45

      Average standard deviation of split frequencies: 0.014834

      190500 -- (-2402.008) (-2405.920) (-2405.033) [-2400.041] * (-2408.265) (-2403.198) [-2398.870] (-2399.068) -- 0:04:44
      191000 -- (-2404.907) (-2405.447) [-2404.942] (-2401.217) * [-2402.296] (-2402.981) (-2405.422) (-2400.999) -- 0:04:43
      191500 -- (-2406.367) [-2405.360] (-2412.008) (-2405.879) * (-2402.579) [-2401.408] (-2408.154) (-2402.156) -- 0:04:47
      192000 -- [-2401.567] (-2402.844) (-2404.889) (-2399.298) * (-2406.020) [-2411.386] (-2407.431) (-2420.137) -- 0:04:46
      192500 -- [-2398.683] (-2414.369) (-2403.530) (-2401.716) * (-2396.639) (-2401.419) (-2407.042) [-2407.898] -- 0:04:45
      193000 -- [-2399.674] (-2409.713) (-2401.490) (-2410.218) * (-2401.532) [-2399.824] (-2398.558) (-2401.905) -- 0:04:44
      193500 -- (-2398.702) (-2398.230) (-2408.693) [-2406.140] * (-2406.022) (-2406.190) (-2403.345) [-2399.380] -- 0:04:43
      194000 -- (-2400.119) (-2401.390) [-2404.506] (-2405.655) * (-2402.079) [-2402.603] (-2405.467) (-2400.937) -- 0:04:42
      194500 -- (-2406.876) (-2406.202) [-2403.333] (-2401.667) * (-2401.619) (-2404.465) [-2404.540] (-2397.685) -- 0:04:45
      195000 -- [-2397.697] (-2403.281) (-2403.367) (-2401.166) * (-2402.181) (-2408.649) (-2405.443) [-2400.159] -- 0:04:44

      Average standard deviation of split frequencies: 0.012507

      195500 -- (-2412.490) (-2402.709) [-2399.627] (-2401.857) * (-2402.564) [-2407.315] (-2405.973) (-2406.674) -- 0:04:43
      196000 -- (-2402.365) (-2406.214) [-2400.993] (-2405.012) * (-2409.741) (-2409.783) [-2402.271] (-2408.504) -- 0:04:43
      196500 -- (-2401.477) (-2403.408) (-2405.050) [-2404.336] * (-2402.895) [-2405.667] (-2411.743) (-2408.752) -- 0:04:42
      197000 -- [-2407.696] (-2404.298) (-2407.714) (-2404.770) * (-2412.517) (-2408.671) (-2401.495) [-2410.632] -- 0:04:45
      197500 -- (-2403.188) (-2405.984) [-2399.348] (-2401.980) * [-2407.340] (-2404.742) (-2405.193) (-2405.289) -- 0:04:44
      198000 -- (-2404.125) (-2401.602) (-2414.780) [-2404.357] * [-2405.286] (-2405.242) (-2401.569) (-2403.494) -- 0:04:43
      198500 -- (-2400.977) [-2405.754] (-2400.129) (-2405.196) * (-2409.619) (-2403.098) (-2405.508) [-2399.379] -- 0:04:42
      199000 -- (-2411.640) (-2400.202) [-2399.219] (-2405.122) * (-2418.571) (-2410.885) (-2395.803) [-2399.345] -- 0:04:41
      199500 -- (-2407.965) [-2402.522] (-2404.627) (-2405.157) * (-2402.046) [-2403.889] (-2398.151) (-2406.837) -- 0:04:40
      200000 -- (-2403.559) (-2406.507) [-2405.814] (-2402.454) * (-2400.271) (-2409.275) (-2404.102) [-2406.949] -- 0:04:44

      Average standard deviation of split frequencies: 0.016914

      200500 -- (-2400.328) (-2409.961) [-2406.074] (-2404.744) * (-2409.448) [-2403.551] (-2406.445) (-2413.285) -- 0:04:43
      201000 -- (-2403.600) (-2401.314) (-2407.992) [-2399.202] * [-2401.230] (-2403.731) (-2403.946) (-2416.256) -- 0:04:42
      201500 -- (-2409.865) (-2414.138) [-2400.538] (-2399.758) * [-2402.560] (-2402.453) (-2409.468) (-2407.249) -- 0:04:41
      202000 -- (-2400.406) [-2405.534] (-2409.991) (-2401.384) * [-2398.185] (-2400.967) (-2407.543) (-2409.509) -- 0:04:40
      202500 -- (-2407.882) (-2408.221) [-2402.161] (-2402.426) * (-2404.814) [-2400.738] (-2407.790) (-2408.178) -- 0:04:39
      203000 -- (-2404.721) (-2407.071) [-2405.164] (-2403.228) * (-2408.051) [-2398.455] (-2400.590) (-2399.117) -- 0:04:42
      203500 -- (-2411.096) (-2410.890) (-2409.651) [-2401.422] * (-2404.214) [-2400.243] (-2398.511) (-2400.730) -- 0:04:41
      204000 -- (-2403.452) (-2402.276) (-2403.866) [-2402.754] * (-2403.124) (-2401.108) [-2406.258] (-2399.824) -- 0:04:40
      204500 -- [-2402.890] (-2405.528) (-2404.859) (-2403.817) * (-2400.323) [-2397.438] (-2405.971) (-2404.543) -- 0:04:40
      205000 -- (-2416.409) [-2399.051] (-2402.528) (-2403.618) * (-2402.829) (-2406.019) [-2398.899] (-2413.021) -- 0:04:39

      Average standard deviation of split frequencies: 0.014646

      205500 -- (-2401.917) [-2403.679] (-2409.152) (-2403.949) * (-2409.788) (-2401.679) (-2402.073) [-2400.665] -- 0:04:42
      206000 -- (-2401.822) (-2401.849) [-2402.973] (-2415.547) * (-2412.152) (-2404.052) [-2400.390] (-2406.399) -- 0:04:41
      206500 -- (-2404.145) [-2408.632] (-2400.852) (-2404.971) * (-2403.175) (-2400.616) (-2405.368) [-2403.348] -- 0:04:40
      207000 -- (-2419.378) [-2401.390] (-2398.100) (-2402.062) * (-2401.564) (-2400.180) [-2407.359] (-2404.322) -- 0:04:39
      207500 -- (-2398.635) (-2400.194) (-2406.136) [-2405.063] * (-2411.920) (-2406.722) (-2411.603) [-2407.326] -- 0:04:38
      208000 -- (-2403.095) (-2402.491) [-2402.594] (-2416.564) * (-2412.787) (-2405.061) (-2403.639) [-2403.338] -- 0:04:37
      208500 -- (-2403.562) (-2412.697) (-2409.421) [-2407.194] * (-2410.756) (-2404.126) [-2398.493] (-2409.063) -- 0:04:40
      209000 -- (-2405.183) (-2402.308) [-2403.462] (-2402.234) * (-2402.720) (-2401.953) [-2406.449] (-2408.615) -- 0:04:40
      209500 -- [-2404.505] (-2404.506) (-2400.625) (-2400.967) * [-2397.658] (-2400.039) (-2399.953) (-2403.319) -- 0:04:39
      210000 -- (-2403.990) (-2407.236) [-2408.633] (-2416.647) * (-2405.402) [-2405.605] (-2399.918) (-2410.148) -- 0:04:38

      Average standard deviation of split frequencies: 0.015216

      210500 -- (-2413.689) (-2410.114) (-2409.128) [-2410.041] * (-2408.634) (-2398.557) [-2398.045] (-2406.887) -- 0:04:37
      211000 -- (-2401.027) (-2399.444) [-2400.736] (-2405.870) * (-2411.040) (-2401.237) (-2399.792) [-2402.994] -- 0:04:36
      211500 -- (-2399.746) (-2398.210) (-2394.916) [-2404.580] * (-2403.566) (-2411.394) [-2401.758] (-2401.163) -- 0:04:39
      212000 -- (-2408.276) (-2395.942) [-2400.465] (-2403.917) * (-2409.620) (-2406.072) [-2402.533] (-2406.667) -- 0:04:38
      212500 -- (-2400.511) (-2405.534) (-2399.573) [-2394.353] * [-2412.916] (-2403.706) (-2401.889) (-2402.874) -- 0:04:37
      213000 -- (-2405.287) (-2402.682) (-2405.570) [-2403.699] * [-2404.743] (-2407.035) (-2401.052) (-2401.901) -- 0:04:37
      213500 -- (-2399.674) [-2401.992] (-2401.471) (-2403.736) * (-2402.707) (-2412.093) (-2404.775) [-2403.490] -- 0:04:36
      214000 -- (-2401.517) [-2402.701] (-2403.643) (-2406.958) * (-2405.927) (-2414.258) (-2406.970) [-2396.482] -- 0:04:39
      214500 -- [-2402.783] (-2407.235) (-2405.975) (-2400.964) * [-2410.878] (-2408.279) (-2402.997) (-2405.567) -- 0:04:38
      215000 -- (-2397.931) (-2412.577) (-2399.365) [-2401.051] * (-2403.721) [-2403.631] (-2400.965) (-2403.321) -- 0:04:37

      Average standard deviation of split frequencies: 0.016586

      215500 -- (-2406.889) (-2402.579) (-2406.865) [-2406.264] * (-2397.056) (-2404.198) (-2410.912) [-2399.113] -- 0:04:36
      216000 -- (-2398.051) (-2410.212) [-2401.668] (-2399.700) * (-2402.399) (-2403.102) (-2400.584) [-2404.066] -- 0:04:35
      216500 -- (-2397.615) (-2403.192) (-2401.227) [-2402.478] * (-2402.820) (-2407.167) [-2405.212] (-2403.888) -- 0:04:35
      217000 -- (-2404.762) [-2399.879] (-2403.827) (-2400.739) * (-2404.490) (-2403.503) (-2402.518) [-2399.984] -- 0:04:37
      217500 -- (-2407.883) (-2411.488) (-2404.933) [-2402.101] * (-2411.123) (-2404.758) (-2404.651) [-2402.424] -- 0:04:37
      218000 -- [-2399.711] (-2407.871) (-2400.882) (-2413.440) * (-2410.911) [-2403.840] (-2408.279) (-2407.030) -- 0:04:36
      218500 -- (-2413.066) [-2401.572] (-2399.556) (-2404.384) * (-2415.463) [-2400.917] (-2403.272) (-2407.180) -- 0:04:35
      219000 -- (-2400.098) (-2408.463) (-2410.203) [-2396.845] * (-2412.331) (-2399.629) (-2413.184) [-2408.883] -- 0:04:34
      219500 -- (-2402.836) [-2400.677] (-2407.892) (-2397.905) * (-2407.275) (-2405.780) (-2405.724) [-2403.018] -- 0:04:33
      220000 -- (-2400.826) [-2398.069] (-2397.267) (-2400.978) * (-2405.764) [-2406.330] (-2404.722) (-2401.991) -- 0:04:36

      Average standard deviation of split frequencies: 0.018799

      220500 -- (-2405.348) (-2402.292) [-2399.778] (-2398.990) * (-2404.040) (-2411.843) (-2413.456) [-2404.194] -- 0:04:35
      221000 -- (-2412.155) (-2398.665) [-2402.700] (-2400.302) * (-2398.057) (-2402.514) [-2411.985] (-2405.772) -- 0:04:34
      221500 -- [-2400.780] (-2400.991) (-2406.169) (-2409.363) * (-2409.410) (-2402.560) (-2410.871) [-2403.120] -- 0:04:34
      222000 -- (-2401.093) [-2408.729] (-2403.580) (-2400.938) * (-2400.044) (-2402.169) (-2410.210) [-2404.382] -- 0:04:33
      222500 -- [-2403.008] (-2402.899) (-2408.010) (-2408.332) * (-2411.817) (-2400.794) (-2400.574) [-2410.842] -- 0:04:36
      223000 -- (-2404.396) (-2404.276) (-2403.446) [-2403.134] * (-2403.807) (-2400.531) (-2403.939) [-2407.877] -- 0:04:35
      223500 -- (-2404.676) (-2404.705) (-2400.514) [-2400.826] * (-2401.866) (-2405.768) [-2402.392] (-2415.750) -- 0:04:34
      224000 -- (-2402.530) (-2403.031) (-2401.985) [-2406.405] * [-2400.616] (-2414.874) (-2407.028) (-2400.673) -- 0:04:33
      224500 -- (-2403.736) [-2402.009] (-2407.157) (-2408.079) * [-2403.424] (-2401.232) (-2402.355) (-2399.810) -- 0:04:32
      225000 -- (-2404.758) (-2399.738) [-2406.969] (-2402.412) * [-2407.511] (-2400.566) (-2404.075) (-2409.254) -- 0:04:32

      Average standard deviation of split frequencies: 0.020024

      225500 -- (-2403.541) (-2408.918) (-2405.041) [-2399.378] * (-2409.413) (-2405.827) [-2411.001] (-2406.682) -- 0:04:34
      226000 -- [-2402.020] (-2405.841) (-2407.387) (-2404.573) * (-2410.005) [-2398.627] (-2402.977) (-2403.355) -- 0:04:33
      226500 -- (-2409.743) (-2404.663) (-2401.710) [-2401.685] * (-2419.413) [-2410.194] (-2398.928) (-2399.522) -- 0:04:33
      227000 -- (-2407.074) (-2402.215) [-2401.484] (-2405.545) * [-2402.127] (-2408.686) (-2409.698) (-2404.299) -- 0:04:32
      227500 -- [-2395.301] (-2401.537) (-2406.170) (-2402.962) * (-2403.796) [-2405.622] (-2402.337) (-2404.749) -- 0:04:31
      228000 -- (-2403.310) [-2405.525] (-2404.611) (-2405.797) * (-2400.074) (-2405.504) (-2408.869) [-2394.893] -- 0:04:30
      228500 -- (-2402.209) (-2405.837) (-2404.627) [-2409.457] * (-2403.217) (-2413.378) [-2402.267] (-2407.313) -- 0:04:33
      229000 -- (-2402.952) (-2403.103) [-2408.010] (-2403.390) * [-2400.097] (-2411.006) (-2408.086) (-2405.057) -- 0:04:32
      229500 -- [-2401.014] (-2408.827) (-2416.631) (-2403.613) * (-2397.467) (-2414.481) (-2404.733) [-2400.880] -- 0:04:31
      230000 -- (-2405.450) [-2406.258] (-2407.833) (-2403.539) * (-2399.678) (-2413.277) (-2406.326) [-2405.135] -- 0:04:31

      Average standard deviation of split frequencies: 0.014714

      230500 -- [-2401.058] (-2408.244) (-2405.329) (-2403.071) * (-2404.300) [-2402.046] (-2405.913) (-2403.513) -- 0:04:30
      231000 -- (-2404.578) [-2402.885] (-2400.162) (-2407.011) * (-2409.194) [-2401.571] (-2411.255) (-2409.077) -- 0:04:29
      231500 -- (-2404.517) (-2399.777) (-2402.717) [-2408.940] * [-2401.695] (-2399.759) (-2409.114) (-2399.001) -- 0:04:32
      232000 -- (-2415.771) (-2407.156) (-2404.923) [-2399.681] * (-2403.391) [-2404.967] (-2409.098) (-2402.898) -- 0:04:31
      232500 -- [-2400.974] (-2404.305) (-2397.861) (-2402.196) * (-2407.580) (-2405.337) (-2408.645) [-2400.725] -- 0:04:30
      233000 -- [-2407.022] (-2412.274) (-2399.178) (-2395.200) * (-2413.551) [-2400.463] (-2414.024) (-2397.520) -- 0:04:29
      233500 -- [-2405.090] (-2406.043) (-2403.072) (-2408.985) * (-2413.475) (-2405.354) (-2408.767) [-2405.246] -- 0:04:29
      234000 -- (-2403.667) (-2401.045) (-2403.006) [-2404.678] * (-2412.956) (-2401.281) (-2404.579) [-2398.360] -- 0:04:31
      234500 -- (-2409.249) (-2406.879) (-2407.006) [-2407.019] * (-2409.361) (-2406.496) [-2410.008] (-2400.254) -- 0:04:30
      235000 -- (-2398.938) (-2411.306) (-2400.126) [-2402.524] * [-2407.171] (-2399.437) (-2399.167) (-2410.179) -- 0:04:30

      Average standard deviation of split frequencies: 0.011186

      235500 -- (-2405.829) (-2403.470) (-2405.093) [-2401.261] * (-2412.152) [-2397.957] (-2398.094) (-2400.345) -- 0:04:29
      236000 -- (-2402.083) (-2402.768) [-2404.166] (-2412.170) * (-2407.004) (-2393.400) [-2399.762] (-2403.333) -- 0:04:28
      236500 -- (-2401.175) (-2400.023) (-2407.471) [-2406.163] * (-2404.492) (-2408.725) [-2409.344] (-2403.611) -- 0:04:27
      237000 -- [-2399.697] (-2404.965) (-2405.662) (-2408.514) * (-2401.425) [-2406.936] (-2407.054) (-2406.832) -- 0:04:30
      237500 -- (-2399.669) (-2404.443) (-2404.480) [-2402.446] * [-2402.524] (-2405.969) (-2407.947) (-2406.758) -- 0:04:29
      238000 -- [-2404.183] (-2403.468) (-2405.526) (-2404.550) * (-2399.760) (-2401.438) (-2401.652) [-2399.464] -- 0:04:28
      238500 -- [-2406.712] (-2402.615) (-2412.881) (-2401.092) * (-2407.175) (-2404.918) [-2402.481] (-2404.766) -- 0:04:28
      239000 -- [-2411.988] (-2409.776) (-2404.844) (-2402.372) * (-2409.392) (-2400.508) [-2403.297] (-2404.995) -- 0:04:27
      239500 -- (-2400.827) (-2404.465) (-2406.384) [-2400.985] * (-2398.202) [-2399.016] (-2402.790) (-2404.607) -- 0:04:26
      240000 -- (-2404.111) (-2401.509) (-2408.818) [-2405.193] * (-2408.737) (-2400.740) [-2402.245] (-2408.793) -- 0:04:29

      Average standard deviation of split frequencies: 0.008618

      240500 -- (-2400.591) (-2403.452) (-2412.585) [-2403.471] * (-2397.479) [-2400.582] (-2407.938) (-2403.235) -- 0:04:28
      241000 -- [-2402.543] (-2402.468) (-2414.031) (-2411.133) * (-2406.184) [-2412.734] (-2399.737) (-2398.420) -- 0:04:27
      241500 -- [-2404.279] (-2413.779) (-2400.904) (-2405.761) * (-2403.246) (-2405.243) [-2402.399] (-2413.218) -- 0:04:26
      242000 -- (-2404.747) (-2398.915) (-2406.831) [-2400.018] * (-2401.233) [-2403.964] (-2400.879) (-2407.868) -- 0:04:29
      242500 -- (-2408.115) (-2400.180) [-2404.510] (-2400.372) * (-2398.555) (-2414.969) [-2402.759] (-2406.445) -- 0:04:28
      243000 -- (-2406.690) (-2398.641) (-2403.989) [-2406.147] * (-2404.459) (-2404.458) [-2401.976] (-2402.514) -- 0:04:27
      243500 -- (-2417.566) (-2403.573) (-2407.402) [-2400.322] * (-2397.748) (-2408.560) (-2401.872) [-2405.843] -- 0:04:27
      244000 -- [-2398.179] (-2407.104) (-2407.456) (-2401.135) * (-2403.546) (-2404.223) [-2399.230] (-2403.907) -- 0:04:26
      244500 -- [-2403.520] (-2403.195) (-2410.674) (-2403.730) * (-2406.982) (-2414.407) (-2407.259) [-2402.777] -- 0:04:28
      245000 -- (-2398.917) [-2407.638] (-2405.027) (-2399.875) * (-2404.495) (-2417.958) (-2403.131) [-2401.572] -- 0:04:28

      Average standard deviation of split frequencies: 0.006899

      245500 -- (-2406.521) [-2409.393] (-2411.173) (-2399.640) * (-2403.154) (-2407.820) [-2400.024] (-2401.271) -- 0:04:27
      246000 -- [-2401.173] (-2406.120) (-2405.087) (-2400.626) * (-2399.927) (-2411.795) [-2398.549] (-2403.772) -- 0:04:26
      246500 -- [-2398.843] (-2405.594) (-2399.016) (-2406.072) * (-2403.261) (-2407.455) (-2400.304) [-2401.899] -- 0:04:25
      247000 -- (-2400.214) (-2397.603) (-2400.740) [-2404.913] * (-2407.999) [-2408.592] (-2399.109) (-2403.129) -- 0:04:25
      247500 -- (-2398.012) (-2408.371) [-2399.226] (-2403.380) * (-2407.752) (-2409.267) (-2406.460) [-2403.752] -- 0:04:27
      248000 -- [-2404.639] (-2406.597) (-2403.526) (-2413.525) * [-2403.563] (-2409.635) (-2402.952) (-2406.934) -- 0:04:26
      248500 -- (-2407.104) (-2404.042) [-2400.824] (-2409.497) * (-2408.258) (-2407.212) (-2402.422) [-2400.701] -- 0:04:26
      249000 -- (-2403.611) [-2405.840] (-2401.391) (-2407.711) * (-2404.949) (-2407.725) (-2398.884) [-2406.002] -- 0:04:25
      249500 -- [-2400.845] (-2401.759) (-2405.936) (-2407.392) * (-2411.408) (-2409.647) [-2402.285] (-2418.153) -- 0:04:24
      250000 -- (-2404.078) [-2402.104] (-2410.141) (-2401.568) * (-2402.855) [-2399.438] (-2412.135) (-2406.419) -- 0:04:24

      Average standard deviation of split frequencies: 0.004513

      250500 -- (-2404.173) (-2409.050) [-2399.350] (-2401.835) * (-2403.177) [-2396.188] (-2406.557) (-2410.246) -- 0:04:26
      251000 -- [-2402.216] (-2400.884) (-2404.254) (-2403.276) * (-2401.811) [-2402.999] (-2406.525) (-2402.843) -- 0:04:25
      251500 -- (-2401.111) [-2403.692] (-2394.107) (-2406.176) * [-2405.733] (-2407.777) (-2400.649) (-2409.133) -- 0:04:24
      252000 -- (-2402.946) [-2404.112] (-2403.084) (-2405.611) * (-2406.240) [-2401.460] (-2404.848) (-2415.705) -- 0:04:24
      252500 -- [-2399.858] (-2408.750) (-2404.216) (-2402.548) * [-2402.257] (-2403.653) (-2398.596) (-2410.415) -- 0:04:23
      253000 -- (-2403.666) [-2408.760] (-2408.629) (-2403.328) * (-2402.894) (-2403.815) (-2398.851) [-2410.148] -- 0:04:22
      253500 -- (-2397.477) [-2407.628] (-2409.971) (-2404.311) * (-2407.497) (-2415.513) [-2405.012] (-2406.364) -- 0:04:25
      254000 -- (-2400.423) (-2410.577) (-2403.507) [-2403.703] * (-2403.651) (-2405.743) (-2398.433) [-2398.133] -- 0:04:24
      254500 -- [-2400.119] (-2408.357) (-2412.946) (-2401.007) * [-2401.453] (-2413.801) (-2404.492) (-2403.642) -- 0:04:23
      255000 -- [-2400.217] (-2406.089) (-2411.368) (-2411.323) * (-2402.677) (-2419.842) (-2398.810) [-2402.577] -- 0:04:22

      Average standard deviation of split frequencies: 0.005893

      255500 -- [-2401.022] (-2397.603) (-2398.542) (-2414.980) * (-2398.833) (-2401.086) (-2405.350) [-2401.474] -- 0:04:22
      256000 -- (-2399.952) (-2407.902) [-2398.335] (-2405.595) * [-2404.586] (-2405.773) (-2404.404) (-2397.932) -- 0:04:21
      256500 -- (-2413.343) [-2399.756] (-2400.944) (-2397.878) * (-2403.925) (-2399.651) (-2396.778) [-2405.342] -- 0:04:23
      257000 -- [-2398.374] (-2398.933) (-2409.722) (-2413.040) * [-2404.622] (-2401.811) (-2405.589) (-2404.980) -- 0:04:23
      257500 -- (-2402.989) (-2402.162) [-2404.260] (-2399.896) * [-2405.268] (-2397.919) (-2410.525) (-2414.090) -- 0:04:22
      258000 -- (-2407.161) (-2400.380) (-2408.826) [-2401.300] * (-2407.282) (-2398.879) [-2398.905] (-2412.884) -- 0:04:21
      258500 -- (-2402.284) (-2403.316) [-2402.960] (-2405.061) * (-2404.513) (-2408.830) [-2403.065] (-2405.757) -- 0:04:21
      259000 -- (-2406.799) (-2405.617) [-2403.045] (-2406.584) * (-2407.827) (-2401.859) (-2400.641) [-2405.920] -- 0:04:23
      259500 -- (-2402.343) (-2409.239) [-2401.647] (-2403.607) * (-2404.853) (-2400.686) [-2405.513] (-2408.542) -- 0:04:22
      260000 -- (-2404.645) [-2401.978] (-2407.453) (-2402.351) * [-2411.667] (-2412.810) (-2407.433) (-2403.524) -- 0:04:21

      Average standard deviation of split frequencies: 0.008681

      260500 -- (-2411.286) [-2402.471] (-2406.707) (-2399.969) * (-2402.902) (-2402.516) [-2401.217] (-2411.740) -- 0:04:21
      261000 -- (-2406.963) (-2407.845) [-2407.569] (-2400.887) * (-2409.690) (-2399.819) [-2403.359] (-2419.700) -- 0:04:20
      261500 -- (-2404.296) (-2407.830) [-2403.841] (-2409.836) * (-2406.214) (-2398.271) [-2405.625] (-2404.179) -- 0:04:19
      262000 -- (-2414.700) (-2404.262) [-2408.597] (-2405.147) * (-2405.688) (-2402.463) (-2407.408) [-2408.391] -- 0:04:21
      262500 -- (-2408.407) [-2400.349] (-2404.611) (-2406.144) * (-2409.387) (-2413.452) (-2399.591) [-2401.797] -- 0:04:21
      263000 -- [-2401.758] (-2400.744) (-2405.883) (-2411.885) * [-2408.282] (-2411.790) (-2406.811) (-2408.600) -- 0:04:20
      263500 -- [-2401.629] (-2400.709) (-2399.413) (-2411.374) * [-2404.437] (-2410.757) (-2403.510) (-2405.864) -- 0:04:19
      264000 -- [-2401.454] (-2403.710) (-2403.605) (-2405.387) * (-2401.864) (-2409.655) (-2398.433) [-2402.039] -- 0:04:19
      264500 -- [-2403.058] (-2407.023) (-2412.615) (-2408.498) * (-2403.087) [-2403.173] (-2410.494) (-2402.604) -- 0:04:18
      265000 -- (-2402.406) (-2408.311) [-2405.022] (-2409.041) * (-2404.244) [-2399.744] (-2402.573) (-2401.700) -- 0:04:20

      Average standard deviation of split frequencies: 0.010633

      265500 -- (-2401.799) [-2410.396] (-2399.453) (-2413.353) * (-2404.158) (-2403.155) [-2409.684] (-2408.927) -- 0:04:20
      266000 -- (-2405.297) (-2409.039) [-2404.288] (-2409.356) * (-2407.746) [-2402.850] (-2407.537) (-2416.609) -- 0:04:19
      266500 -- (-2402.527) (-2407.146) [-2410.715] (-2415.169) * (-2402.515) [-2399.129] (-2403.472) (-2403.710) -- 0:04:18
      267000 -- (-2407.066) (-2403.530) (-2406.743) [-2403.195] * (-2406.533) (-2408.986) [-2401.467] (-2399.430) -- 0:04:18
      267500 -- (-2400.603) (-2405.606) (-2408.414) [-2404.638] * (-2408.791) [-2401.759] (-2402.544) (-2402.572) -- 0:04:17
      268000 -- (-2398.608) [-2402.151] (-2402.187) (-2404.203) * (-2403.739) (-2406.175) [-2400.286] (-2400.435) -- 0:04:19
      268500 -- (-2414.137) (-2408.773) [-2406.489] (-2402.900) * (-2407.502) [-2400.088] (-2403.774) (-2403.287) -- 0:04:18
      269000 -- (-2407.481) (-2403.727) (-2402.318) [-2410.205] * [-2405.642] (-2400.342) (-2399.785) (-2407.855) -- 0:04:18
      269500 -- [-2403.511] (-2407.339) (-2401.577) (-2417.166) * (-2401.918) [-2402.117] (-2403.533) (-2395.456) -- 0:04:17
      270000 -- (-2403.845) (-2405.702) [-2408.552] (-2412.237) * [-2401.231] (-2397.224) (-2400.981) (-2408.511) -- 0:04:16

      Average standard deviation of split frequencies: 0.009753

      270500 -- (-2402.941) (-2403.742) [-2402.358] (-2407.495) * [-2404.582] (-2409.832) (-2401.604) (-2412.843) -- 0:04:18
      271000 -- (-2400.721) (-2400.224) [-2403.395] (-2408.679) * (-2402.395) (-2401.549) (-2397.765) [-2405.754] -- 0:04:18
      271500 -- [-2404.884] (-2405.531) (-2406.205) (-2404.779) * (-2404.272) (-2402.351) (-2404.869) [-2399.403] -- 0:04:17
      272000 -- (-2401.510) (-2410.709) (-2402.045) [-2404.031] * (-2404.088) (-2407.848) [-2401.222] (-2402.593) -- 0:04:16
      272500 -- [-2407.938] (-2406.789) (-2407.542) (-2401.292) * [-2406.901] (-2403.629) (-2410.505) (-2403.797) -- 0:04:16
      273000 -- (-2411.314) (-2399.540) (-2410.737) [-2404.835] * [-2407.571] (-2408.645) (-2404.608) (-2409.391) -- 0:04:15
      273500 -- (-2402.015) (-2402.608) [-2397.979] (-2405.302) * (-2405.802) [-2404.703] (-2406.431) (-2404.498) -- 0:04:17
      274000 -- (-2407.587) [-2397.606] (-2402.997) (-2413.903) * (-2404.528) (-2410.606) [-2399.856] (-2401.041) -- 0:04:17
      274500 -- (-2401.503) (-2399.619) (-2412.135) [-2404.705] * (-2403.686) [-2404.393] (-2400.420) (-2410.539) -- 0:04:16
      275000 -- (-2398.317) [-2397.039] (-2400.267) (-2402.993) * (-2403.057) (-2400.651) (-2401.626) [-2395.061] -- 0:04:15

      Average standard deviation of split frequencies: 0.009906

      275500 -- (-2401.530) [-2409.497] (-2400.502) (-2402.161) * (-2400.620) (-2402.022) [-2404.528] (-2407.091) -- 0:04:15
      276000 -- (-2401.179) [-2409.249] (-2401.369) (-2407.757) * [-2398.612] (-2401.436) (-2402.480) (-2401.492) -- 0:04:14
      276500 -- (-2402.298) (-2405.453) [-2405.513] (-2404.606) * (-2404.714) [-2404.355] (-2401.912) (-2411.675) -- 0:04:16
      277000 -- (-2402.284) (-2400.049) (-2406.142) [-2402.927] * (-2403.386) (-2399.232) (-2409.966) [-2402.602] -- 0:04:15
      277500 -- [-2402.794] (-2398.432) (-2400.774) (-2396.939) * (-2407.318) (-2401.908) (-2408.279) [-2400.805] -- 0:04:15
      278000 -- (-2407.129) (-2405.660) [-2402.463] (-2398.580) * (-2398.136) (-2401.826) [-2410.057] (-2405.188) -- 0:04:14
      278500 -- (-2405.076) [-2402.721] (-2406.811) (-2402.935) * (-2403.477) (-2410.170) (-2403.921) [-2398.750] -- 0:04:13
      279000 -- (-2398.046) (-2401.115) [-2401.158] (-2404.360) * [-2398.982] (-2411.482) (-2409.752) (-2400.339) -- 0:04:13
      279500 -- (-2399.922) [-2402.813] (-2399.553) (-2401.188) * (-2398.449) (-2405.945) (-2403.219) [-2399.108] -- 0:04:15
      280000 -- (-2411.157) (-2407.948) [-2404.239] (-2395.479) * (-2408.044) (-2400.658) (-2418.462) [-2400.416] -- 0:04:14

      Average standard deviation of split frequencies: 0.009742

      280500 -- (-2401.954) [-2402.383] (-2405.900) (-2401.865) * (-2403.583) [-2399.660] (-2410.086) (-2407.390) -- 0:04:13
      281000 -- (-2409.799) (-2403.202) (-2413.085) [-2401.527] * [-2399.375] (-2402.266) (-2403.043) (-2404.044) -- 0:04:13
      281500 -- (-2404.371) (-2398.403) [-2402.229] (-2408.537) * (-2399.862) (-2402.521) [-2403.692] (-2405.177) -- 0:04:12
      282000 -- (-2401.141) (-2402.278) [-2409.014] (-2407.674) * (-2401.907) (-2401.772) [-2398.910] (-2411.022) -- 0:04:14
      282500 -- (-2409.449) (-2405.826) [-2405.543] (-2411.616) * (-2403.695) (-2406.856) (-2406.389) [-2400.192] -- 0:04:13
      283000 -- (-2411.517) [-2401.142] (-2411.091) (-2418.156) * (-2412.009) [-2403.115] (-2399.373) (-2408.594) -- 0:04:13
      283500 -- [-2397.767] (-2402.284) (-2404.286) (-2403.939) * (-2402.617) (-2402.525) [-2401.143] (-2405.660) -- 0:04:12
      284000 -- [-2399.665] (-2401.853) (-2410.052) (-2405.234) * (-2404.501) (-2404.243) (-2400.755) [-2408.673] -- 0:04:12
      284500 -- [-2401.064] (-2408.968) (-2406.478) (-2405.044) * (-2399.406) (-2398.321) [-2403.629] (-2404.246) -- 0:04:11
      285000 -- (-2406.420) [-2395.804] (-2404.850) (-2402.284) * (-2405.384) [-2400.021] (-2403.322) (-2410.392) -- 0:04:13

      Average standard deviation of split frequencies: 0.012197

      285500 -- [-2402.454] (-2401.836) (-2402.125) (-2402.556) * (-2401.086) [-2405.898] (-2402.280) (-2407.657) -- 0:04:12
      286000 -- (-2404.556) (-2404.517) [-2404.696] (-2404.111) * (-2401.218) (-2407.282) (-2404.869) [-2405.323] -- 0:04:12
      286500 -- (-2403.467) (-2401.993) [-2400.482] (-2401.077) * (-2408.295) [-2411.369] (-2408.957) (-2412.377) -- 0:04:11
      287000 -- (-2399.343) (-2407.670) (-2398.067) [-2402.021] * [-2407.721] (-2402.869) (-2402.466) (-2404.107) -- 0:04:10
      287500 -- [-2394.976] (-2408.977) (-2403.685) (-2407.007) * [-2409.788] (-2402.427) (-2406.358) (-2415.768) -- 0:04:10
      288000 -- [-2407.772] (-2412.797) (-2405.539) (-2406.233) * [-2404.064] (-2404.668) (-2403.692) (-2403.837) -- 0:04:12
      288500 -- (-2398.746) (-2413.082) [-2398.792] (-2402.731) * (-2401.624) (-2400.542) [-2398.125] (-2402.924) -- 0:04:11
      289000 -- [-2396.280] (-2403.315) (-2403.412) (-2406.978) * (-2404.878) (-2412.607) (-2400.373) [-2408.516] -- 0:04:10
      289500 -- [-2404.898] (-2404.432) (-2407.433) (-2400.656) * [-2398.416] (-2406.240) (-2398.503) (-2402.937) -- 0:04:10
      290000 -- [-2400.431] (-2413.692) (-2411.581) (-2402.834) * [-2403.320] (-2406.142) (-2405.084) (-2403.467) -- 0:04:09

      Average standard deviation of split frequencies: 0.010055

      290500 -- (-2408.756) (-2408.969) [-2402.106] (-2395.832) * (-2403.059) (-2398.151) (-2398.839) [-2412.310] -- 0:04:09
      291000 -- (-2409.433) (-2397.547) (-2402.482) [-2401.957] * (-2401.438) (-2403.567) [-2400.424] (-2402.916) -- 0:04:10
      291500 -- (-2406.941) (-2403.559) (-2405.279) [-2410.393] * (-2404.778) [-2395.965] (-2405.476) (-2403.645) -- 0:04:10
      292000 -- (-2407.417) [-2403.387] (-2397.328) (-2407.832) * (-2409.099) (-2398.188) [-2402.378] (-2402.344) -- 0:04:09
      292500 -- (-2403.704) (-2407.640) [-2406.341] (-2409.131) * (-2422.666) (-2399.987) (-2401.684) [-2401.178] -- 0:04:09
      293000 -- [-2398.256] (-2407.415) (-2401.062) (-2401.188) * (-2402.326) [-2401.173] (-2406.203) (-2401.939) -- 0:04:08
      293500 -- (-2405.456) (-2404.490) [-2396.690] (-2404.536) * [-2397.382] (-2398.209) (-2414.244) (-2407.761) -- 0:04:07
      294000 -- (-2403.925) [-2400.408] (-2401.552) (-2406.929) * [-2402.812] (-2406.211) (-2402.657) (-2402.251) -- 0:04:09
      294500 -- (-2403.661) (-2403.092) (-2400.071) [-2399.906] * (-2405.666) [-2405.323] (-2408.444) (-2406.942) -- 0:04:09
      295000 -- (-2400.533) (-2408.239) [-2400.011] (-2399.314) * [-2411.404] (-2409.702) (-2409.405) (-2409.039) -- 0:04:08

      Average standard deviation of split frequencies: 0.009874

      295500 -- (-2401.316) (-2402.868) (-2402.515) [-2401.525] * (-2416.279) (-2406.764) (-2405.858) [-2402.387] -- 0:04:07
      296000 -- (-2410.045) (-2403.365) [-2401.493] (-2411.051) * (-2406.964) (-2408.108) [-2402.922] (-2402.345) -- 0:04:07
      296500 -- [-2399.669] (-2408.472) (-2399.974) (-2408.884) * (-2404.477) (-2408.871) (-2404.869) [-2405.300] -- 0:04:09
      297000 -- (-2399.152) (-2400.976) [-2401.518] (-2402.131) * (-2404.180) [-2405.731] (-2406.192) (-2401.447) -- 0:04:08
      297500 -- (-2407.953) (-2406.145) (-2403.698) [-2400.086] * (-2414.196) (-2401.579) [-2404.014] (-2405.717) -- 0:04:07
      298000 -- (-2414.484) (-2396.523) (-2409.449) [-2398.072] * (-2404.195) [-2403.474] (-2400.684) (-2416.258) -- 0:04:07
      298500 -- (-2408.445) [-2394.667] (-2404.765) (-2406.031) * (-2405.754) (-2405.344) (-2404.902) [-2403.525] -- 0:04:06
      299000 -- (-2404.730) [-2400.996] (-2406.605) (-2402.458) * (-2407.867) (-2399.327) (-2404.483) [-2400.749] -- 0:04:06
      299500 -- (-2401.855) (-2402.402) [-2401.011] (-2408.249) * (-2402.193) (-2407.251) (-2400.730) [-2404.444] -- 0:04:07
      300000 -- [-2402.924] (-2398.148) (-2406.357) (-2407.761) * (-2398.464) (-2397.083) [-2403.179] (-2408.417) -- 0:04:07

      Average standard deviation of split frequencies: 0.008466

      300500 -- (-2402.752) (-2410.700) [-2400.546] (-2399.902) * [-2408.587] (-2408.819) (-2403.456) (-2407.659) -- 0:04:06
      301000 -- (-2408.624) (-2408.516) [-2400.722] (-2398.775) * [-2406.901] (-2399.811) (-2402.292) (-2406.923) -- 0:04:06
      301500 -- [-2399.760] (-2406.167) (-2401.182) (-2408.222) * (-2407.148) (-2403.218) [-2405.519] (-2411.142) -- 0:04:05
      302000 -- (-2400.400) [-2415.854] (-2404.119) (-2411.258) * [-2403.755] (-2415.121) (-2406.954) (-2404.524) -- 0:04:04
      302500 -- (-2405.286) (-2403.736) [-2403.814] (-2397.659) * (-2399.260) (-2400.760) (-2414.709) [-2399.544] -- 0:04:06
      303000 -- (-2405.222) (-2407.343) (-2403.483) [-2401.140] * (-2398.436) (-2400.908) [-2404.808] (-2403.901) -- 0:04:06
      303500 -- (-2399.324) (-2398.015) [-2407.890] (-2405.209) * (-2403.128) [-2407.060] (-2407.782) (-2406.069) -- 0:04:05
      304000 -- (-2407.192) [-2396.212] (-2399.847) (-2403.725) * (-2400.724) (-2412.854) (-2402.059) [-2399.095] -- 0:04:04
      304500 -- (-2415.681) [-2403.569] (-2405.735) (-2402.753) * (-2407.842) (-2400.503) (-2410.046) [-2401.940] -- 0:04:04
      305000 -- (-2402.178) (-2403.816) (-2409.870) [-2400.550] * (-2411.121) (-2404.227) [-2400.847] (-2404.456) -- 0:04:03

      Average standard deviation of split frequencies: 0.008935

      305500 -- (-2411.654) (-2410.576) (-2408.347) [-2402.015] * [-2398.366] (-2413.652) (-2403.637) (-2400.382) -- 0:04:05
      306000 -- [-2403.142] (-2410.322) (-2413.439) (-2404.794) * (-2406.783) [-2399.697] (-2410.783) (-2406.434) -- 0:04:04
      306500 -- (-2405.398) (-2406.491) (-2401.613) [-2402.168] * (-2407.616) (-2408.372) [-2407.848] (-2405.207) -- 0:04:04
      307000 -- [-2409.679] (-2402.707) (-2407.194) (-2400.474) * (-2400.785) (-2411.179) [-2403.697] (-2406.950) -- 0:04:03
      307500 -- (-2403.618) [-2407.301] (-2413.421) (-2408.008) * [-2410.068] (-2401.144) (-2403.322) (-2405.717) -- 0:04:03
      308000 -- [-2400.316] (-2405.537) (-2402.366) (-2400.836) * (-2412.259) (-2403.427) [-2404.769] (-2404.188) -- 0:04:04
      308500 -- (-2395.403) (-2406.750) [-2398.487] (-2412.173) * (-2402.674) [-2402.636] (-2409.684) (-2400.589) -- 0:04:04
      309000 -- (-2406.286) (-2427.047) (-2400.370) [-2405.614] * (-2402.072) [-2401.723] (-2406.946) (-2406.479) -- 0:04:03
      309500 -- (-2408.862) (-2404.101) (-2411.339) [-2403.627] * [-2401.640] (-2402.810) (-2407.423) (-2397.468) -- 0:04:03
      310000 -- [-2400.313] (-2405.407) (-2407.767) (-2408.103) * (-2400.841) (-2407.766) (-2401.710) [-2404.653] -- 0:04:02

      Average standard deviation of split frequencies: 0.009408

      310500 -- [-2403.934] (-2414.543) (-2408.263) (-2401.028) * (-2398.803) (-2400.977) [-2400.618] (-2406.781) -- 0:04:02
      311000 -- (-2405.577) (-2404.848) (-2409.964) [-2399.855] * (-2399.257) (-2404.024) (-2404.235) [-2403.281] -- 0:04:03
      311500 -- (-2402.301) (-2411.719) (-2403.122) [-2402.683] * (-2402.471) [-2406.206] (-2401.834) (-2408.404) -- 0:04:03
      312000 -- (-2407.147) [-2402.162] (-2405.746) (-2407.873) * (-2405.453) [-2404.194] (-2402.591) (-2408.326) -- 0:04:02
      312500 -- (-2410.015) [-2402.140] (-2406.686) (-2407.374) * (-2406.043) (-2405.278) (-2413.358) [-2401.652] -- 0:04:02
      313000 -- (-2405.449) (-2408.324) [-2410.217] (-2404.065) * (-2406.121) (-2408.424) (-2406.349) [-2402.918] -- 0:04:01
      313500 -- (-2401.124) [-2399.791] (-2405.748) (-2408.244) * (-2405.064) (-2404.641) [-2398.756] (-2403.436) -- 0:04:00
      314000 -- (-2398.782) [-2399.202] (-2410.491) (-2401.049) * [-2403.667] (-2399.838) (-2398.173) (-2405.417) -- 0:04:02
      314500 -- [-2406.249] (-2403.487) (-2408.378) (-2401.487) * [-2404.835] (-2405.965) (-2406.945) (-2401.457) -- 0:04:01
      315000 -- (-2407.922) (-2399.843) [-2406.652] (-2402.509) * (-2411.791) [-2399.643] (-2412.313) (-2403.221) -- 0:04:01

      Average standard deviation of split frequencies: 0.007459

      315500 -- (-2404.484) [-2397.039] (-2404.013) (-2407.056) * [-2404.323] (-2405.611) (-2402.546) (-2409.517) -- 0:04:00
      316000 -- (-2411.508) [-2399.745] (-2408.195) (-2399.198) * (-2405.114) [-2400.341] (-2401.939) (-2398.552) -- 0:04:00
      316500 -- [-2402.534] (-2400.772) (-2407.742) (-2405.412) * (-2410.205) (-2401.507) (-2405.764) [-2397.139] -- 0:03:59
      317000 -- (-2411.922) [-2406.828] (-2406.877) (-2399.575) * (-2401.201) (-2403.465) [-2408.775] (-2404.258) -- 0:04:01
      317500 -- (-2400.483) (-2395.986) (-2410.284) [-2404.322] * (-2399.429) (-2402.254) (-2409.814) [-2398.582] -- 0:04:00
      318000 -- (-2404.893) (-2402.470) (-2411.286) [-2406.033] * [-2405.705] (-2399.115) (-2398.158) (-2402.998) -- 0:04:00
      318500 -- (-2410.725) (-2408.375) [-2397.474] (-2397.406) * (-2405.975) [-2398.050] (-2407.029) (-2407.542) -- 0:03:59
      319000 -- (-2407.537) (-2414.771) [-2403.973] (-2401.138) * [-2411.157] (-2402.992) (-2403.836) (-2403.280) -- 0:03:59
      319500 -- (-2400.160) [-2408.327] (-2405.694) (-2403.544) * (-2407.317) [-2401.012] (-2403.336) (-2403.373) -- 0:04:00
      320000 -- [-2400.693] (-2398.337) (-2410.335) (-2399.702) * [-2401.830] (-2404.212) (-2402.853) (-2407.683) -- 0:04:00

      Average standard deviation of split frequencies: 0.009114

      320500 -- [-2399.541] (-2409.142) (-2407.025) (-2403.585) * [-2404.174] (-2400.988) (-2402.051) (-2402.215) -- 0:03:59
      321000 -- (-2401.519) (-2403.037) [-2404.362] (-2399.512) * (-2401.585) [-2405.459] (-2401.558) (-2401.262) -- 0:03:59
      321500 -- (-2404.442) (-2409.504) [-2403.628] (-2407.912) * (-2400.412) (-2402.927) (-2405.500) [-2395.613] -- 0:03:58
      322000 -- [-2408.328] (-2406.520) (-2402.145) (-2412.394) * (-2407.735) [-2401.157] (-2402.829) (-2399.918) -- 0:03:57
      322500 -- (-2400.441) (-2400.429) (-2407.783) [-2400.294] * [-2396.660] (-2404.443) (-2398.804) (-2404.951) -- 0:03:59
      323000 -- [-2400.748] (-2403.933) (-2404.327) (-2403.744) * (-2407.054) (-2409.231) [-2401.135] (-2404.539) -- 0:03:58
      323500 -- (-2399.039) [-2408.619] (-2399.411) (-2402.467) * [-2400.751] (-2408.232) (-2403.894) (-2400.491) -- 0:03:58
      324000 -- (-2405.596) [-2397.074] (-2407.104) (-2405.659) * [-2407.032] (-2402.268) (-2398.661) (-2407.636) -- 0:03:57
      324500 -- (-2401.318) (-2405.524) (-2403.129) [-2406.709] * (-2399.904) (-2407.034) [-2400.112] (-2412.991) -- 0:03:57
      325000 -- (-2405.370) (-2400.456) [-2404.714] (-2406.108) * [-2406.274] (-2413.120) (-2404.240) (-2414.046) -- 0:03:56

      Average standard deviation of split frequencies: 0.009544

      325500 -- (-2412.406) [-2400.438] (-2410.119) (-2405.551) * (-2408.327) (-2404.968) (-2402.471) [-2405.195] -- 0:03:58
      326000 -- (-2408.741) (-2403.984) (-2396.912) [-2396.992] * (-2401.939) [-2401.023] (-2401.016) (-2400.949) -- 0:03:57
      326500 -- (-2406.331) (-2400.394) [-2405.953] (-2403.815) * [-2400.924] (-2404.806) (-2397.251) (-2404.111) -- 0:03:57
      327000 -- [-2405.025] (-2403.252) (-2399.956) (-2412.888) * (-2401.137) (-2407.617) (-2402.028) [-2393.924] -- 0:03:56
      327500 -- (-2400.834) (-2409.535) (-2403.038) [-2399.196] * (-2400.336) (-2402.530) [-2403.597] (-2408.847) -- 0:03:56
      328000 -- [-2400.614] (-2406.841) (-2409.311) (-2409.655) * (-2403.730) [-2398.561] (-2398.970) (-2405.741) -- 0:03:55
      328500 -- (-2398.228) [-2403.904] (-2411.687) (-2398.766) * (-2407.200) (-2403.482) (-2410.988) [-2400.393] -- 0:03:57
      329000 -- (-2405.336) [-2400.388] (-2409.326) (-2404.437) * (-2412.172) [-2405.560] (-2409.690) (-2407.197) -- 0:03:56
      329500 -- (-2405.081) (-2405.733) [-2407.087] (-2406.325) * (-2404.174) [-2405.234] (-2414.062) (-2399.739) -- 0:03:56
      330000 -- (-2403.741) (-2398.813) [-2402.562] (-2406.811) * (-2401.219) (-2404.647) (-2406.599) [-2403.017] -- 0:03:55

      Average standard deviation of split frequencies: 0.011690

      330500 -- (-2401.024) [-2397.300] (-2404.007) (-2409.696) * [-2399.389] (-2411.858) (-2405.100) (-2405.980) -- 0:03:54
      331000 -- [-2404.277] (-2411.938) (-2410.206) (-2400.798) * (-2406.408) (-2396.279) (-2401.405) [-2399.818] -- 0:03:56
      331500 -- [-2404.818] (-2414.065) (-2409.512) (-2409.853) * (-2402.260) [-2400.445] (-2406.058) (-2400.100) -- 0:03:55
      332000 -- (-2398.966) [-2405.873] (-2411.159) (-2406.819) * (-2402.647) [-2399.548] (-2400.357) (-2405.333) -- 0:03:55
      332500 -- (-2403.339) (-2406.695) [-2412.305] (-2410.247) * [-2403.647] (-2404.125) (-2401.071) (-2409.178) -- 0:03:54
      333000 -- (-2399.077) [-2402.061] (-2405.197) (-2403.593) * (-2404.182) (-2401.987) [-2406.564] (-2404.609) -- 0:03:54
      333500 -- (-2407.083) [-2404.911] (-2404.907) (-2405.845) * [-2402.828] (-2404.646) (-2401.157) (-2405.950) -- 0:03:53
      334000 -- (-2398.773) [-2401.595] (-2408.061) (-2410.704) * (-2405.951) [-2400.208] (-2405.159) (-2413.011) -- 0:03:55
      334500 -- [-2402.259] (-2405.298) (-2409.003) (-2410.616) * (-2405.451) (-2407.509) [-2406.973] (-2411.136) -- 0:03:54
      335000 -- (-2404.767) (-2406.289) (-2413.964) [-2407.985] * (-2400.578) (-2414.125) (-2408.081) [-2410.937] -- 0:03:54

      Average standard deviation of split frequencies: 0.011505

      335500 -- (-2405.087) (-2404.207) [-2400.805] (-2405.097) * [-2409.231] (-2403.661) (-2400.985) (-2406.397) -- 0:03:53
      336000 -- (-2405.044) (-2406.577) (-2411.877) [-2406.243] * (-2405.992) [-2395.887] (-2401.929) (-2406.112) -- 0:03:53
      336500 -- (-2396.861) (-2406.034) [-2398.351] (-2408.438) * (-2403.537) (-2402.905) [-2407.237] (-2401.588) -- 0:03:52
      337000 -- (-2408.445) (-2402.490) [-2401.205] (-2398.224) * (-2409.526) (-2409.584) (-2403.487) [-2403.118] -- 0:03:54
      337500 -- (-2402.402) (-2400.521) (-2408.926) [-2400.537] * [-2398.725] (-2407.564) (-2403.040) (-2413.693) -- 0:03:53
      338000 -- (-2400.692) (-2407.949) (-2406.089) [-2398.588] * (-2409.000) (-2401.899) [-2407.413] (-2401.811) -- 0:03:53
      338500 -- [-2398.928] (-2404.046) (-2412.541) (-2403.285) * (-2410.838) (-2400.280) [-2400.457] (-2402.537) -- 0:03:52
      339000 -- (-2402.981) (-2406.977) [-2408.386] (-2402.122) * [-2400.137] (-2400.013) (-2406.973) (-2403.586) -- 0:03:52
      339500 -- (-2404.746) [-2397.438] (-2414.904) (-2403.589) * [-2399.020] (-2399.719) (-2397.737) (-2406.727) -- 0:03:51
      340000 -- (-2401.894) (-2407.008) (-2419.673) [-2399.240] * (-2401.296) (-2403.901) (-2399.942) [-2409.884] -- 0:03:52

      Average standard deviation of split frequencies: 0.015221

      340500 -- [-2402.032] (-2400.352) (-2406.615) (-2404.570) * [-2395.856] (-2403.880) (-2402.872) (-2408.895) -- 0:03:52
      341000 -- (-2405.238) (-2407.497) [-2401.703] (-2410.338) * [-2398.052] (-2409.997) (-2402.839) (-2404.546) -- 0:03:51
      341500 -- (-2410.713) [-2404.330] (-2401.698) (-2403.996) * (-2407.617) (-2403.746) [-2403.901] (-2407.380) -- 0:03:51
      342000 -- (-2403.867) (-2411.223) [-2402.852] (-2401.236) * (-2407.630) (-2404.419) [-2404.264] (-2400.776) -- 0:03:50
      342500 -- (-2406.420) (-2401.223) (-2401.974) [-2401.885] * (-2398.911) (-2404.835) [-2403.187] (-2396.912) -- 0:03:52
      343000 -- (-2402.699) [-2399.160] (-2401.576) (-2405.529) * (-2403.876) (-2409.392) [-2413.107] (-2396.939) -- 0:03:51
      343500 -- [-2405.577] (-2399.053) (-2402.628) (-2407.484) * (-2410.605) (-2401.871) (-2399.769) [-2400.312] -- 0:03:51
      344000 -- (-2400.256) (-2401.251) (-2405.721) [-2408.203] * (-2402.135) (-2402.423) (-2407.151) [-2401.689] -- 0:03:50
      344500 -- (-2399.121) [-2398.337] (-2402.553) (-2404.462) * [-2405.681] (-2400.174) (-2403.966) (-2406.707) -- 0:03:50
      345000 -- (-2406.263) [-2399.954] (-2405.593) (-2407.682) * (-2405.786) [-2405.782] (-2408.178) (-2407.562) -- 0:03:49

      Average standard deviation of split frequencies: 0.016077

      345500 -- (-2402.434) [-2403.677] (-2406.419) (-2405.866) * (-2405.691) [-2398.780] (-2404.677) (-2402.985) -- 0:03:51
      346000 -- (-2406.600) [-2397.595] (-2409.503) (-2399.136) * [-2396.627] (-2399.754) (-2407.535) (-2414.744) -- 0:03:50
      346500 -- (-2404.380) (-2399.102) (-2402.145) [-2400.706] * (-2413.649) (-2398.334) (-2397.975) [-2397.718] -- 0:03:50
      347000 -- (-2403.693) (-2400.776) [-2402.022] (-2407.608) * (-2402.827) (-2401.209) (-2413.466) [-2403.015] -- 0:03:49
      347500 -- [-2403.461] (-2404.567) (-2399.334) (-2406.790) * (-2406.051) [-2399.742] (-2398.167) (-2399.660) -- 0:03:49
      348000 -- (-2402.282) [-2404.554] (-2401.122) (-2404.123) * [-2403.086] (-2402.806) (-2408.147) (-2403.916) -- 0:03:48
      348500 -- (-2406.873) (-2401.075) (-2405.998) [-2402.293] * (-2408.994) (-2411.407) [-2402.755] (-2412.397) -- 0:03:49
      349000 -- (-2408.505) (-2401.620) [-2399.357] (-2403.402) * [-2410.826] (-2405.006) (-2402.169) (-2403.880) -- 0:03:49
      349500 -- [-2402.399] (-2401.611) (-2401.766) (-2399.126) * [-2403.959] (-2406.821) (-2404.830) (-2400.597) -- 0:03:48
      350000 -- [-2397.067] (-2406.408) (-2401.193) (-2400.543) * (-2402.561) (-2405.912) (-2408.209) [-2397.434] -- 0:03:48

      Average standard deviation of split frequencies: 0.016401

      350500 -- (-2406.133) (-2409.906) (-2409.659) [-2405.972] * (-2403.057) (-2404.438) [-2403.402] (-2403.122) -- 0:03:47
      351000 -- (-2406.571) (-2406.735) (-2408.524) [-2403.710] * [-2403.658] (-2406.232) (-2408.310) (-2403.742) -- 0:03:49
      351500 -- [-2410.191] (-2409.480) (-2405.963) (-2404.209) * (-2410.121) (-2403.841) (-2407.108) [-2404.618] -- 0:03:48
      352000 -- (-2401.412) [-2405.002] (-2403.802) (-2398.819) * (-2400.638) (-2410.121) (-2402.060) [-2400.320] -- 0:03:48
      352500 -- [-2406.045] (-2408.255) (-2407.190) (-2400.505) * (-2404.491) (-2415.265) [-2406.047] (-2408.885) -- 0:03:47
      353000 -- (-2408.470) (-2406.786) (-2404.748) [-2402.065] * (-2404.734) (-2402.475) [-2401.406] (-2399.280) -- 0:03:47
      353500 -- (-2406.856) [-2398.116] (-2400.082) (-2399.703) * (-2399.334) [-2404.931] (-2398.386) (-2401.640) -- 0:03:46
      354000 -- (-2416.114) (-2400.379) [-2402.056] (-2413.507) * (-2403.290) (-2409.115) [-2400.571] (-2406.185) -- 0:03:48
      354500 -- [-2409.552] (-2408.132) (-2399.554) (-2399.224) * [-2399.934] (-2406.000) (-2404.449) (-2394.936) -- 0:03:47
      355000 -- [-2397.817] (-2406.099) (-2408.346) (-2401.822) * (-2401.294) (-2403.827) (-2401.021) [-2402.375] -- 0:03:47

      Average standard deviation of split frequencies: 0.016155

      355500 -- (-2411.762) (-2401.679) [-2402.295] (-2409.967) * (-2404.493) (-2404.873) [-2401.243] (-2399.689) -- 0:03:46
      356000 -- (-2401.160) [-2400.928] (-2403.353) (-2406.253) * (-2408.471) (-2404.450) [-2397.400] (-2400.993) -- 0:03:46
      356500 -- (-2401.870) (-2407.076) [-2400.815] (-2401.868) * (-2409.117) (-2401.634) [-2402.469] (-2405.164) -- 0:03:45
      357000 -- (-2404.749) [-2413.020] (-2399.600) (-2408.357) * (-2406.618) [-2406.367] (-2405.926) (-2403.166) -- 0:03:46
      357500 -- (-2402.152) [-2399.773] (-2402.193) (-2406.778) * (-2405.922) (-2404.794) [-2402.886] (-2400.243) -- 0:03:46
      358000 -- (-2404.842) [-2406.537] (-2409.281) (-2400.464) * [-2400.413] (-2411.555) (-2407.472) (-2406.342) -- 0:03:45
      358500 -- (-2402.396) (-2420.971) (-2413.362) [-2400.954] * [-2400.908] (-2404.560) (-2400.502) (-2405.129) -- 0:03:45
      359000 -- (-2415.510) [-2396.184] (-2398.374) (-2402.216) * [-2404.885] (-2409.928) (-2403.516) (-2404.484) -- 0:03:44
      359500 -- (-2402.830) [-2408.551] (-2411.742) (-2408.382) * (-2401.707) [-2398.203] (-2407.575) (-2401.786) -- 0:03:44
      360000 -- (-2410.152) (-2403.357) [-2411.164] (-2403.339) * (-2401.954) (-2410.410) [-2402.211] (-2405.501) -- 0:03:45

      Average standard deviation of split frequencies: 0.015946

      360500 -- (-2405.564) (-2407.698) (-2405.990) [-2401.687] * (-2404.934) (-2403.204) [-2400.300] (-2399.428) -- 0:03:45
      361000 -- [-2401.667] (-2413.616) (-2404.784) (-2403.474) * (-2402.469) (-2405.316) [-2405.395] (-2405.795) -- 0:03:44
      361500 -- (-2406.071) (-2403.109) (-2406.757) [-2397.419] * (-2404.351) [-2403.442] (-2402.215) (-2402.147) -- 0:03:44
      362000 -- (-2402.651) (-2405.584) (-2403.950) [-2401.796] * [-2400.607] (-2412.426) (-2407.357) (-2401.693) -- 0:03:43
      362500 -- (-2400.513) [-2410.814] (-2402.274) (-2414.479) * (-2406.452) [-2398.758] (-2398.660) (-2408.149) -- 0:03:43
      363000 -- (-2412.209) [-2396.937] (-2405.195) (-2412.701) * [-2399.928] (-2401.170) (-2409.845) (-2422.145) -- 0:03:44
      363500 -- [-2401.384] (-2403.883) (-2410.267) (-2405.057) * (-2405.956) [-2398.928] (-2404.535) (-2409.495) -- 0:03:44
      364000 -- (-2406.516) (-2407.004) [-2401.683] (-2400.598) * (-2415.476) (-2409.640) [-2399.335] (-2412.034) -- 0:03:43
      364500 -- (-2409.541) [-2408.832] (-2406.382) (-2401.622) * (-2402.689) (-2404.053) (-2397.054) [-2401.420] -- 0:03:43
      365000 -- [-2404.625] (-2413.228) (-2404.199) (-2397.071) * [-2399.620] (-2412.910) (-2400.480) (-2401.295) -- 0:03:42

      Average standard deviation of split frequencies: 0.018289

      365500 -- (-2404.988) (-2408.919) (-2399.996) [-2402.657] * (-2410.107) (-2410.926) [-2396.928] (-2411.556) -- 0:03:43
      366000 -- (-2405.430) (-2405.573) [-2405.620] (-2401.092) * [-2405.543] (-2418.200) (-2401.063) (-2398.543) -- 0:03:43
      366500 -- (-2401.362) (-2403.589) [-2404.321] (-2399.995) * (-2398.551) (-2412.781) (-2404.911) [-2405.381] -- 0:03:42
      367000 -- (-2409.042) (-2408.093) [-2410.653] (-2406.779) * [-2402.517] (-2411.747) (-2403.545) (-2400.384) -- 0:03:42
      367500 -- [-2402.148] (-2411.792) (-2403.218) (-2406.434) * (-2408.236) (-2415.504) (-2403.787) [-2409.303] -- 0:03:42
      368000 -- (-2400.297) (-2401.936) [-2401.483] (-2407.129) * (-2405.615) (-2403.786) (-2409.072) [-2407.105] -- 0:03:41
      368500 -- (-2400.754) (-2403.630) (-2402.762) [-2401.882] * [-2401.456] (-2410.462) (-2409.885) (-2401.635) -- 0:03:42
      369000 -- (-2401.631) [-2405.694] (-2404.406) (-2403.955) * (-2401.636) (-2403.599) (-2414.788) [-2408.094] -- 0:03:42
      369500 -- (-2406.477) (-2408.764) (-2405.078) [-2401.278] * [-2403.109] (-2409.246) (-2413.113) (-2402.490) -- 0:03:41
      370000 -- (-2406.429) [-2412.282] (-2403.083) (-2406.358) * (-2400.012) (-2403.396) [-2408.479] (-2405.221) -- 0:03:41

      Average standard deviation of split frequencies: 0.018568

      370500 -- (-2413.399) (-2405.516) (-2402.612) [-2402.012] * (-2404.484) [-2399.127] (-2412.940) (-2401.771) -- 0:03:40
      371000 -- (-2404.973) [-2400.755] (-2400.796) (-2400.563) * (-2406.004) (-2404.932) [-2400.709] (-2402.446) -- 0:03:40
      371500 -- (-2406.955) (-2402.742) (-2399.856) [-2402.320] * (-2414.726) [-2408.509] (-2397.005) (-2403.331) -- 0:03:41
      372000 -- (-2395.602) (-2401.191) (-2403.657) [-2403.634] * (-2412.086) (-2414.100) (-2400.593) [-2400.722] -- 0:03:41
      372500 -- [-2402.634] (-2404.175) (-2401.972) (-2399.902) * (-2407.504) (-2407.246) [-2403.461] (-2404.100) -- 0:03:40
      373000 -- (-2399.467) (-2409.005) [-2407.240] (-2405.899) * [-2401.967] (-2402.904) (-2399.019) (-2401.624) -- 0:03:40
      373500 -- (-2405.482) (-2404.605) [-2402.819] (-2408.030) * (-2396.914) (-2401.031) [-2398.912] (-2404.055) -- 0:03:39
      374000 -- (-2410.471) (-2408.865) (-2404.779) [-2401.919] * (-2406.195) [-2402.645] (-2401.900) (-2402.248) -- 0:03:40
      374500 -- [-2398.316] (-2408.857) (-2403.985) (-2405.832) * (-2401.558) (-2403.149) (-2409.978) [-2403.104] -- 0:03:40
      375000 -- (-2401.259) [-2409.665] (-2402.678) (-2400.856) * [-2403.128] (-2404.893) (-2415.405) (-2395.430) -- 0:03:40

      Average standard deviation of split frequencies: 0.018305

      375500 -- (-2404.475) (-2408.039) (-2404.788) [-2402.432] * (-2400.348) (-2406.904) (-2412.262) [-2402.755] -- 0:03:39
      376000 -- (-2402.343) (-2405.064) [-2399.828] (-2400.214) * (-2400.543) [-2402.434] (-2404.017) (-2408.246) -- 0:03:39
      376500 -- (-2405.662) (-2409.286) [-2402.307] (-2401.670) * (-2400.290) [-2406.861] (-2399.355) (-2401.313) -- 0:03:38
      377000 -- (-2402.947) (-2408.907) [-2404.288] (-2401.038) * (-2404.838) (-2406.593) [-2408.917] (-2400.631) -- 0:03:39
      377500 -- [-2399.056] (-2404.466) (-2401.646) (-2407.978) * [-2400.422] (-2403.570) (-2404.590) (-2402.506) -- 0:03:39
      378000 -- (-2412.896) (-2402.809) (-2403.956) [-2405.129] * (-2403.894) [-2404.475] (-2408.486) (-2410.986) -- 0:03:38
      378500 -- (-2401.856) (-2411.274) [-2408.649] (-2421.165) * [-2408.179] (-2398.315) (-2404.736) (-2399.261) -- 0:03:38
      379000 -- (-2403.686) (-2401.336) [-2406.330] (-2411.668) * (-2405.586) (-2403.725) (-2407.626) [-2401.240] -- 0:03:37
      379500 -- (-2402.192) (-2407.384) (-2417.842) [-2407.942] * (-2403.780) [-2398.422] (-2404.810) (-2407.112) -- 0:03:37
      380000 -- (-2404.322) [-2405.555] (-2407.805) (-2404.274) * [-2398.949] (-2409.488) (-2403.518) (-2404.290) -- 0:03:38

      Average standard deviation of split frequencies: 0.017585

      380500 -- (-2408.531) (-2412.337) [-2400.229] (-2404.633) * [-2403.567] (-2404.582) (-2405.144) (-2401.349) -- 0:03:38
      381000 -- (-2405.100) (-2405.283) (-2399.245) [-2405.176] * [-2404.674] (-2402.015) (-2399.601) (-2401.556) -- 0:03:37
      381500 -- (-2405.022) [-2405.512] (-2402.860) (-2405.506) * (-2402.225) (-2402.763) (-2407.738) [-2397.674] -- 0:03:37
      382000 -- (-2401.570) (-2407.274) [-2404.675] (-2403.382) * (-2405.034) (-2403.608) [-2408.689] (-2405.139) -- 0:03:36
      382500 -- (-2401.467) (-2402.449) [-2404.624] (-2408.661) * (-2407.555) (-2407.301) [-2415.488] (-2406.895) -- 0:03:36
      383000 -- (-2406.782) (-2398.082) (-2407.742) [-2400.317] * (-2403.309) (-2401.404) [-2415.088] (-2402.592) -- 0:03:37
      383500 -- (-2401.196) (-2401.217) [-2397.246] (-2402.756) * (-2402.901) (-2410.650) [-2400.058] (-2402.443) -- 0:03:37
      384000 -- (-2404.216) (-2400.605) (-2409.089) [-2402.205] * (-2403.866) (-2405.483) (-2408.216) [-2402.896] -- 0:03:36
      384500 -- (-2403.773) (-2405.411) [-2404.540] (-2399.125) * (-2412.742) [-2401.841] (-2402.672) (-2401.535) -- 0:03:36
      385000 -- (-2405.006) (-2400.680) [-2403.675] (-2397.631) * [-2408.831] (-2414.754) (-2396.210) (-2404.023) -- 0:03:35

      Average standard deviation of split frequencies: 0.020273

      385500 -- [-2401.273] (-2422.487) (-2409.151) (-2402.582) * [-2407.697] (-2416.384) (-2408.953) (-2413.478) -- 0:03:35
      386000 -- (-2402.408) (-2403.188) [-2404.185] (-2413.983) * [-2400.295] (-2409.344) (-2397.726) (-2405.495) -- 0:03:36
      386500 -- [-2402.682] (-2401.704) (-2404.747) (-2404.174) * (-2406.713) [-2400.438] (-2404.164) (-2412.764) -- 0:03:35
      387000 -- (-2404.175) [-2407.074] (-2404.885) (-2401.774) * (-2410.401) (-2397.233) [-2400.705] (-2416.169) -- 0:03:35
      387500 -- [-2403.832] (-2404.060) (-2401.343) (-2409.363) * [-2410.717] (-2401.362) (-2398.552) (-2408.475) -- 0:03:34
      388000 -- (-2404.285) [-2406.932] (-2414.764) (-2401.601) * (-2405.989) [-2403.727] (-2399.193) (-2403.171) -- 0:03:34
      388500 -- (-2408.556) [-2400.666] (-2413.658) (-2405.709) * (-2400.557) [-2398.507] (-2405.193) (-2402.720) -- 0:03:35
      389000 -- [-2407.262] (-2407.858) (-2404.898) (-2403.412) * (-2406.795) [-2407.800] (-2405.144) (-2405.220) -- 0:03:35
      389500 -- [-2397.651] (-2401.764) (-2398.282) (-2409.513) * (-2411.161) [-2408.913] (-2406.750) (-2399.962) -- 0:03:34
      390000 -- [-2403.408] (-2404.070) (-2408.419) (-2408.907) * (-2408.015) (-2408.445) (-2402.254) [-2403.603] -- 0:03:34

      Average standard deviation of split frequencies: 0.020996

      390500 -- [-2400.958] (-2410.059) (-2400.223) (-2400.886) * [-2405.696] (-2408.848) (-2403.405) (-2402.811) -- 0:03:33
      391000 -- [-2398.287] (-2403.716) (-2403.600) (-2401.271) * (-2405.393) [-2405.701] (-2400.261) (-2407.605) -- 0:03:33
      391500 -- (-2400.972) (-2399.546) (-2401.465) [-2405.746] * (-2406.584) (-2403.668) [-2407.887] (-2402.745) -- 0:03:34
      392000 -- (-2409.061) (-2403.434) [-2401.507] (-2403.939) * (-2401.604) (-2407.187) (-2413.584) [-2396.658] -- 0:03:34
      392500 -- (-2404.200) (-2399.418) (-2410.149) [-2401.663] * (-2403.725) (-2402.795) [-2403.285] (-2395.786) -- 0:03:33
      393000 -- (-2404.518) [-2399.160] (-2403.579) (-2404.184) * (-2412.526) (-2402.559) [-2406.192] (-2407.794) -- 0:03:33
      393500 -- (-2401.967) [-2400.300] (-2406.047) (-2408.146) * (-2404.023) (-2406.907) [-2407.996] (-2408.411) -- 0:03:32
      394000 -- [-2406.474] (-2413.318) (-2407.259) (-2402.022) * (-2403.170) [-2402.016] (-2405.325) (-2408.700) -- 0:03:32
      394500 -- (-2410.208) (-2401.076) [-2407.473] (-2403.458) * (-2401.875) [-2401.150] (-2406.008) (-2404.381) -- 0:03:33
      395000 -- (-2404.150) (-2402.595) (-2399.585) [-2400.083] * (-2406.100) (-2401.909) [-2404.855] (-2405.662) -- 0:03:32

      Average standard deviation of split frequencies: 0.021666

      395500 -- (-2400.452) (-2396.099) [-2398.872] (-2411.317) * [-2394.982] (-2408.236) (-2399.020) (-2403.428) -- 0:03:32
      396000 -- (-2402.078) [-2398.869] (-2412.397) (-2403.304) * (-2406.090) [-2408.600] (-2404.748) (-2404.579) -- 0:03:32
      396500 -- [-2403.171] (-2410.025) (-2401.591) (-2405.205) * (-2409.491) [-2402.805] (-2406.996) (-2401.910) -- 0:03:31
      397000 -- (-2405.945) [-2401.277] (-2404.598) (-2405.298) * (-2403.988) (-2408.498) (-2401.964) [-2401.501] -- 0:03:32
      397500 -- (-2407.550) (-2401.811) (-2400.147) [-2402.148] * [-2405.878] (-2408.378) (-2399.626) (-2407.800) -- 0:03:32
      398000 -- (-2406.001) (-2413.771) (-2398.698) [-2404.718] * (-2403.029) [-2399.889] (-2407.635) (-2405.229) -- 0:03:31
      398500 -- [-2397.501] (-2404.400) (-2400.500) (-2411.847) * (-2412.251) [-2405.716] (-2405.473) (-2403.483) -- 0:03:31
      399000 -- (-2412.385) (-2409.712) [-2398.193] (-2402.621) * (-2404.041) (-2399.429) (-2404.790) [-2401.919] -- 0:03:30
      399500 -- [-2411.478] (-2413.252) (-2405.628) (-2405.095) * (-2405.469) (-2398.560) [-2400.531] (-2402.220) -- 0:03:30
      400000 -- (-2411.440) (-2410.741) (-2400.417) [-2403.259] * [-2402.693] (-2409.615) (-2403.059) (-2406.082) -- 0:03:31

      Average standard deviation of split frequencies: 0.021178

      400500 -- (-2400.379) (-2405.162) [-2399.183] (-2403.401) * (-2404.287) (-2408.578) [-2405.127] (-2408.367) -- 0:03:31
      401000 -- [-2403.008] (-2400.607) (-2404.266) (-2414.422) * (-2402.819) (-2405.152) [-2397.192] (-2403.972) -- 0:03:30
      401500 -- [-2403.813] (-2405.085) (-2410.996) (-2410.255) * (-2405.028) [-2401.850] (-2404.701) (-2411.931) -- 0:03:30
      402000 -- (-2402.833) [-2409.278] (-2408.886) (-2403.391) * [-2402.241] (-2402.047) (-2397.944) (-2411.153) -- 0:03:29
      402500 -- (-2399.925) (-2400.489) (-2403.285) [-2400.550] * (-2409.063) (-2406.642) [-2402.096] (-2406.936) -- 0:03:29
      403000 -- (-2412.952) (-2405.433) (-2401.780) [-2401.209] * (-2405.044) [-2404.490] (-2403.568) (-2402.250) -- 0:03:30
      403500 -- (-2408.049) (-2404.363) [-2399.951] (-2419.254) * (-2414.126) (-2407.154) [-2406.979] (-2401.809) -- 0:03:29
      404000 -- (-2404.763) [-2401.192] (-2402.978) (-2414.411) * (-2412.992) (-2408.528) (-2401.554) [-2405.719] -- 0:03:29
      404500 -- (-2405.866) [-2401.464] (-2404.287) (-2397.825) * [-2403.519] (-2403.682) (-2402.758) (-2409.717) -- 0:03:29
      405000 -- [-2398.837] (-2404.011) (-2404.896) (-2398.631) * (-2398.845) (-2402.368) [-2401.313] (-2404.467) -- 0:03:28

      Average standard deviation of split frequencies: 0.022990

      405500 -- [-2411.106] (-2402.246) (-2400.944) (-2405.952) * [-2398.462] (-2412.335) (-2397.531) (-2403.706) -- 0:03:29
      406000 -- (-2398.976) (-2412.556) (-2406.829) [-2399.850] * (-2401.688) (-2407.543) [-2400.456] (-2407.246) -- 0:03:29
      406500 -- (-2406.611) (-2404.457) [-2401.309] (-2399.719) * (-2403.173) [-2399.107] (-2400.263) (-2403.156) -- 0:03:28
      407000 -- (-2402.729) (-2411.578) (-2404.493) [-2403.340] * [-2407.965] (-2403.239) (-2398.861) (-2406.285) -- 0:03:28
      407500 -- (-2409.109) (-2405.944) (-2405.708) [-2401.718] * [-2401.315] (-2402.127) (-2403.379) (-2404.027) -- 0:03:27
      408000 -- (-2404.657) (-2401.244) [-2401.153] (-2408.437) * (-2404.837) [-2401.265] (-2400.164) (-2411.635) -- 0:03:27
      408500 -- (-2405.046) [-2404.623] (-2411.803) (-2407.257) * [-2405.331] (-2412.660) (-2399.829) (-2408.611) -- 0:03:28
      409000 -- (-2408.386) (-2401.117) (-2405.751) [-2403.336] * [-2405.445] (-2414.693) (-2401.716) (-2402.647) -- 0:03:28
      409500 -- (-2406.206) [-2404.935] (-2414.801) (-2409.082) * (-2405.577) (-2406.151) (-2406.932) [-2402.513] -- 0:03:27
      410000 -- [-2404.878] (-2409.072) (-2405.768) (-2406.740) * [-2402.774] (-2413.596) (-2406.369) (-2408.544) -- 0:03:27

      Average standard deviation of split frequencies: 0.022728

      410500 -- [-2403.274] (-2407.602) (-2405.747) (-2404.425) * [-2403.062] (-2406.285) (-2403.526) (-2410.032) -- 0:03:26
      411000 -- (-2402.165) [-2405.879] (-2400.998) (-2404.487) * (-2401.528) (-2408.097) [-2401.857] (-2402.464) -- 0:03:26
      411500 -- [-2403.459] (-2405.004) (-2406.085) (-2407.883) * [-2401.347] (-2402.451) (-2404.331) (-2399.534) -- 0:03:27
      412000 -- (-2401.203) [-2408.511] (-2406.151) (-2405.834) * (-2403.732) (-2410.525) [-2398.165] (-2399.527) -- 0:03:26
      412500 -- (-2408.268) (-2407.274) [-2405.958] (-2405.019) * (-2403.506) [-2401.167] (-2407.085) (-2405.583) -- 0:03:26
      413000 -- (-2405.783) (-2405.742) [-2405.101] (-2406.994) * (-2405.059) [-2404.081] (-2405.297) (-2401.690) -- 0:03:26
      413500 -- (-2403.231) [-2403.157] (-2405.233) (-2403.814) * [-2407.498] (-2411.250) (-2403.402) (-2405.916) -- 0:03:25
      414000 -- (-2412.954) (-2411.202) (-2400.987) [-2404.211] * (-2406.835) [-2409.587] (-2405.890) (-2406.602) -- 0:03:25
      414500 -- (-2409.217) [-2406.074] (-2400.038) (-2411.103) * (-2405.054) (-2411.920) [-2405.323] (-2410.642) -- 0:03:26
      415000 -- (-2400.606) (-2398.485) [-2397.431] (-2404.336) * (-2406.326) (-2410.536) (-2402.870) [-2408.605] -- 0:03:25

      Average standard deviation of split frequencies: 0.022437

      415500 -- (-2406.733) [-2404.484] (-2403.917) (-2404.473) * (-2404.002) [-2402.804] (-2410.700) (-2414.618) -- 0:03:25
      416000 -- (-2405.329) (-2401.941) (-2406.933) [-2404.648] * (-2409.106) (-2401.288) [-2400.539] (-2406.305) -- 0:03:24
      416500 -- [-2404.917] (-2400.090) (-2403.060) (-2408.006) * (-2402.372) (-2416.839) (-2404.985) [-2406.898] -- 0:03:24
      417000 -- (-2403.615) (-2412.993) (-2398.939) [-2402.422] * (-2405.672) (-2397.389) (-2404.749) [-2404.569] -- 0:03:25
      417500 -- (-2418.419) (-2407.632) (-2406.330) [-2401.730] * (-2407.644) (-2409.316) [-2405.288] (-2407.356) -- 0:03:25
      418000 -- (-2415.421) [-2403.383] (-2399.166) (-2403.503) * [-2403.433] (-2401.662) (-2398.821) (-2395.476) -- 0:03:24
      418500 -- (-2406.038) (-2407.228) [-2402.434] (-2401.869) * (-2404.294) (-2399.666) [-2395.632] (-2404.775) -- 0:03:24
      419000 -- [-2404.868] (-2406.571) (-2403.022) (-2416.716) * [-2403.515] (-2403.853) (-2408.882) (-2404.205) -- 0:03:23
      419500 -- (-2402.974) (-2405.573) [-2404.696] (-2412.729) * (-2411.697) [-2403.138] (-2403.259) (-2407.229) -- 0:03:23
      420000 -- (-2409.911) (-2413.626) (-2404.614) [-2413.151] * [-2404.929] (-2406.842) (-2403.355) (-2403.607) -- 0:03:24

      Average standard deviation of split frequencies: 0.020843

      420500 -- (-2400.044) (-2400.180) (-2400.165) [-2414.436] * (-2407.221) [-2408.820] (-2401.833) (-2401.431) -- 0:03:23
      421000 -- [-2402.592] (-2407.391) (-2401.842) (-2406.471) * (-2406.762) [-2400.217] (-2412.874) (-2404.026) -- 0:03:23
      421500 -- (-2407.789) [-2401.157] (-2402.663) (-2404.365) * (-2402.522) (-2401.431) [-2405.801] (-2403.949) -- 0:03:23
      422000 -- (-2406.460) (-2401.457) [-2396.907] (-2405.714) * (-2403.368) (-2402.009) [-2403.496] (-2401.995) -- 0:03:22
      422500 -- (-2404.818) [-2404.680] (-2404.404) (-2405.506) * (-2410.081) (-2405.748) [-2402.480] (-2403.592) -- 0:03:22
      423000 -- (-2401.547) (-2410.965) (-2408.882) [-2407.566] * (-2409.047) [-2409.365] (-2402.669) (-2403.855) -- 0:03:23
      423500 -- [-2409.912] (-2417.458) (-2404.766) (-2408.512) * (-2408.282) [-2402.500] (-2401.875) (-2405.403) -- 0:03:22
      424000 -- (-2405.309) (-2418.694) (-2405.097) [-2407.186] * [-2405.447] (-2401.945) (-2399.000) (-2408.647) -- 0:03:22
      424500 -- (-2403.412) (-2405.916) (-2416.455) [-2398.963] * (-2404.370) [-2404.646] (-2401.426) (-2409.917) -- 0:03:22
      425000 -- (-2404.637) (-2405.396) [-2405.064] (-2404.491) * (-2406.305) [-2402.688] (-2416.111) (-2403.626) -- 0:03:21

      Average standard deviation of split frequencies: 0.020582

      425500 -- (-2403.113) (-2409.477) (-2403.300) [-2408.673] * (-2407.472) [-2400.399] (-2405.632) (-2406.580) -- 0:03:21
      426000 -- [-2404.516] (-2404.213) (-2399.820) (-2403.730) * (-2407.959) [-2405.642] (-2406.757) (-2405.294) -- 0:03:22
      426500 -- (-2402.735) (-2406.485) [-2399.821] (-2405.061) * (-2404.026) (-2400.814) [-2403.406] (-2400.989) -- 0:03:21
      427000 -- (-2401.210) [-2407.698] (-2397.837) (-2400.645) * (-2406.977) (-2411.189) (-2405.310) [-2402.286] -- 0:03:21
      427500 -- [-2404.270] (-2407.048) (-2396.495) (-2403.727) * [-2404.548] (-2406.305) (-2407.442) (-2399.163) -- 0:03:20
      428000 -- (-2404.637) (-2405.339) (-2406.321) [-2401.679] * (-2402.936) (-2399.918) (-2408.160) [-2400.237] -- 0:03:20
      428500 -- (-2401.367) (-2398.486) [-2400.969] (-2403.711) * [-2407.452] (-2401.881) (-2402.313) (-2402.230) -- 0:03:21
      429000 -- [-2406.751] (-2405.919) (-2401.802) (-2403.724) * (-2403.946) [-2400.660] (-2409.203) (-2405.543) -- 0:03:20
      429500 -- (-2412.336) (-2415.927) (-2407.617) [-2399.552] * (-2405.198) (-2403.995) (-2406.341) [-2401.722] -- 0:03:20
      430000 -- [-2395.231] (-2407.871) (-2405.968) (-2400.762) * (-2405.770) (-2401.320) [-2402.044] (-2400.138) -- 0:03:20

      Average standard deviation of split frequencies: 0.019046

      430500 -- [-2398.004] (-2408.154) (-2408.578) (-2413.397) * (-2400.976) [-2396.237] (-2419.823) (-2403.804) -- 0:03:19
      431000 -- (-2406.998) (-2406.724) [-2399.318] (-2407.611) * (-2413.359) [-2403.826] (-2407.697) (-2411.034) -- 0:03:19
      431500 -- (-2400.950) (-2408.970) (-2406.568) [-2401.275] * [-2399.368] (-2411.667) (-2404.636) (-2404.685) -- 0:03:20
      432000 -- (-2401.360) (-2405.319) (-2405.149) [-2405.179] * (-2400.495) (-2404.125) [-2401.411] (-2408.356) -- 0:03:19
      432500 -- [-2406.838] (-2407.541) (-2412.634) (-2404.940) * [-2403.612] (-2399.731) (-2404.933) (-2409.254) -- 0:03:19
      433000 -- (-2409.455) [-2406.141] (-2410.276) (-2408.999) * (-2405.942) [-2397.892] (-2402.758) (-2403.132) -- 0:03:19
      433500 -- (-2401.299) (-2404.457) (-2400.396) [-2401.728] * (-2401.828) [-2403.568] (-2411.389) (-2403.556) -- 0:03:18
      434000 -- (-2412.477) (-2402.651) (-2404.975) [-2407.404] * (-2404.376) (-2409.532) (-2422.151) [-2410.655] -- 0:03:18
      434500 -- (-2411.133) (-2403.378) (-2400.168) [-2408.044] * (-2411.296) (-2408.986) (-2399.514) [-2402.279] -- 0:03:19
      435000 -- [-2402.291] (-2402.119) (-2403.853) (-2401.358) * (-2406.087) (-2401.194) (-2412.021) [-2402.444] -- 0:03:18

      Average standard deviation of split frequencies: 0.017515

      435500 -- (-2403.593) (-2409.411) [-2402.014] (-2406.879) * (-2402.872) (-2414.332) (-2398.261) [-2398.577] -- 0:03:18
      436000 -- [-2400.254] (-2408.189) (-2404.553) (-2402.176) * (-2400.749) [-2403.167] (-2404.945) (-2401.502) -- 0:03:17
      436500 -- [-2403.344] (-2410.682) (-2403.564) (-2403.418) * (-2401.555) (-2406.044) [-2406.393] (-2403.068) -- 0:03:17
      437000 -- (-2402.764) (-2402.176) (-2402.754) [-2399.206] * (-2406.023) (-2406.693) (-2397.145) [-2405.763] -- 0:03:17
      437500 -- (-2406.029) (-2406.120) [-2405.290] (-2401.138) * [-2397.918] (-2400.959) (-2409.408) (-2402.579) -- 0:03:18
      438000 -- (-2399.578) (-2405.075) (-2398.318) [-2407.447] * (-2410.245) [-2401.112] (-2404.747) (-2396.282) -- 0:03:17
      438500 -- [-2400.553] (-2396.686) (-2405.613) (-2401.055) * [-2400.975] (-2406.278) (-2406.997) (-2397.095) -- 0:03:17
      439000 -- (-2403.494) (-2401.660) [-2403.835] (-2398.152) * (-2405.806) (-2404.164) (-2402.139) [-2403.727] -- 0:03:16
      439500 -- (-2405.130) (-2403.634) [-2400.971] (-2404.952) * (-2405.498) (-2401.339) (-2398.472) [-2398.700] -- 0:03:16
      440000 -- (-2404.250) [-2405.865] (-2402.060) (-2400.990) * (-2403.148) (-2397.564) [-2401.518] (-2408.548) -- 0:03:17

      Average standard deviation of split frequencies: 0.016474

      440500 -- (-2404.207) [-2398.347] (-2406.900) (-2405.223) * (-2400.133) (-2402.002) [-2403.374] (-2406.979) -- 0:03:16
      441000 -- (-2410.193) (-2400.391) (-2407.276) [-2399.398] * (-2403.758) [-2411.760] (-2403.449) (-2406.971) -- 0:03:16
      441500 -- (-2410.026) [-2401.428] (-2413.695) (-2399.747) * [-2405.493] (-2406.447) (-2410.724) (-2414.108) -- 0:03:16
      442000 -- (-2405.417) (-2401.748) [-2405.025] (-2399.836) * (-2409.992) [-2397.145] (-2402.037) (-2411.617) -- 0:03:15
      442500 -- [-2400.320] (-2403.697) (-2402.657) (-2401.036) * (-2410.800) [-2404.228] (-2404.248) (-2405.660) -- 0:03:15
      443000 -- [-2400.780] (-2413.786) (-2409.898) (-2409.159) * (-2403.287) (-2406.182) [-2400.188] (-2408.191) -- 0:03:16
      443500 -- [-2399.497] (-2409.181) (-2406.102) (-2401.421) * (-2405.562) [-2398.631] (-2405.379) (-2408.442) -- 0:03:15
      444000 -- (-2400.521) (-2405.956) (-2405.748) [-2401.269] * (-2402.730) (-2400.248) (-2399.616) [-2402.326] -- 0:03:15
      444500 -- (-2406.326) [-2404.321] (-2400.798) (-2404.618) * (-2403.248) [-2398.998] (-2403.629) (-2406.218) -- 0:03:14
      445000 -- (-2406.391) [-2403.964] (-2401.725) (-2405.636) * (-2405.298) [-2403.375] (-2407.076) (-2402.282) -- 0:03:14

      Average standard deviation of split frequencies: 0.015432

      445500 -- (-2403.120) (-2405.695) [-2406.544] (-2415.262) * [-2398.527] (-2405.673) (-2408.559) (-2407.515) -- 0:03:14
      446000 -- [-2399.146] (-2410.034) (-2405.918) (-2411.213) * (-2399.361) [-2404.544] (-2412.731) (-2408.247) -- 0:03:15
      446500 -- [-2404.669] (-2401.489) (-2396.778) (-2401.004) * (-2400.355) [-2401.676] (-2412.390) (-2402.407) -- 0:03:14
      447000 -- [-2401.677] (-2405.846) (-2397.653) (-2410.269) * (-2404.068) (-2413.807) (-2403.923) [-2400.654] -- 0:03:14
      447500 -- (-2397.225) (-2406.710) (-2406.513) [-2401.952] * (-2400.901) (-2416.804) [-2407.927] (-2399.556) -- 0:03:13
      448000 -- [-2404.070] (-2403.128) (-2400.556) (-2408.688) * (-2402.413) (-2409.141) (-2405.966) [-2400.714] -- 0:03:13
      448500 -- (-2408.323) (-2406.431) [-2399.961] (-2407.881) * (-2408.854) [-2402.733] (-2401.698) (-2404.908) -- 0:03:14
      449000 -- (-2406.359) (-2409.335) [-2398.399] (-2405.064) * [-2398.310] (-2405.385) (-2404.349) (-2407.343) -- 0:03:13
      449500 -- (-2405.558) [-2403.151] (-2404.052) (-2405.455) * (-2399.162) [-2402.489] (-2406.043) (-2401.259) -- 0:03:13
      450000 -- (-2402.823) (-2402.676) [-2403.277] (-2408.043) * [-2395.551] (-2405.207) (-2403.520) (-2406.929) -- 0:03:13

      Average standard deviation of split frequencies: 0.014853

      450500 -- (-2409.857) (-2409.539) (-2403.690) [-2405.520] * (-2410.955) (-2404.129) [-2404.487] (-2407.602) -- 0:03:12
      451000 -- (-2401.509) [-2402.919] (-2402.480) (-2417.553) * (-2399.110) [-2402.114] (-2408.593) (-2402.032) -- 0:03:12
      451500 -- (-2404.485) (-2403.942) (-2400.020) [-2406.204] * (-2407.036) (-2400.366) (-2400.234) [-2399.064] -- 0:03:13
      452000 -- (-2409.914) (-2407.748) [-2405.478] (-2410.110) * [-2397.553] (-2413.401) (-2401.875) (-2400.473) -- 0:03:12
      452500 -- (-2405.536) (-2409.281) (-2400.654) [-2406.252] * (-2401.881) [-2407.379] (-2404.000) (-2399.308) -- 0:03:12
      453000 -- (-2397.546) [-2403.828] (-2410.764) (-2407.171) * [-2406.736] (-2402.905) (-2405.390) (-2401.413) -- 0:03:11
      453500 -- (-2399.356) [-2403.255] (-2403.658) (-2406.375) * (-2400.217) (-2409.349) [-2402.527] (-2405.379) -- 0:03:11
      454000 -- (-2406.626) (-2412.415) [-2404.986] (-2411.546) * (-2400.721) (-2404.821) (-2407.988) [-2399.846] -- 0:03:11
      454500 -- (-2404.328) (-2403.680) [-2408.835] (-2406.801) * (-2402.282) (-2402.128) [-2403.116] (-2396.721) -- 0:03:12
      455000 -- (-2400.418) [-2399.677] (-2405.375) (-2401.556) * [-2403.214] (-2404.863) (-2406.072) (-2400.457) -- 0:03:11

      Average standard deviation of split frequencies: 0.015920

      455500 -- (-2399.133) (-2405.727) (-2403.507) [-2402.963] * (-2409.589) (-2400.455) (-2410.073) [-2399.595] -- 0:03:11
      456000 -- [-2398.470] (-2408.615) (-2406.968) (-2413.009) * (-2400.687) (-2400.851) (-2406.340) [-2398.585] -- 0:03:10
      456500 -- (-2406.173) [-2404.044] (-2400.143) (-2408.729) * (-2404.351) [-2406.220] (-2407.332) (-2402.788) -- 0:03:10
      457000 -- (-2400.041) (-2407.176) (-2400.746) [-2411.397] * [-2411.394] (-2399.855) (-2407.621) (-2398.162) -- 0:03:10
      457500 -- (-2406.025) [-2401.293] (-2403.657) (-2411.986) * [-2399.911] (-2397.300) (-2409.742) (-2400.196) -- 0:03:10
      458000 -- (-2405.788) (-2407.364) (-2398.066) [-2405.555] * (-2400.677) (-2403.977) (-2399.478) [-2404.560] -- 0:03:10
      458500 -- [-2405.601] (-2402.191) (-2401.608) (-2402.542) * (-2404.215) (-2409.201) [-2402.843] (-2404.893) -- 0:03:10
      459000 -- (-2405.888) (-2415.898) (-2406.732) [-2409.637] * (-2397.385) (-2409.517) (-2401.389) [-2401.479] -- 0:03:09
      459500 -- (-2415.068) (-2414.398) [-2403.916] (-2397.909) * (-2403.391) [-2404.033] (-2402.869) (-2406.773) -- 0:03:09
      460000 -- (-2412.663) (-2401.257) [-2412.484] (-2405.091) * (-2408.244) (-2400.653) [-2408.005] (-2399.944) -- 0:03:10

      Average standard deviation of split frequencies: 0.016578

      460500 -- (-2412.764) (-2401.229) [-2401.629] (-2407.293) * [-2400.609] (-2400.866) (-2408.591) (-2397.385) -- 0:03:09
      461000 -- (-2403.092) [-2395.167] (-2396.678) (-2406.444) * (-2401.864) [-2404.464] (-2408.671) (-2410.353) -- 0:03:09
      461500 -- (-2408.702) [-2406.099] (-2396.337) (-2408.555) * (-2404.009) (-2406.007) [-2404.836] (-2403.826) -- 0:03:09
      462000 -- (-2413.633) (-2406.233) (-2402.514) [-2405.080] * (-2407.475) [-2399.413] (-2410.645) (-2409.637) -- 0:03:08
      462500 -- (-2410.188) (-2409.964) (-2398.133) [-2404.420] * [-2404.457] (-2412.586) (-2407.210) (-2407.286) -- 0:03:08
      463000 -- (-2405.540) (-2402.939) [-2399.606] (-2401.552) * [-2400.282] (-2415.969) (-2401.406) (-2401.486) -- 0:03:09
      463500 -- [-2404.856] (-2403.290) (-2411.742) (-2399.031) * (-2410.803) (-2405.057) (-2402.828) [-2404.663] -- 0:03:08
      464000 -- (-2400.208) (-2408.469) (-2409.889) [-2407.635] * (-2401.700) (-2399.299) (-2411.505) [-2399.791] -- 0:03:08
      464500 -- (-2411.223) (-2414.163) [-2414.384] (-2412.780) * [-2406.554] (-2401.066) (-2408.749) (-2403.847) -- 0:03:07
      465000 -- (-2401.997) (-2400.342) [-2401.056] (-2417.881) * [-2403.489] (-2405.117) (-2402.054) (-2409.473) -- 0:03:07

      Average standard deviation of split frequencies: 0.016388

      465500 -- (-2405.251) [-2401.345] (-2402.326) (-2405.571) * (-2397.841) (-2400.786) [-2401.877] (-2402.853) -- 0:03:07
      466000 -- [-2399.078] (-2408.867) (-2402.557) (-2400.982) * (-2401.052) (-2408.312) [-2404.029] (-2400.188) -- 0:03:07
      466500 -- (-2409.760) (-2404.766) (-2404.978) [-2403.855] * [-2403.349] (-2401.243) (-2398.800) (-2396.033) -- 0:03:07
      467000 -- [-2401.522] (-2406.200) (-2404.790) (-2406.953) * (-2404.336) (-2399.145) [-2399.424] (-2404.920) -- 0:03:07
      467500 -- [-2405.137] (-2416.296) (-2406.705) (-2406.879) * (-2407.308) [-2401.544] (-2400.339) (-2412.096) -- 0:03:06
      468000 -- [-2407.275] (-2407.076) (-2404.415) (-2402.292) * (-2399.804) (-2401.755) [-2399.269] (-2406.239) -- 0:03:06
      468500 -- (-2406.028) (-2404.595) [-2397.749] (-2401.554) * [-2405.307] (-2409.403) (-2400.210) (-2402.697) -- 0:03:06
      469000 -- (-2401.532) (-2402.024) [-2399.239] (-2406.040) * [-2403.770] (-2405.990) (-2401.297) (-2400.637) -- 0:03:06
      469500 -- (-2402.668) [-2395.907] (-2404.025) (-2404.060) * (-2409.216) (-2410.837) (-2406.794) [-2405.906] -- 0:03:06
      470000 -- (-2404.072) (-2399.388) (-2408.044) [-2406.711] * [-2404.061] (-2398.247) (-2407.168) (-2403.380) -- 0:03:06

      Average standard deviation of split frequencies: 0.015424

      470500 -- (-2401.057) (-2398.050) [-2407.463] (-2410.157) * (-2407.664) (-2402.054) [-2406.798] (-2407.636) -- 0:03:05
      471000 -- (-2403.458) (-2410.029) (-2401.067) [-2401.838] * (-2404.338) [-2398.543] (-2399.732) (-2410.251) -- 0:03:05
      471500 -- (-2404.347) (-2399.307) [-2401.650] (-2403.990) * (-2400.552) [-2398.023] (-2404.398) (-2400.471) -- 0:03:06
      472000 -- [-2400.212] (-2401.050) (-2412.051) (-2401.593) * (-2403.424) [-2406.227] (-2400.260) (-2402.109) -- 0:03:05
      472500 -- (-2404.018) (-2402.406) (-2405.745) [-2400.091] * (-2407.286) (-2414.002) (-2408.544) [-2397.062] -- 0:03:05
      473000 -- (-2410.090) [-2402.034] (-2399.974) (-2407.267) * (-2409.067) (-2405.851) (-2413.238) [-2401.766] -- 0:03:04
      473500 -- (-2403.694) (-2405.587) [-2398.210] (-2406.466) * (-2408.364) (-2395.773) (-2400.380) [-2401.564] -- 0:03:04
      474000 -- (-2402.388) (-2407.704) [-2400.020] (-2409.584) * [-2406.513] (-2401.756) (-2401.230) (-2397.487) -- 0:03:04
      474500 -- (-2412.859) [-2407.872] (-2407.079) (-2408.048) * [-2401.588] (-2405.163) (-2402.716) (-2402.925) -- 0:03:04
      475000 -- (-2409.434) (-2406.791) [-2402.133] (-2404.482) * (-2402.196) [-2399.734] (-2404.854) (-2403.516) -- 0:03:04

      Average standard deviation of split frequencies: 0.015251

      475500 -- (-2403.433) (-2406.756) [-2408.989] (-2408.118) * (-2398.586) (-2400.101) (-2404.682) [-2399.968] -- 0:03:04
      476000 -- [-2402.089] (-2407.040) (-2407.324) (-2400.089) * [-2404.555] (-2400.141) (-2404.735) (-2403.688) -- 0:03:03
      476500 -- (-2401.029) (-2402.544) (-2398.627) [-2408.403] * (-2404.115) [-2398.055] (-2411.651) (-2404.352) -- 0:03:03
      477000 -- (-2411.770) (-2409.622) [-2401.670] (-2401.261) * (-2404.971) [-2403.681] (-2406.992) (-2408.373) -- 0:03:03
      477500 -- (-2407.459) (-2399.443) (-2397.196) [-2405.192] * (-2403.393) [-2400.138] (-2400.933) (-2414.109) -- 0:03:03
      478000 -- (-2405.972) (-2407.250) [-2395.606] (-2404.456) * [-2406.417] (-2401.878) (-2400.605) (-2400.488) -- 0:03:03
      478500 -- (-2398.357) [-2404.418] (-2408.974) (-2407.164) * (-2398.411) (-2404.322) [-2403.736] (-2402.425) -- 0:03:03
      479000 -- (-2399.607) [-2396.807] (-2403.427) (-2406.465) * [-2404.557] (-2408.403) (-2398.200) (-2406.767) -- 0:03:02
      479500 -- [-2402.908] (-2407.674) (-2400.906) (-2400.697) * (-2411.433) [-2406.418] (-2405.028) (-2407.409) -- 0:03:02
      480000 -- (-2405.989) (-2400.477) (-2402.910) [-2409.676] * (-2410.631) (-2404.643) [-2401.179] (-2404.527) -- 0:03:03

      Average standard deviation of split frequencies: 0.015299

      480500 -- (-2398.537) [-2401.982] (-2402.490) (-2403.900) * (-2410.336) (-2405.286) (-2408.316) [-2399.655] -- 0:03:02
      481000 -- (-2404.849) (-2404.759) (-2407.392) [-2396.920] * (-2399.948) [-2402.254] (-2410.391) (-2406.165) -- 0:03:02
      481500 -- (-2410.263) (-2414.077) [-2400.821] (-2404.505) * [-2405.563] (-2401.885) (-2410.425) (-2406.198) -- 0:03:01
      482000 -- (-2404.356) (-2402.769) [-2400.184] (-2403.450) * (-2403.839) (-2408.242) [-2414.331] (-2404.234) -- 0:03:01
      482500 -- (-2405.295) (-2398.200) [-2400.451] (-2404.482) * (-2401.290) (-2400.228) (-2402.586) [-2403.188] -- 0:03:01
      483000 -- [-2405.416] (-2401.864) (-2411.790) (-2400.550) * (-2408.815) (-2407.064) [-2405.531] (-2410.734) -- 0:03:01
      483500 -- (-2406.074) (-2400.935) (-2420.380) [-2403.819] * (-2409.225) (-2402.515) [-2401.653] (-2407.479) -- 0:03:01
      484000 -- (-2410.270) [-2404.773] (-2408.383) (-2406.566) * [-2406.529] (-2399.631) (-2409.715) (-2401.406) -- 0:03:01
      484500 -- (-2413.129) (-2404.164) (-2401.312) [-2400.304] * (-2400.396) (-2417.035) [-2399.445] (-2407.715) -- 0:03:00
      485000 -- (-2411.216) (-2404.700) [-2403.361] (-2409.391) * (-2412.241) [-2401.801] (-2404.057) (-2400.949) -- 0:03:00

      Average standard deviation of split frequencies: 0.013968

      485500 -- (-2405.671) [-2403.777] (-2409.284) (-2401.184) * (-2405.294) (-2396.349) (-2403.079) [-2405.646] -- 0:03:00
      486000 -- (-2407.284) (-2407.414) (-2403.884) [-2406.636] * (-2408.132) [-2400.203] (-2404.988) (-2404.636) -- 0:03:00
      486500 -- [-2407.105] (-2399.750) (-2406.257) (-2400.106) * (-2401.080) (-2401.035) (-2403.325) [-2403.650] -- 0:03:00
      487000 -- (-2406.695) (-2401.917) (-2404.155) [-2397.893] * (-2403.349) (-2410.062) (-2403.052) [-2405.937] -- 0:03:00
      487500 -- (-2413.034) [-2398.500] (-2405.065) (-2399.024) * (-2403.973) [-2404.650] (-2401.675) (-2401.129) -- 0:02:59
      488000 -- [-2407.702] (-2400.019) (-2401.354) (-2402.279) * (-2410.333) (-2406.223) [-2401.027] (-2401.431) -- 0:02:59
      488500 -- (-2407.266) (-2408.916) (-2401.961) [-2402.759] * (-2404.925) (-2406.884) [-2408.654] (-2407.097) -- 0:03:00
      489000 -- (-2405.901) [-2403.286] (-2409.636) (-2404.445) * [-2406.616] (-2401.350) (-2408.121) (-2407.683) -- 0:02:59
      489500 -- (-2397.764) (-2400.399) (-2407.670) [-2403.381] * [-2400.891] (-2401.675) (-2409.395) (-2406.995) -- 0:02:59
      490000 -- [-2403.656] (-2405.645) (-2412.690) (-2402.059) * [-2394.269] (-2399.282) (-2401.930) (-2402.379) -- 0:02:59

      Average standard deviation of split frequencies: 0.012298

      490500 -- [-2401.140] (-2411.612) (-2402.657) (-2407.500) * (-2406.855) [-2399.318] (-2404.060) (-2403.211) -- 0:02:58
      491000 -- (-2407.835) (-2401.268) [-2395.813] (-2399.887) * (-2418.908) [-2403.125] (-2406.991) (-2399.760) -- 0:02:58
      491500 -- (-2403.985) (-2401.773) [-2399.237] (-2399.531) * (-2404.033) (-2405.119) [-2400.178] (-2402.306) -- 0:02:58
      492000 -- [-2409.114] (-2410.439) (-2406.030) (-2399.434) * (-2399.307) (-2407.201) (-2411.519) [-2406.201] -- 0:02:58
      492500 -- [-2407.990] (-2403.047) (-2402.805) (-2402.925) * [-2399.409] (-2404.147) (-2407.576) (-2406.868) -- 0:02:58
      493000 -- (-2414.663) [-2404.880] (-2407.337) (-2400.241) * (-2403.203) [-2402.023] (-2411.225) (-2403.019) -- 0:02:57
      493500 -- (-2407.784) (-2414.397) (-2398.352) [-2397.858] * (-2400.371) [-2402.785] (-2407.432) (-2403.527) -- 0:02:57
      494000 -- [-2395.986] (-2401.545) (-2399.810) (-2407.300) * (-2405.143) [-2403.583] (-2402.836) (-2405.603) -- 0:02:58
      494500 -- (-2407.204) (-2410.030) [-2403.207] (-2411.343) * (-2400.272) (-2400.364) [-2404.992] (-2406.401) -- 0:02:57
      495000 -- (-2405.162) (-2403.967) (-2412.407) [-2405.484] * (-2404.205) (-2396.110) (-2408.991) [-2401.026] -- 0:02:57

      Average standard deviation of split frequencies: 0.010264

      495500 -- (-2401.007) (-2402.769) [-2405.402] (-2402.399) * (-2412.472) (-2399.727) [-2408.127] (-2398.481) -- 0:02:57
      496000 -- (-2411.057) [-2403.477] (-2403.259) (-2408.383) * (-2401.875) (-2403.120) (-2403.079) [-2408.590] -- 0:02:56
      496500 -- (-2401.780) [-2401.560] (-2402.959) (-2409.283) * (-2408.171) (-2407.587) (-2405.503) [-2405.627] -- 0:02:56
      497000 -- (-2402.476) (-2396.961) [-2401.722] (-2405.195) * (-2406.283) [-2400.906] (-2411.847) (-2403.715) -- 0:02:57
      497500 -- (-2412.714) (-2406.558) [-2402.749] (-2400.863) * (-2420.697) (-2404.824) (-2404.709) [-2402.813] -- 0:02:56
      498000 -- (-2407.809) [-2400.271] (-2405.579) (-2413.468) * [-2404.681] (-2405.558) (-2408.538) (-2399.231) -- 0:02:56
      498500 -- (-2401.432) (-2402.547) (-2402.949) [-2403.533] * (-2403.924) (-2398.673) [-2401.686] (-2401.057) -- 0:02:56
      499000 -- (-2401.942) [-2399.130] (-2405.923) (-2400.905) * (-2408.116) (-2401.208) (-2404.355) [-2402.687] -- 0:02:55
      499500 -- (-2403.183) [-2402.421] (-2406.165) (-2407.313) * (-2405.659) (-2401.950) [-2396.902] (-2400.924) -- 0:02:55
      500000 -- (-2409.132) (-2399.247) (-2411.872) [-2397.284] * (-2403.807) (-2402.748) (-2401.242) [-2401.318] -- 0:02:56

      Average standard deviation of split frequencies: 0.008662

      500500 -- [-2400.368] (-2399.335) (-2414.840) (-2405.452) * (-2398.447) (-2400.728) (-2409.348) [-2404.360] -- 0:02:55
      501000 -- [-2403.473] (-2401.899) (-2404.334) (-2409.705) * (-2403.204) (-2404.506) [-2400.344] (-2399.338) -- 0:02:55
      501500 -- [-2400.185] (-2401.023) (-2400.848) (-2406.544) * (-2403.765) (-2401.964) (-2406.850) [-2399.359] -- 0:02:54
      502000 -- (-2403.889) (-2405.926) [-2401.713] (-2409.036) * (-2402.166) [-2400.179] (-2410.797) (-2406.033) -- 0:02:54
      502500 -- [-2401.241] (-2401.680) (-2402.696) (-2402.903) * (-2408.933) [-2394.879] (-2408.408) (-2403.384) -- 0:02:54
      503000 -- (-2413.183) (-2405.127) (-2412.909) [-2403.244] * (-2409.327) [-2402.705] (-2402.938) (-2402.936) -- 0:02:54
      503500 -- (-2399.687) (-2403.118) [-2408.640] (-2398.815) * (-2414.076) (-2402.827) (-2401.651) [-2397.993] -- 0:02:54
      504000 -- (-2403.578) (-2404.819) [-2407.411] (-2404.410) * (-2405.555) (-2405.915) (-2405.220) [-2406.550] -- 0:02:54
      504500 -- (-2400.659) (-2405.776) (-2405.712) [-2404.391] * (-2397.320) (-2407.241) [-2406.475] (-2406.904) -- 0:02:53
      505000 -- [-2403.680] (-2402.734) (-2404.947) (-2400.631) * [-2411.656] (-2399.959) (-2403.357) (-2414.889) -- 0:02:53

      Average standard deviation of split frequencies: 0.008944

      505500 -- (-2402.654) [-2400.756] (-2409.457) (-2404.742) * [-2409.890] (-2406.157) (-2403.889) (-2399.778) -- 0:02:54
      506000 -- (-2402.954) (-2397.604) [-2405.804] (-2416.183) * (-2404.010) (-2399.391) (-2405.288) [-2403.508] -- 0:02:53
      506500 -- (-2401.748) [-2401.619] (-2401.336) (-2405.517) * (-2396.663) [-2405.900] (-2399.207) (-2400.887) -- 0:02:53
      507000 -- (-2398.272) (-2404.390) [-2404.027] (-2405.950) * (-2403.975) (-2406.992) [-2398.490] (-2405.605) -- 0:02:53
      507500 -- (-2406.995) (-2401.340) [-2397.627] (-2406.184) * (-2403.646) [-2418.732] (-2401.580) (-2407.310) -- 0:02:52
      508000 -- (-2400.536) (-2405.074) [-2403.878] (-2408.351) * (-2407.704) (-2402.274) [-2403.275] (-2406.684) -- 0:02:52
      508500 -- (-2410.723) (-2409.104) (-2405.439) [-2404.860] * (-2408.875) [-2402.043] (-2402.193) (-2401.188) -- 0:02:53
      509000 -- (-2408.016) [-2405.724] (-2408.546) (-2412.702) * [-2400.679] (-2403.454) (-2402.648) (-2404.225) -- 0:02:52
      509500 -- [-2397.715] (-2400.025) (-2408.055) (-2395.437) * [-2404.488] (-2404.507) (-2402.540) (-2406.425) -- 0:02:52
      510000 -- (-2407.205) [-2407.871] (-2401.706) (-2401.817) * (-2414.672) (-2414.816) (-2402.014) [-2402.399] -- 0:02:51

      Average standard deviation of split frequencies: 0.008493

      510500 -- (-2402.311) (-2397.175) (-2398.252) [-2403.394] * [-2402.148] (-2403.041) (-2401.960) (-2400.519) -- 0:02:51
      511000 -- (-2409.817) (-2400.489) [-2400.283] (-2409.665) * (-2401.192) (-2406.354) [-2406.686] (-2406.943) -- 0:02:51
      511500 -- (-2397.745) [-2407.338] (-2407.099) (-2400.125) * (-2399.826) (-2407.433) [-2399.675] (-2402.148) -- 0:02:51
      512000 -- (-2406.691) [-2408.843] (-2404.500) (-2407.462) * (-2404.690) (-2404.609) [-2404.233] (-2402.502) -- 0:02:51
      512500 -- (-2404.542) [-2405.029] (-2401.715) (-2403.777) * [-2404.645] (-2406.660) (-2395.346) (-2406.518) -- 0:02:51
      513000 -- (-2407.942) (-2408.838) [-2409.624] (-2406.228) * (-2413.260) (-2399.941) [-2407.075] (-2407.875) -- 0:02:50
      513500 -- [-2408.151] (-2405.412) (-2402.259) (-2404.270) * (-2403.035) (-2403.868) (-2409.554) [-2402.670] -- 0:02:50
      514000 -- (-2398.416) [-2405.241] (-2403.431) (-2399.586) * (-2401.401) (-2406.055) [-2406.775] (-2402.070) -- 0:02:50
      514500 -- (-2403.965) (-2426.226) [-2405.089] (-2410.116) * (-2405.530) (-2413.644) [-2408.868] (-2405.760) -- 0:02:50
      515000 -- (-2403.207) (-2409.727) [-2403.300] (-2406.761) * (-2401.197) (-2407.432) [-2400.971] (-2407.120) -- 0:02:50

      Average standard deviation of split frequencies: 0.008405

      515500 -- [-2410.302] (-2403.766) (-2404.042) (-2411.978) * (-2400.448) (-2408.431) (-2404.720) [-2407.912] -- 0:02:50
      516000 -- (-2419.898) (-2403.564) [-2401.077] (-2406.635) * (-2403.381) (-2406.573) (-2399.637) [-2399.832] -- 0:02:49
      516500 -- (-2411.928) [-2409.811] (-2404.172) (-2407.483) * (-2401.789) (-2406.630) (-2409.850) [-2398.072] -- 0:02:49
      517000 -- (-2404.596) [-2401.996] (-2403.527) (-2412.867) * (-2399.842) (-2412.905) (-2408.475) [-2402.742] -- 0:02:50
      517500 -- (-2405.146) [-2397.287] (-2409.961) (-2401.583) * (-2401.730) [-2406.080] (-2399.611) (-2403.914) -- 0:02:49
      518000 -- [-2404.858] (-2412.483) (-2405.037) (-2406.987) * (-2402.297) [-2409.799] (-2405.704) (-2401.797) -- 0:02:49
      518500 -- (-2404.222) (-2402.822) (-2405.625) [-2403.964] * (-2400.597) (-2411.807) [-2400.783] (-2405.488) -- 0:02:49
      519000 -- (-2402.115) [-2411.240] (-2404.655) (-2397.820) * (-2404.928) (-2403.007) (-2403.621) [-2404.094] -- 0:02:48
      519500 -- (-2407.587) (-2408.254) [-2401.575] (-2413.622) * [-2405.045] (-2402.499) (-2402.828) (-2406.054) -- 0:02:48
      520000 -- (-2402.030) (-2406.412) [-2411.015] (-2407.770) * [-2401.301] (-2402.682) (-2404.260) (-2407.461) -- 0:02:48

      Average standard deviation of split frequencies: 0.009416

      520500 -- (-2410.670) [-2400.141] (-2403.929) (-2410.495) * (-2398.682) (-2403.400) [-2396.881] (-2406.265) -- 0:02:48
      521000 -- (-2413.504) (-2407.982) (-2400.197) [-2408.626] * (-2401.086) (-2400.658) [-2400.688] (-2407.834) -- 0:02:48
      521500 -- (-2404.009) (-2411.482) (-2399.506) [-2400.222] * (-2401.990) [-2403.741] (-2408.626) (-2398.170) -- 0:02:47
      522000 -- (-2409.224) (-2402.414) [-2405.344] (-2404.886) * [-2400.369] (-2406.750) (-2399.297) (-2399.055) -- 0:02:47
      522500 -- (-2416.682) (-2414.576) (-2406.062) [-2397.469] * (-2406.935) [-2399.406] (-2403.156) (-2407.410) -- 0:02:47
      523000 -- (-2413.956) [-2403.903] (-2400.646) (-2405.713) * (-2405.673) (-2410.004) [-2404.750] (-2406.616) -- 0:02:47
      523500 -- (-2411.955) (-2413.181) (-2399.698) [-2399.364] * (-2412.337) (-2406.880) [-2397.724] (-2406.086) -- 0:02:47
      524000 -- (-2413.140) (-2400.429) (-2404.473) [-2401.805] * [-2411.637] (-2412.112) (-2397.992) (-2404.372) -- 0:02:47
      524500 -- (-2411.825) (-2412.822) (-2398.620) [-2400.400] * (-2409.772) (-2410.250) (-2401.729) [-2402.843] -- 0:02:46
      525000 -- (-2410.580) [-2401.698] (-2401.591) (-2401.828) * [-2406.408] (-2401.540) (-2407.580) (-2402.424) -- 0:02:46

      Average standard deviation of split frequencies: 0.008245

      525500 -- (-2406.184) (-2401.656) [-2410.586] (-2399.716) * (-2401.588) (-2399.656) [-2404.273] (-2405.303) -- 0:02:46
      526000 -- [-2406.752] (-2398.457) (-2411.248) (-2407.458) * (-2409.337) (-2407.571) [-2406.128] (-2407.045) -- 0:02:46
      526500 -- (-2402.819) [-2404.918] (-2415.189) (-2407.465) * (-2404.948) (-2399.087) [-2402.731] (-2409.270) -- 0:02:46
      527000 -- (-2401.853) [-2399.836] (-2397.079) (-2408.800) * (-2409.155) (-2407.496) (-2405.211) [-2399.567] -- 0:02:46
      527500 -- (-2401.688) [-2400.485] (-2401.815) (-2401.489) * (-2409.325) [-2400.879] (-2399.660) (-2415.219) -- 0:02:45
      528000 -- [-2408.158] (-2402.198) (-2400.383) (-2399.575) * [-2406.452] (-2397.713) (-2403.718) (-2398.613) -- 0:02:45
      528500 -- (-2406.673) (-2410.040) (-2415.375) [-2400.545] * (-2407.614) (-2403.499) (-2414.572) [-2403.957] -- 0:02:45
      529000 -- (-2407.954) (-2406.459) (-2406.875) [-2398.633] * (-2399.624) [-2409.516] (-2399.123) (-2408.795) -- 0:02:45
      529500 -- [-2400.845] (-2403.252) (-2403.466) (-2402.323) * (-2406.937) (-2405.139) [-2405.301] (-2411.740) -- 0:02:45
      530000 -- (-2405.749) (-2407.634) [-2402.774] (-2402.887) * (-2410.992) [-2399.809] (-2399.612) (-2411.801) -- 0:02:44

      Average standard deviation of split frequencies: 0.008528

      530500 -- (-2399.006) (-2415.935) [-2399.563] (-2398.540) * [-2399.176] (-2409.026) (-2407.048) (-2404.262) -- 0:02:44
      531000 -- (-2399.636) (-2402.822) (-2403.823) [-2408.522] * (-2402.919) (-2400.940) [-2412.967] (-2406.456) -- 0:02:44
      531500 -- (-2402.069) [-2402.952] (-2405.294) (-2405.542) * (-2407.128) (-2426.590) (-2411.491) [-2408.451] -- 0:02:44
      532000 -- [-2396.850] (-2400.168) (-2408.471) (-2401.862) * (-2401.649) (-2404.300) (-2399.769) [-2400.781] -- 0:02:44
      532500 -- [-2402.881] (-2406.115) (-2400.644) (-2410.341) * [-2404.086] (-2408.729) (-2399.181) (-2407.600) -- 0:02:44
      533000 -- (-2407.002) (-2402.372) (-2406.617) [-2405.147] * (-2408.724) (-2405.367) [-2404.497] (-2401.335) -- 0:02:43
      533500 -- (-2406.165) (-2399.314) [-2403.827] (-2404.027) * (-2409.196) [-2405.161] (-2403.476) (-2404.352) -- 0:02:43
      534000 -- (-2403.729) (-2408.319) (-2397.966) [-2403.680] * (-2406.879) (-2403.955) (-2400.957) [-2405.545] -- 0:02:43
      534500 -- (-2405.513) (-2403.019) [-2405.971] (-2401.292) * (-2402.115) [-2402.763] (-2402.177) (-2404.911) -- 0:02:43
      535000 -- (-2412.298) (-2400.544) [-2408.962] (-2403.345) * (-2406.352) [-2399.043] (-2412.922) (-2405.069) -- 0:02:43

      Average standard deviation of split frequencies: 0.008443

      535500 -- (-2403.604) [-2400.326] (-2413.174) (-2406.005) * (-2399.394) (-2402.040) [-2395.976] (-2405.183) -- 0:02:43
      536000 -- (-2406.910) (-2402.311) (-2398.894) [-2403.732] * (-2395.686) (-2407.848) [-2399.779] (-2408.675) -- 0:02:42
      536500 -- (-2402.683) [-2401.097] (-2398.127) (-2404.268) * (-2403.349) (-2402.643) [-2401.486] (-2407.412) -- 0:02:42
      537000 -- (-2407.889) [-2401.905] (-2407.602) (-2405.434) * [-2405.639] (-2402.242) (-2406.607) (-2405.028) -- 0:02:42
      537500 -- (-2401.127) (-2402.397) [-2402.643] (-2403.347) * (-2414.390) (-2414.109) [-2401.615] (-2403.131) -- 0:02:42
      538000 -- [-2399.957] (-2401.545) (-2395.719) (-2400.658) * (-2409.002) (-2408.852) [-2404.748] (-2400.060) -- 0:02:42
      538500 -- (-2404.084) (-2400.378) (-2404.530) [-2400.551] * (-2414.996) (-2406.032) [-2404.290] (-2398.896) -- 0:02:41
      539000 -- (-2396.916) (-2403.973) (-2400.852) [-2406.679] * (-2401.046) (-2409.798) [-2398.927] (-2400.473) -- 0:02:41
      539500 -- (-2408.847) (-2401.395) [-2400.939] (-2408.621) * [-2404.427] (-2408.833) (-2401.483) (-2404.500) -- 0:02:41
      540000 -- (-2411.890) (-2405.880) (-2404.239) [-2405.004] * (-2400.977) (-2404.476) (-2409.438) [-2401.524] -- 0:02:41

      Average standard deviation of split frequencies: 0.008021

      540500 -- (-2406.939) [-2400.344] (-2404.885) (-2405.234) * [-2401.720] (-2409.236) (-2400.251) (-2399.372) -- 0:02:41
      541000 -- (-2406.962) (-2407.075) (-2399.674) [-2400.033] * (-2405.094) (-2407.014) [-2408.242] (-2402.355) -- 0:02:41
      541500 -- (-2396.069) (-2398.630) (-2403.626) [-2405.359] * (-2402.868) [-2410.019] (-2406.810) (-2411.477) -- 0:02:40
      542000 -- (-2398.060) [-2405.630] (-2401.747) (-2402.981) * (-2401.332) (-2407.176) [-2402.289] (-2407.406) -- 0:02:40
      542500 -- (-2405.684) (-2408.878) [-2399.421] (-2396.259) * [-2410.653] (-2403.366) (-2403.254) (-2396.618) -- 0:02:40
      543000 -- [-2400.768] (-2403.432) (-2397.534) (-2403.280) * [-2406.144] (-2405.466) (-2401.024) (-2402.231) -- 0:02:40
      543500 -- (-2399.666) [-2401.044] (-2402.877) (-2408.797) * [-2406.717] (-2406.419) (-2409.896) (-2406.215) -- 0:02:40
      544000 -- (-2408.796) (-2403.071) [-2400.225] (-2405.388) * (-2411.426) (-2405.536) (-2406.300) [-2409.014] -- 0:02:40
      544500 -- (-2402.347) [-2397.691] (-2410.403) (-2407.798) * (-2405.685) [-2404.067] (-2404.546) (-2407.520) -- 0:02:39
      545000 -- (-2409.563) [-2400.663] (-2405.800) (-2418.795) * (-2411.018) (-2400.172) [-2405.963] (-2398.693) -- 0:02:39

      Average standard deviation of split frequencies: 0.008288

      545500 -- (-2412.056) [-2404.302] (-2405.638) (-2408.968) * (-2407.517) [-2403.311] (-2412.678) (-2402.566) -- 0:02:39
      546000 -- [-2408.131] (-2401.289) (-2400.874) (-2413.971) * (-2402.377) (-2404.659) (-2414.665) [-2402.798] -- 0:02:39
      546500 -- [-2405.689] (-2407.192) (-2406.605) (-2409.124) * (-2407.634) [-2406.193] (-2399.521) (-2405.460) -- 0:02:39
      547000 -- (-2401.915) [-2399.221] (-2414.177) (-2409.911) * (-2413.086) [-2399.098] (-2407.428) (-2401.628) -- 0:02:39
      547500 -- (-2402.244) (-2407.707) (-2412.129) [-2400.073] * (-2405.116) (-2403.537) [-2405.350] (-2401.861) -- 0:02:38
      548000 -- [-2403.856] (-2404.466) (-2402.455) (-2406.845) * (-2411.069) (-2400.039) [-2400.062] (-2404.221) -- 0:02:38
      548500 -- (-2406.393) (-2407.740) (-2404.834) [-2410.007] * (-2409.371) (-2409.426) (-2404.287) [-2408.292] -- 0:02:38
      549000 -- (-2403.115) (-2410.818) (-2405.658) [-2408.112] * [-2411.262] (-2403.157) (-2402.917) (-2404.665) -- 0:02:38
      549500 -- (-2403.200) [-2405.798] (-2403.389) (-2401.844) * (-2402.447) (-2410.753) (-2406.134) [-2403.829] -- 0:02:38
      550000 -- (-2402.788) (-2404.464) [-2401.424] (-2407.371) * (-2404.160) (-2403.960) (-2401.111) [-2404.397] -- 0:02:37

      Average standard deviation of split frequencies: 0.008561

      550500 -- (-2399.139) (-2403.483) (-2399.987) [-2399.886] * (-2408.072) (-2412.539) (-2402.878) [-2400.868] -- 0:02:37
      551000 -- [-2397.034] (-2404.259) (-2402.823) (-2400.167) * [-2402.057] (-2399.683) (-2405.115) (-2406.641) -- 0:02:37
      551500 -- (-2403.742) (-2400.119) (-2399.553) [-2405.991] * (-2404.448) (-2406.425) (-2402.985) [-2399.775] -- 0:02:36
      552000 -- [-2401.817] (-2400.675) (-2404.236) (-2398.887) * [-2399.334] (-2404.923) (-2405.042) (-2400.262) -- 0:02:37
      552500 -- (-2407.279) [-2396.672] (-2404.751) (-2403.857) * [-2398.926] (-2408.504) (-2404.384) (-2401.920) -- 0:02:37
      553000 -- (-2412.235) [-2401.568] (-2402.409) (-2405.488) * [-2400.187] (-2398.267) (-2419.952) (-2402.083) -- 0:02:36
      553500 -- (-2405.791) [-2409.317] (-2398.209) (-2402.173) * (-2406.980) (-2409.224) [-2401.683] (-2401.569) -- 0:02:36
      554000 -- (-2404.216) (-2413.804) [-2398.865] (-2397.722) * (-2406.215) (-2399.487) [-2408.637] (-2405.857) -- 0:02:36
      554500 -- (-2407.520) (-2403.965) (-2409.376) [-2404.141] * (-2404.050) [-2404.672] (-2402.524) (-2409.047) -- 0:02:36
      555000 -- (-2413.336) (-2402.887) (-2404.669) [-2404.290] * [-2395.882] (-2405.206) (-2406.329) (-2409.889) -- 0:02:36

      Average standard deviation of split frequencies: 0.009496

      555500 -- (-2408.954) (-2405.713) (-2401.885) [-2398.465] * (-2404.770) (-2406.234) (-2401.288) [-2406.036] -- 0:02:36
      556000 -- [-2403.014] (-2398.652) (-2407.233) (-2401.322) * [-2401.792] (-2401.680) (-2397.024) (-2409.905) -- 0:02:35
      556500 -- (-2408.455) (-2404.953) (-2404.943) [-2407.841] * [-2402.178] (-2410.094) (-2411.063) (-2401.603) -- 0:02:35
      557000 -- (-2406.381) (-2399.647) (-2409.047) [-2404.548] * [-2402.005] (-2404.027) (-2409.191) (-2412.947) -- 0:02:35
      557500 -- (-2404.801) (-2400.107) (-2410.689) [-2399.740] * (-2401.331) (-2402.430) [-2411.273] (-2401.441) -- 0:02:35
      558000 -- (-2405.311) (-2404.586) [-2402.236] (-2402.690) * [-2404.675] (-2406.213) (-2406.546) (-2401.340) -- 0:02:35
      558500 -- (-2410.525) (-2398.029) [-2403.583] (-2402.390) * (-2405.400) (-2407.540) [-2403.959] (-2404.347) -- 0:02:34
      559000 -- (-2409.040) [-2398.603] (-2402.127) (-2404.965) * (-2409.368) (-2406.357) [-2403.460] (-2404.831) -- 0:02:34
      559500 -- (-2407.310) (-2404.516) [-2409.213] (-2409.123) * (-2408.453) [-2401.791] (-2405.995) (-2402.441) -- 0:02:34
      560000 -- (-2399.189) [-2402.699] (-2404.147) (-2399.345) * (-2404.615) (-2400.442) (-2403.737) [-2403.880] -- 0:02:34

      Average standard deviation of split frequencies: 0.009417

      560500 -- (-2403.996) (-2400.404) (-2415.468) [-2403.012] * (-2400.560) (-2403.371) [-2399.047] (-2402.206) -- 0:02:34
      561000 -- [-2401.620] (-2411.578) (-2412.988) (-2402.386) * (-2409.584) [-2400.586] (-2399.018) (-2415.061) -- 0:02:34
      561500 -- [-2401.170] (-2402.220) (-2404.969) (-2404.191) * (-2405.833) (-2404.229) (-2397.876) [-2403.724] -- 0:02:33
      562000 -- (-2404.961) (-2400.938) [-2409.849] (-2404.394) * (-2409.799) (-2412.617) [-2395.789] (-2408.470) -- 0:02:33
      562500 -- (-2407.722) (-2404.085) (-2406.829) [-2399.953] * (-2407.536) (-2400.403) [-2402.969] (-2406.748) -- 0:02:33
      563000 -- (-2400.088) (-2405.696) [-2404.613] (-2397.346) * (-2403.400) (-2403.623) (-2402.512) [-2402.212] -- 0:02:32
      563500 -- (-2402.960) (-2402.399) (-2400.084) [-2405.864] * (-2408.374) (-2402.599) [-2402.326] (-2399.946) -- 0:02:33
      564000 -- (-2408.809) (-2404.396) (-2403.475) [-2400.298] * (-2407.154) (-2401.989) (-2407.180) [-2404.704] -- 0:02:33
      564500 -- (-2402.472) (-2401.845) (-2400.278) [-2404.394] * [-2400.439] (-2397.843) (-2405.139) (-2399.571) -- 0:02:32
      565000 -- [-2396.929] (-2403.995) (-2402.760) (-2397.845) * (-2406.605) (-2405.358) [-2406.420] (-2404.249) -- 0:02:32

      Average standard deviation of split frequencies: 0.010328

      565500 -- (-2402.388) [-2399.094] (-2413.703) (-2400.538) * (-2405.537) (-2407.927) (-2398.187) [-2402.560] -- 0:02:32
      566000 -- (-2397.966) [-2402.453] (-2405.124) (-2403.938) * [-2398.491] (-2409.134) (-2405.453) (-2400.962) -- 0:02:32
      566500 -- (-2403.052) (-2414.498) [-2401.898] (-2405.670) * (-2403.017) [-2398.114] (-2404.266) (-2403.786) -- 0:02:32
      567000 -- (-2404.907) (-2404.581) [-2409.078] (-2404.680) * (-2399.013) (-2410.576) (-2399.674) [-2405.658] -- 0:02:31
      567500 -- (-2404.578) (-2407.747) [-2406.429] (-2409.781) * (-2401.958) (-2410.322) (-2409.837) [-2403.461] -- 0:02:31
      568000 -- [-2400.642] (-2404.437) (-2401.002) (-2400.512) * (-2405.856) (-2406.767) [-2403.475] (-2405.028) -- 0:02:31
      568500 -- (-2407.012) (-2409.275) [-2410.587] (-2403.023) * (-2406.923) (-2412.759) [-2398.058] (-2406.596) -- 0:02:31
      569000 -- (-2408.162) [-2401.651] (-2399.688) (-2400.816) * [-2402.443] (-2401.353) (-2407.245) (-2409.246) -- 0:02:31
      569500 -- (-2399.413) [-2404.286] (-2409.169) (-2402.630) * (-2412.864) (-2402.874) [-2398.729] (-2402.334) -- 0:02:31
      570000 -- [-2404.911] (-2397.721) (-2405.268) (-2403.047) * (-2409.604) [-2396.833] (-2404.801) (-2403.379) -- 0:02:30

      Average standard deviation of split frequencies: 0.009252

      570500 -- (-2408.372) [-2398.847] (-2413.729) (-2407.297) * (-2406.523) [-2401.367] (-2403.198) (-2404.150) -- 0:02:30
      571000 -- (-2404.158) [-2398.965] (-2399.530) (-2403.812) * [-2396.301] (-2404.139) (-2401.752) (-2408.218) -- 0:02:30
      571500 -- (-2401.115) [-2402.448] (-2407.654) (-2410.268) * (-2411.249) (-2406.423) [-2403.346] (-2414.655) -- 0:02:29
      572000 -- (-2397.850) (-2402.656) (-2405.239) [-2401.327] * (-2398.259) (-2400.013) [-2402.509] (-2407.329) -- 0:02:30
      572500 -- [-2405.723] (-2399.630) (-2397.351) (-2405.019) * (-2404.711) (-2399.738) [-2401.593] (-2404.439) -- 0:02:30
      573000 -- (-2407.701) (-2400.846) [-2402.920] (-2405.266) * (-2399.872) [-2399.142] (-2402.383) (-2407.528) -- 0:02:29
      573500 -- [-2404.660] (-2399.526) (-2402.998) (-2406.176) * (-2402.477) [-2404.049] (-2403.707) (-2411.509) -- 0:02:29
      574000 -- (-2406.601) (-2403.599) [-2403.792] (-2414.919) * (-2398.039) (-2410.031) [-2410.663] (-2409.071) -- 0:02:29
      574500 -- [-2404.271] (-2403.529) (-2403.665) (-2406.504) * (-2406.593) (-2400.457) (-2406.523) [-2401.423] -- 0:02:28
      575000 -- [-2404.936] (-2412.366) (-2405.146) (-2405.552) * (-2406.768) [-2404.588] (-2403.472) (-2398.628) -- 0:02:29

      Average standard deviation of split frequencies: 0.007857

      575500 -- (-2398.551) [-2412.542] (-2407.623) (-2413.210) * (-2409.215) [-2403.620] (-2399.511) (-2408.310) -- 0:02:28
      576000 -- (-2406.991) (-2396.565) [-2397.913] (-2400.331) * (-2401.163) [-2399.749] (-2401.420) (-2409.648) -- 0:02:28
      576500 -- (-2404.136) [-2407.931] (-2415.383) (-2397.511) * (-2401.567) (-2412.931) (-2401.014) [-2402.820] -- 0:02:28
      577000 -- [-2394.711] (-2404.460) (-2405.932) (-2412.942) * (-2404.480) [-2401.137] (-2407.609) (-2407.011) -- 0:02:28
      577500 -- (-2398.844) [-2402.215] (-2403.549) (-2410.101) * (-2402.578) (-2403.513) (-2404.976) [-2401.215] -- 0:02:27
      578000 -- (-2400.503) (-2401.501) (-2410.097) [-2403.518] * (-2398.566) [-2400.759] (-2405.873) (-2399.840) -- 0:02:28
      578500 -- [-2399.442] (-2398.002) (-2400.850) (-2406.627) * (-2405.771) (-2397.129) (-2402.819) [-2404.300] -- 0:02:27
      579000 -- [-2396.759] (-2403.455) (-2410.189) (-2406.762) * (-2412.116) (-2408.298) [-2397.959] (-2401.784) -- 0:02:27
      579500 -- (-2411.693) (-2399.737) [-2408.623] (-2412.567) * [-2406.822] (-2401.310) (-2404.219) (-2414.861) -- 0:02:27
      580000 -- (-2401.891) [-2404.113] (-2410.625) (-2407.875) * (-2408.003) (-2405.099) [-2404.264] (-2412.184) -- 0:02:27

      Average standard deviation of split frequencies: 0.008768

      580500 -- (-2399.774) (-2403.077) [-2407.917] (-2413.447) * (-2406.243) (-2400.738) (-2399.319) [-2406.256] -- 0:02:27
      581000 -- (-2405.124) [-2402.661] (-2415.714) (-2410.291) * (-2402.300) (-2402.337) (-2402.115) [-2412.395] -- 0:02:27
      581500 -- [-2398.911] (-2400.303) (-2404.944) (-2404.640) * (-2399.940) (-2406.091) (-2405.360) [-2411.769] -- 0:02:26
      582000 -- (-2405.343) (-2404.621) [-2402.498] (-2399.492) * (-2410.725) (-2403.592) [-2400.962] (-2404.251) -- 0:02:26
      582500 -- (-2413.175) [-2406.076] (-2403.241) (-2405.116) * (-2406.577) [-2403.134] (-2408.143) (-2409.457) -- 0:02:26
      583000 -- (-2403.295) (-2403.170) [-2400.354] (-2401.223) * [-2404.153] (-2401.241) (-2405.603) (-2403.816) -- 0:02:25
      583500 -- [-2401.722] (-2412.241) (-2402.031) (-2401.851) * (-2409.942) (-2407.118) [-2402.203] (-2404.817) -- 0:02:26
      584000 -- [-2411.283] (-2404.082) (-2401.276) (-2401.595) * (-2404.486) (-2406.991) [-2399.937] (-2405.874) -- 0:02:26
      584500 -- (-2405.742) (-2415.089) (-2399.566) [-2402.121] * (-2407.355) [-2406.879] (-2413.363) (-2412.517) -- 0:02:25
      585000 -- (-2405.592) [-2407.252] (-2401.022) (-2402.406) * [-2403.551] (-2401.161) (-2406.683) (-2407.006) -- 0:02:25

      Average standard deviation of split frequencies: 0.009332

      585500 -- (-2407.073) (-2415.086) (-2402.911) [-2406.942] * [-2401.276] (-2403.144) (-2406.427) (-2403.329) -- 0:02:25
      586000 -- (-2405.489) (-2402.121) [-2404.001] (-2409.531) * (-2420.725) (-2395.382) [-2402.961] (-2401.082) -- 0:02:24
      586500 -- (-2409.330) (-2401.349) (-2410.010) [-2402.089] * (-2419.018) (-2408.013) (-2402.602) [-2399.227] -- 0:02:25
      587000 -- (-2401.721) [-2400.067] (-2401.419) (-2405.077) * [-2407.739] (-2402.172) (-2404.156) (-2403.417) -- 0:02:24
      587500 -- (-2403.885) (-2411.266) [-2399.048] (-2398.775) * [-2410.839] (-2402.473) (-2405.856) (-2408.927) -- 0:02:24
      588000 -- (-2397.347) [-2402.664] (-2404.701) (-2401.411) * (-2410.483) (-2401.073) (-2405.756) [-2400.970] -- 0:02:24
      588500 -- (-2409.531) (-2401.298) [-2404.877] (-2409.895) * (-2399.736) (-2407.336) (-2400.383) [-2400.553] -- 0:02:24
      589000 -- [-2398.855] (-2407.110) (-2402.723) (-2404.352) * (-2405.488) [-2407.477] (-2400.328) (-2402.811) -- 0:02:24
      589500 -- (-2408.307) [-2398.108] (-2402.962) (-2416.294) * (-2401.667) (-2409.636) [-2397.925] (-2400.852) -- 0:02:24
      590000 -- (-2405.434) (-2404.015) [-2407.353] (-2407.500) * [-2402.773] (-2399.742) (-2410.752) (-2399.449) -- 0:02:23

      Average standard deviation of split frequencies: 0.008619

      590500 -- (-2409.938) [-2403.752] (-2399.147) (-2408.148) * (-2404.534) (-2404.644) [-2403.011] (-2408.560) -- 0:02:23
      591000 -- (-2405.313) (-2402.500) (-2399.583) [-2409.641] * (-2403.543) [-2400.853] (-2409.140) (-2410.331) -- 0:02:23
      591500 -- [-2396.085] (-2403.450) (-2405.103) (-2404.048) * [-2403.242] (-2403.281) (-2402.544) (-2413.714) -- 0:02:22
      592000 -- [-2398.881] (-2407.854) (-2404.075) (-2404.896) * (-2401.937) [-2399.267] (-2407.422) (-2400.059) -- 0:02:23
      592500 -- (-2410.768) (-2404.830) (-2413.542) [-2405.152] * (-2403.422) [-2411.125] (-2404.407) (-2407.815) -- 0:02:23
      593000 -- (-2401.003) (-2407.431) (-2405.294) [-2402.608] * (-2399.891) [-2395.327] (-2404.700) (-2408.361) -- 0:02:22
      593500 -- [-2402.739] (-2411.624) (-2403.014) (-2403.643) * (-2403.411) [-2407.338] (-2405.522) (-2412.758) -- 0:02:22
      594000 -- (-2417.184) (-2398.706) (-2403.415) [-2398.916] * (-2404.285) (-2401.526) [-2405.291] (-2401.988) -- 0:02:22
      594500 -- (-2397.909) [-2399.201] (-2401.946) (-2396.829) * (-2403.504) [-2410.135] (-2406.424) (-2400.790) -- 0:02:21
      595000 -- (-2405.583) (-2404.958) (-2407.055) [-2400.875] * (-2406.667) [-2406.979] (-2405.582) (-2399.934) -- 0:02:22

      Average standard deviation of split frequencies: 0.007277

      595500 -- (-2400.678) (-2408.370) [-2400.291] (-2404.490) * (-2413.224) [-2401.400] (-2407.821) (-2403.799) -- 0:02:21
      596000 -- (-2408.501) [-2413.409] (-2403.764) (-2401.625) * [-2407.623] (-2402.156) (-2404.456) (-2401.485) -- 0:02:21
      596500 -- (-2415.926) (-2411.122) (-2400.199) [-2396.860] * (-2403.330) (-2404.210) (-2403.377) [-2402.543] -- 0:02:21
      597000 -- [-2403.632] (-2406.177) (-2407.512) (-2401.606) * (-2402.437) [-2406.152] (-2400.134) (-2402.306) -- 0:02:21
      597500 -- (-2408.072) [-2402.266] (-2408.984) (-2402.657) * (-2409.288) (-2403.683) [-2401.486] (-2399.667) -- 0:02:21
      598000 -- [-2399.679] (-2402.317) (-2405.634) (-2402.759) * [-2400.176] (-2412.244) (-2396.660) (-2407.744) -- 0:02:21
      598500 -- (-2411.184) (-2406.103) (-2404.880) [-2400.490] * (-2408.324) (-2402.829) [-2406.423] (-2407.059) -- 0:02:20
      599000 -- (-2402.900) (-2397.592) [-2400.238] (-2403.277) * (-2398.984) (-2403.439) [-2404.774] (-2407.631) -- 0:02:20
      599500 -- [-2402.789] (-2403.720) (-2402.492) (-2410.957) * (-2401.044) (-2402.390) (-2407.693) [-2406.759] -- 0:02:20
      600000 -- (-2403.552) [-2404.460] (-2401.910) (-2401.002) * (-2406.197) [-2405.206] (-2406.319) (-2407.084) -- 0:02:20

      Average standard deviation of split frequencies: 0.006592

      600500 -- (-2405.096) (-2408.248) [-2408.628] (-2396.388) * (-2405.617) [-2409.872] (-2403.447) (-2402.199) -- 0:02:20
      601000 -- (-2412.914) (-2404.475) (-2405.206) [-2393.856] * (-2401.838) (-2400.799) [-2400.113] (-2401.610) -- 0:02:20
      601500 -- (-2404.562) (-2410.147) (-2401.702) [-2405.171] * (-2405.952) (-2408.937) [-2406.407] (-2403.487) -- 0:02:19
      602000 -- (-2405.924) (-2408.562) (-2397.006) [-2401.375] * (-2409.945) (-2398.768) [-2401.274] (-2399.604) -- 0:02:19
      602500 -- (-2409.644) (-2401.287) [-2400.227] (-2408.927) * (-2404.135) (-2400.827) (-2402.360) [-2403.310] -- 0:02:19
      603000 -- (-2402.633) (-2401.389) [-2399.947] (-2410.182) * (-2405.945) [-2395.962] (-2408.317) (-2404.295) -- 0:02:18
      603500 -- (-2405.969) (-2401.738) [-2408.863] (-2414.219) * (-2402.233) (-2405.503) (-2406.121) [-2399.957] -- 0:02:19
      604000 -- (-2401.229) (-2404.138) [-2407.796] (-2413.043) * (-2400.932) (-2400.621) [-2397.773] (-2404.074) -- 0:02:18
      604500 -- (-2401.388) (-2406.504) [-2402.350] (-2416.457) * (-2402.196) (-2399.264) (-2403.102) [-2406.731] -- 0:02:18
      605000 -- (-2401.077) (-2403.902) (-2400.903) [-2399.777] * (-2399.043) (-2400.872) [-2401.222] (-2408.398) -- 0:02:18

      Average standard deviation of split frequencies: 0.007779

      605500 -- (-2403.378) [-2400.270] (-2411.161) (-2407.796) * (-2404.527) (-2399.400) [-2406.661] (-2404.948) -- 0:02:18
      606000 -- (-2404.530) (-2403.291) [-2400.299] (-2404.523) * (-2405.879) (-2402.179) (-2412.724) [-2400.110] -- 0:02:17
      606500 -- [-2402.957] (-2400.928) (-2403.379) (-2408.926) * (-2402.177) (-2403.229) [-2401.400] (-2408.025) -- 0:02:18
      607000 -- (-2409.140) [-2403.053] (-2401.917) (-2409.590) * (-2409.281) [-2405.374] (-2405.741) (-2403.271) -- 0:02:17
      607500 -- (-2400.410) (-2403.094) (-2407.455) [-2397.540] * (-2408.296) (-2397.854) [-2406.788] (-2405.968) -- 0:02:17
      608000 -- (-2403.046) (-2405.386) (-2405.218) [-2405.625] * (-2406.730) (-2403.675) [-2406.049] (-2401.697) -- 0:02:17
      608500 -- (-2399.983) [-2400.478] (-2408.700) (-2400.428) * (-2400.779) (-2404.081) (-2405.858) [-2403.518] -- 0:02:17
      609000 -- [-2397.901] (-2404.048) (-2407.777) (-2408.801) * (-2402.751) (-2401.986) (-2407.327) [-2399.569] -- 0:02:17
      609500 -- (-2400.966) (-2406.822) (-2402.946) [-2403.821] * [-2402.653] (-2401.130) (-2402.110) (-2401.639) -- 0:02:17
      610000 -- (-2404.013) (-2411.331) [-2402.711] (-2406.029) * (-2409.789) (-2406.081) [-2399.342] (-2402.594) -- 0:02:16

      Average standard deviation of split frequencies: 0.006793

      610500 -- [-2403.615] (-2408.574) (-2406.667) (-2404.091) * (-2406.667) [-2399.633] (-2405.219) (-2401.140) -- 0:02:16
      611000 -- (-2412.489) (-2404.404) (-2405.813) [-2403.353] * [-2406.757] (-2401.632) (-2402.327) (-2411.631) -- 0:02:16
      611500 -- [-2398.591] (-2409.985) (-2405.261) (-2404.150) * (-2401.097) [-2405.600] (-2398.124) (-2399.983) -- 0:02:15
      612000 -- [-2402.644] (-2405.096) (-2406.236) (-2405.667) * [-2399.814] (-2405.987) (-2403.258) (-2407.797) -- 0:02:16
      612500 -- (-2401.321) [-2409.215] (-2407.334) (-2403.416) * (-2401.258) (-2410.404) (-2405.530) [-2401.254] -- 0:02:16
      613000 -- [-2399.993] (-2400.623) (-2394.817) (-2413.557) * [-2400.684] (-2402.210) (-2401.491) (-2403.323) -- 0:02:15
      613500 -- [-2400.867] (-2396.675) (-2412.816) (-2401.116) * (-2413.543) [-2401.355] (-2408.054) (-2402.434) -- 0:02:15
      614000 -- (-2403.669) [-2402.314] (-2415.035) (-2402.576) * [-2409.261] (-2406.771) (-2409.071) (-2404.213) -- 0:02:15
      614500 -- [-2407.686] (-2400.591) (-2405.095) (-2401.023) * [-2404.955] (-2402.539) (-2402.985) (-2406.251) -- 0:02:14
      615000 -- (-2399.742) (-2408.430) (-2400.391) [-2405.334] * [-2400.438] (-2398.290) (-2417.648) (-2406.553) -- 0:02:15

      Average standard deviation of split frequencies: 0.006734

      615500 -- (-2407.527) (-2414.073) [-2398.058] (-2404.793) * [-2403.755] (-2407.642) (-2415.286) (-2402.293) -- 0:02:14
      616000 -- (-2411.013) (-2400.354) [-2404.551] (-2400.339) * (-2400.508) (-2405.074) (-2407.130) [-2406.367] -- 0:02:14
      616500 -- (-2415.812) (-2404.966) (-2399.485) [-2398.602] * (-2405.723) [-2402.942] (-2406.392) (-2409.605) -- 0:02:14
      617000 -- (-2413.504) (-2410.501) (-2406.491) [-2402.481] * (-2402.161) [-2398.508] (-2406.588) (-2402.029) -- 0:02:14
      617500 -- [-2402.370] (-2405.475) (-2405.480) (-2405.709) * (-2403.664) [-2399.180] (-2406.226) (-2404.727) -- 0:02:13
      618000 -- (-2401.853) (-2405.666) (-2403.222) [-2400.632] * (-2400.205) (-2415.914) (-2408.831) [-2402.243] -- 0:02:14
      618500 -- (-2405.836) (-2407.760) (-2401.806) [-2401.182] * (-2396.861) [-2410.594] (-2406.767) (-2404.304) -- 0:02:13
      619000 -- (-2403.840) [-2404.417] (-2407.028) (-2404.866) * (-2403.019) [-2402.097] (-2399.811) (-2409.802) -- 0:02:13
      619500 -- (-2399.981) (-2421.999) [-2402.797] (-2410.334) * [-2400.862] (-2408.028) (-2402.096) (-2411.930) -- 0:02:13
      620000 -- (-2401.541) [-2406.087] (-2414.198) (-2407.668) * (-2400.061) (-2408.958) [-2403.729] (-2399.601) -- 0:02:13

      Average standard deviation of split frequencies: 0.006076

      620500 -- (-2403.743) [-2409.209] (-2406.560) (-2400.980) * (-2407.550) (-2406.684) (-2403.580) [-2405.463] -- 0:02:13
      621000 -- (-2402.788) (-2405.815) [-2405.600] (-2408.478) * (-2400.099) (-2406.932) (-2401.816) [-2399.881] -- 0:02:13
      621500 -- (-2402.871) (-2404.812) (-2404.639) [-2400.824] * [-2400.916] (-2409.160) (-2404.049) (-2406.860) -- 0:02:12
      622000 -- (-2401.906) (-2403.188) (-2406.478) [-2403.506] * (-2403.227) [-2400.946] (-2404.438) (-2404.168) -- 0:02:12
      622500 -- (-2405.620) [-2405.066] (-2409.830) (-2405.050) * (-2399.920) [-2399.080] (-2402.585) (-2400.010) -- 0:02:12
      623000 -- (-2406.178) [-2403.367] (-2408.136) (-2404.316) * [-2400.692] (-2402.487) (-2400.550) (-2395.092) -- 0:02:11
      623500 -- (-2409.700) [-2405.443] (-2403.919) (-2402.286) * (-2404.828) [-2401.164] (-2412.766) (-2399.429) -- 0:02:12
      624000 -- (-2414.581) (-2411.552) (-2403.324) [-2399.942] * (-2409.057) (-2406.482) [-2403.956] (-2398.851) -- 0:02:11
      624500 -- (-2400.995) (-2408.517) [-2403.470] (-2399.256) * [-2407.346] (-2407.848) (-2406.698) (-2400.968) -- 0:02:11
      625000 -- (-2405.619) (-2409.548) [-2408.777] (-2405.222) * [-2404.336] (-2401.615) (-2405.023) (-2403.862) -- 0:02:11

      Average standard deviation of split frequencies: 0.006024

      625500 -- (-2405.644) (-2407.658) (-2405.886) [-2398.176] * (-2403.224) (-2400.171) [-2406.339] (-2405.403) -- 0:02:11
      626000 -- [-2406.665] (-2406.176) (-2407.554) (-2395.572) * (-2402.036) [-2401.234] (-2409.048) (-2403.384) -- 0:02:10
      626500 -- (-2419.691) [-2413.898] (-2405.537) (-2402.354) * [-2400.954] (-2402.258) (-2405.603) (-2405.683) -- 0:02:11
      627000 -- (-2400.874) (-2415.114) (-2401.299) [-2401.937] * (-2399.647) (-2397.839) (-2402.620) [-2406.373] -- 0:02:10
      627500 -- (-2403.135) (-2413.710) (-2408.743) [-2401.584] * (-2400.167) (-2403.621) [-2407.516] (-2402.383) -- 0:02:10
      628000 -- (-2399.241) [-2410.132] (-2411.128) (-2409.478) * (-2408.939) (-2402.764) [-2406.989] (-2404.009) -- 0:02:10
      628500 -- [-2399.945] (-2400.618) (-2407.757) (-2408.742) * (-2411.268) [-2403.679] (-2402.254) (-2406.148) -- 0:02:10
      629000 -- (-2400.343) (-2404.274) [-2403.396] (-2409.097) * (-2401.900) (-2411.980) (-2408.842) [-2395.431] -- 0:02:10
      629500 -- (-2399.551) (-2404.715) [-2408.090] (-2405.085) * [-2404.377] (-2405.955) (-2416.161) (-2401.885) -- 0:02:10
      630000 -- (-2400.115) (-2401.433) [-2405.636] (-2404.239) * (-2420.018) (-2405.037) (-2407.994) [-2401.826] -- 0:02:09

      Average standard deviation of split frequencies: 0.005083

      630500 -- (-2400.471) (-2406.958) [-2401.187] (-2404.653) * (-2402.877) (-2402.843) (-2407.160) [-2402.223] -- 0:02:09
      631000 -- [-2401.787] (-2403.277) (-2410.994) (-2405.745) * (-2406.178) [-2400.468] (-2411.905) (-2398.759) -- 0:02:09
      631500 -- (-2403.667) (-2401.917) (-2402.102) [-2408.856] * (-2410.298) (-2402.786) [-2409.111] (-2399.622) -- 0:02:08
      632000 -- (-2403.224) (-2401.252) (-2400.329) [-2402.173] * (-2409.615) (-2400.936) (-2399.711) [-2404.343] -- 0:02:09
      632500 -- (-2402.881) [-2402.745] (-2406.576) (-2401.462) * (-2410.499) (-2406.777) [-2400.960] (-2413.411) -- 0:02:08
      633000 -- [-2396.890] (-2402.743) (-2408.117) (-2405.356) * (-2406.821) (-2406.083) (-2403.361) [-2404.095] -- 0:02:08
      633500 -- (-2401.042) (-2411.794) (-2408.763) [-2403.281] * (-2414.606) (-2405.337) (-2412.982) [-2398.675] -- 0:02:08
      634000 -- (-2404.394) [-2404.016] (-2399.089) (-2412.173) * (-2405.896) (-2410.424) [-2405.494] (-2412.093) -- 0:02:08
      634500 -- (-2411.394) (-2401.281) (-2400.020) [-2406.203] * (-2400.362) (-2405.797) [-2409.098] (-2406.805) -- 0:02:07
      635000 -- (-2401.614) (-2404.690) (-2403.820) [-2406.181] * (-2408.463) [-2403.251] (-2405.320) (-2401.462) -- 0:02:08

      Average standard deviation of split frequencies: 0.004744

      635500 -- (-2400.163) (-2404.858) [-2403.719] (-2404.927) * (-2400.689) (-2404.475) [-2398.409] (-2408.556) -- 0:02:07
      636000 -- (-2402.182) (-2408.095) [-2403.798] (-2411.963) * [-2405.668] (-2396.597) (-2404.514) (-2412.096) -- 0:02:07
      636500 -- (-2407.323) [-2412.635] (-2403.454) (-2401.810) * (-2408.330) (-2399.164) (-2400.686) [-2403.281] -- 0:02:07
      637000 -- (-2410.031) (-2401.733) (-2402.760) [-2402.043] * (-2408.497) [-2407.942] (-2401.767) (-2412.893) -- 0:02:07
      637500 -- [-2402.296] (-2395.623) (-2408.774) (-2410.465) * (-2400.897) (-2410.266) [-2401.382] (-2400.023) -- 0:02:06
      638000 -- (-2408.821) [-2398.038] (-2402.255) (-2404.935) * (-2400.820) (-2399.965) [-2406.893] (-2400.172) -- 0:02:07
      638500 -- [-2402.365] (-2397.625) (-2403.271) (-2408.807) * (-2410.695) (-2400.830) (-2401.055) [-2400.472] -- 0:02:06
      639000 -- (-2404.218) [-2402.272] (-2400.940) (-2400.337) * (-2401.830) [-2401.167] (-2414.977) (-2404.259) -- 0:02:06
      639500 -- (-2396.267) [-2406.956] (-2407.751) (-2407.484) * (-2409.122) [-2405.122] (-2410.362) (-2405.941) -- 0:02:06
      640000 -- [-2399.132] (-2406.386) (-2401.923) (-2403.459) * (-2400.748) (-2402.069) (-2402.546) [-2404.589] -- 0:02:06

      Average standard deviation of split frequencies: 0.005003

      640500 -- (-2402.037) (-2407.128) [-2402.938] (-2404.793) * (-2404.843) (-2407.220) [-2398.799] (-2408.754) -- 0:02:06
      641000 -- (-2399.976) [-2405.204] (-2396.617) (-2401.039) * (-2401.083) [-2398.803] (-2407.659) (-2414.290) -- 0:02:06
      641500 -- [-2402.328] (-2411.517) (-2400.631) (-2400.771) * [-2399.770] (-2405.830) (-2404.343) (-2403.035) -- 0:02:05
      642000 -- [-2399.251] (-2408.677) (-2396.360) (-2412.791) * [-2398.970] (-2399.654) (-2402.656) (-2400.529) -- 0:02:05
      642500 -- (-2400.651) (-2402.781) (-2405.199) [-2403.251] * (-2401.780) [-2401.057] (-2402.008) (-2402.648) -- 0:02:05
      643000 -- [-2408.737] (-2400.546) (-2408.325) (-2406.942) * (-2404.140) [-2404.141] (-2406.807) (-2399.050) -- 0:02:04
      643500 -- (-2406.480) (-2401.489) (-2410.741) [-2399.910] * [-2405.073] (-2416.112) (-2407.026) (-2404.610) -- 0:02:05
      644000 -- (-2402.173) (-2401.561) (-2408.555) [-2401.287] * (-2408.793) (-2408.326) [-2403.152] (-2402.040) -- 0:02:04
      644500 -- (-2399.537) (-2403.199) [-2400.182] (-2409.440) * (-2401.566) [-2403.954] (-2409.751) (-2404.279) -- 0:02:04
      645000 -- (-2406.505) (-2403.307) (-2400.601) [-2406.711] * (-2404.235) [-2404.080] (-2408.377) (-2406.087) -- 0:02:04

      Average standard deviation of split frequencies: 0.006714

      645500 -- (-2400.580) (-2401.734) (-2406.010) [-2405.607] * (-2406.497) (-2402.565) (-2414.382) [-2397.582] -- 0:02:04
      646000 -- [-2400.611] (-2411.468) (-2401.967) (-2405.540) * [-2404.517] (-2395.766) (-2410.097) (-2405.089) -- 0:02:03
      646500 -- (-2417.723) [-2400.292] (-2412.210) (-2408.414) * [-2401.017] (-2402.167) (-2405.323) (-2409.786) -- 0:02:04
      647000 -- [-2408.165] (-2405.496) (-2408.954) (-2405.947) * [-2404.487] (-2404.758) (-2399.684) (-2396.186) -- 0:02:03
      647500 -- (-2403.218) (-2399.495) [-2403.410] (-2402.337) * [-2403.323] (-2404.468) (-2405.028) (-2410.476) -- 0:02:03
      648000 -- (-2403.744) [-2402.485] (-2418.438) (-2403.278) * (-2409.941) (-2404.783) (-2406.563) [-2402.861] -- 0:02:03
      648500 -- (-2409.776) (-2403.164) (-2403.269) [-2406.284] * (-2406.913) [-2402.534] (-2406.381) (-2402.939) -- 0:02:03
      649000 -- (-2403.310) (-2406.847) [-2402.035] (-2403.618) * (-2405.988) (-2404.313) (-2403.427) [-2400.760] -- 0:02:02
      649500 -- [-2402.965] (-2407.188) (-2406.853) (-2411.396) * (-2406.951) (-2395.811) [-2404.469] (-2406.561) -- 0:02:03
      650000 -- (-2398.402) (-2407.758) [-2396.412] (-2408.295) * [-2406.682] (-2401.500) (-2414.132) (-2398.552) -- 0:02:02

      Average standard deviation of split frequencies: 0.006955

      650500 -- (-2405.346) [-2408.679] (-2401.010) (-2410.119) * (-2405.053) (-2404.043) (-2402.690) [-2405.979] -- 0:02:02
      651000 -- [-2394.454] (-2414.357) (-2401.756) (-2407.314) * [-2402.630] (-2404.482) (-2403.589) (-2401.943) -- 0:02:02
      651500 -- (-2399.764) (-2405.091) [-2404.063] (-2403.570) * (-2401.326) (-2399.027) (-2400.355) [-2398.184] -- 0:02:01
      652000 -- (-2408.094) [-2414.463] (-2404.840) (-2401.506) * [-2402.378] (-2401.714) (-2404.487) (-2401.531) -- 0:02:01
      652500 -- [-2407.466] (-2412.714) (-2404.911) (-2402.057) * (-2401.953) [-2399.919] (-2414.434) (-2399.452) -- 0:02:01
      653000 -- (-2408.452) (-2402.185) [-2404.033] (-2405.565) * (-2404.575) [-2395.954] (-2401.157) (-2405.805) -- 0:02:01
      653500 -- (-2404.751) (-2403.265) [-2402.806] (-2405.250) * (-2408.663) (-2402.396) (-2405.195) [-2400.749] -- 0:02:01
      654000 -- (-2405.555) [-2402.527] (-2396.410) (-2407.947) * (-2402.471) (-2405.243) [-2402.162] (-2406.336) -- 0:02:01
      654500 -- (-2400.747) [-2402.990] (-2411.947) (-2408.996) * [-2403.999] (-2401.735) (-2400.775) (-2410.800) -- 0:02:00
      655000 -- (-2402.818) (-2400.844) [-2400.097] (-2409.577) * [-2412.553] (-2401.038) (-2403.517) (-2400.257) -- 0:02:01

      Average standard deviation of split frequencies: 0.006611

      655500 -- [-2401.297] (-2411.745) (-2401.096) (-2408.530) * (-2408.936) (-2397.331) (-2404.024) [-2405.160] -- 0:02:00
      656000 -- (-2400.516) [-2402.218] (-2404.119) (-2408.856) * (-2415.059) (-2404.057) [-2405.870] (-2408.340) -- 0:02:00
      656500 -- [-2400.831] (-2407.413) (-2401.429) (-2404.433) * [-2404.244] (-2413.035) (-2401.833) (-2397.475) -- 0:02:00
      657000 -- (-2401.354) (-2404.495) (-2398.949) [-2398.971] * (-2404.701) (-2399.771) (-2400.563) [-2405.364] -- 0:02:00
      657500 -- (-2405.690) (-2406.480) (-2398.312) [-2405.335] * (-2407.360) (-2401.778) (-2407.046) [-2400.676] -- 0:01:59
      658000 -- (-2410.565) (-2400.574) (-2409.806) [-2399.490] * (-2407.886) (-2407.456) [-2399.646] (-2404.439) -- 0:02:00
      658500 -- (-2400.372) [-2400.783] (-2404.056) (-2403.826) * (-2397.194) (-2411.233) [-2406.666] (-2408.017) -- 0:01:59
      659000 -- (-2404.724) (-2406.197) [-2403.291] (-2407.686) * (-2402.794) (-2415.185) [-2394.700] (-2402.526) -- 0:01:59
      659500 -- (-2408.186) (-2401.183) [-2401.548] (-2403.720) * (-2408.878) (-2412.370) [-2401.476] (-2399.870) -- 0:01:59
      660000 -- (-2404.153) (-2402.366) [-2401.091] (-2403.964) * [-2404.862] (-2405.669) (-2403.547) (-2401.618) -- 0:01:59

      Average standard deviation of split frequencies: 0.006279

      660500 -- (-2400.744) (-2399.511) [-2413.512] (-2401.214) * (-2410.673) [-2404.465] (-2409.477) (-2400.034) -- 0:01:58
      661000 -- (-2400.779) [-2398.254] (-2397.714) (-2404.416) * [-2398.011] (-2402.984) (-2411.335) (-2402.931) -- 0:01:58
      661500 -- (-2399.759) (-2403.215) (-2402.559) [-2399.023] * [-2400.954] (-2401.950) (-2406.097) (-2416.730) -- 0:01:58
      662000 -- [-2402.445] (-2403.888) (-2404.996) (-2406.635) * (-2403.138) [-2399.894] (-2398.325) (-2404.517) -- 0:01:58
      662500 -- (-2398.961) (-2405.642) [-2402.221] (-2399.298) * (-2400.669) [-2401.261] (-2410.509) (-2406.453) -- 0:01:58
      663000 -- (-2402.433) (-2399.246) [-2404.716] (-2398.896) * (-2407.752) (-2402.851) (-2410.018) [-2396.309] -- 0:01:57
      663500 -- (-2406.593) (-2395.485) (-2404.524) [-2394.881] * (-2413.119) (-2408.905) (-2405.681) [-2401.225] -- 0:01:57
      664000 -- (-2410.244) (-2405.313) (-2403.995) [-2402.597] * (-2401.468) (-2411.534) (-2403.885) [-2402.500] -- 0:01:57
      664500 -- (-2414.931) (-2398.067) (-2400.297) [-2402.379] * (-2410.534) (-2404.703) [-2404.868] (-2404.912) -- 0:01:57
      665000 -- (-2396.855) (-2401.476) [-2399.249] (-2399.283) * [-2398.700] (-2402.141) (-2407.572) (-2403.612) -- 0:01:57

      Average standard deviation of split frequencies: 0.005096

      665500 -- (-2406.352) [-2403.394] (-2409.306) (-2401.835) * (-2408.139) [-2411.504] (-2401.571) (-2406.337) -- 0:01:57
      666000 -- (-2406.462) (-2407.264) (-2400.120) [-2402.702] * [-2407.016] (-2403.705) (-2409.778) (-2404.991) -- 0:01:56
      666500 -- (-2408.675) [-2404.628] (-2412.586) (-2403.486) * (-2399.230) (-2401.076) (-2406.388) [-2404.306] -- 0:01:57
      667000 -- [-2399.918] (-2405.625) (-2406.494) (-2408.457) * (-2403.368) (-2397.873) (-2401.400) [-2404.779] -- 0:01:56
      667500 -- (-2399.637) [-2407.123] (-2404.228) (-2406.375) * (-2398.793) (-2398.939) [-2400.186] (-2397.569) -- 0:01:56
      668000 -- (-2400.045) (-2399.296) [-2398.532] (-2398.599) * (-2400.066) [-2403.231] (-2404.497) (-2404.306) -- 0:01:56
      668500 -- [-2402.985] (-2399.482) (-2401.724) (-2408.134) * (-2401.220) (-2411.137) [-2406.685] (-2405.004) -- 0:01:56
      669000 -- (-2412.330) (-2405.573) (-2401.118) [-2402.418] * [-2400.091] (-2402.973) (-2406.003) (-2409.561) -- 0:01:55
      669500 -- (-2411.550) (-2406.952) (-2400.438) [-2409.361] * (-2402.491) (-2409.691) [-2406.847] (-2402.662) -- 0:01:56
      670000 -- (-2402.065) [-2405.047] (-2400.025) (-2410.693) * (-2399.403) (-2399.701) (-2414.507) [-2404.477] -- 0:01:55

      Average standard deviation of split frequencies: 0.004639

      670500 -- [-2400.274] (-2399.556) (-2401.740) (-2405.919) * (-2400.930) [-2403.305] (-2403.107) (-2396.237) -- 0:01:55
      671000 -- [-2403.063] (-2398.295) (-2405.683) (-2404.188) * (-2409.941) (-2396.874) [-2403.859] (-2402.398) -- 0:01:55
      671500 -- (-2405.128) [-2401.468] (-2406.490) (-2408.116) * [-2402.192] (-2403.844) (-2413.142) (-2401.722) -- 0:01:54
      672000 -- (-2400.279) [-2406.728] (-2404.794) (-2402.408) * (-2402.421) [-2404.083] (-2408.402) (-2404.590) -- 0:01:54
      672500 -- (-2407.001) (-2404.344) (-2400.929) [-2400.655] * (-2407.804) (-2399.700) [-2398.798] (-2401.513) -- 0:01:54
      673000 -- (-2404.432) [-2404.219] (-2401.917) (-2399.541) * [-2401.065] (-2399.897) (-2401.573) (-2406.591) -- 0:01:54
      673500 -- (-2401.994) (-2406.912) [-2411.073] (-2407.726) * (-2411.658) [-2404.197] (-2406.101) (-2403.858) -- 0:01:54
      674000 -- (-2411.237) [-2404.796] (-2401.231) (-2405.601) * [-2398.295] (-2404.069) (-2404.952) (-2404.847) -- 0:01:54
      674500 -- (-2411.028) (-2403.253) [-2405.514] (-2405.594) * (-2402.050) (-2402.991) [-2402.814] (-2404.703) -- 0:01:53
      675000 -- [-2408.305] (-2400.984) (-2398.853) (-2403.981) * (-2409.304) (-2410.406) [-2403.731] (-2409.957) -- 0:01:53

      Average standard deviation of split frequencies: 0.004045

      675500 -- (-2405.107) (-2407.825) (-2404.754) [-2407.851] * (-2412.918) (-2407.386) (-2401.651) [-2406.809] -- 0:01:53
      676000 -- (-2405.735) (-2402.449) [-2406.673] (-2408.185) * [-2406.203] (-2405.068) (-2414.608) (-2417.047) -- 0:01:53
      676500 -- (-2401.607) [-2405.449] (-2403.513) (-2412.315) * (-2401.678) [-2408.345] (-2404.122) (-2409.269) -- 0:01:53
      677000 -- [-2405.345] (-2404.534) (-2403.229) (-2396.184) * [-2400.769] (-2406.832) (-2405.799) (-2409.442) -- 0:01:53
      677500 -- (-2404.564) (-2403.031) [-2400.925] (-2406.722) * (-2401.618) (-2402.059) [-2403.852] (-2396.668) -- 0:01:52
      678000 -- (-2402.301) [-2398.853] (-2407.018) (-2406.485) * (-2400.084) [-2399.626] (-2399.352) (-2413.603) -- 0:01:52
      678500 -- [-2398.920] (-2400.711) (-2408.255) (-2402.076) * [-2403.440] (-2401.639) (-2409.954) (-2408.591) -- 0:01:52
      679000 -- [-2399.012] (-2402.550) (-2405.346) (-2411.423) * (-2399.926) [-2402.726] (-2411.569) (-2399.969) -- 0:01:52
      679500 -- (-2404.313) (-2403.001) (-2412.152) [-2402.606] * (-2401.958) [-2399.215] (-2417.960) (-2402.986) -- 0:01:52
      680000 -- (-2399.713) [-2402.687] (-2401.468) (-2402.658) * (-2403.831) [-2399.822] (-2408.026) (-2401.943) -- 0:01:52

      Average standard deviation of split frequencies: 0.003186

      680500 -- (-2408.274) [-2404.506] (-2394.693) (-2410.830) * (-2406.023) (-2406.752) (-2402.365) [-2401.193] -- 0:01:51
      681000 -- [-2403.598] (-2409.111) (-2407.537) (-2401.007) * (-2413.129) (-2403.800) [-2401.588] (-2408.510) -- 0:01:51
      681500 -- [-2401.866] (-2407.539) (-2409.758) (-2405.185) * (-2414.459) (-2397.539) [-2403.389] (-2403.357) -- 0:01:51
      682000 -- (-2401.423) (-2401.784) (-2408.325) [-2401.101] * (-2409.138) [-2399.321] (-2401.400) (-2401.642) -- 0:01:51
      682500 -- (-2403.261) [-2402.717] (-2406.100) (-2403.340) * (-2406.839) (-2401.347) [-2402.007] (-2409.746) -- 0:01:51
      683000 -- (-2397.741) (-2398.866) (-2404.671) [-2402.338] * [-2405.750] (-2409.978) (-2404.978) (-2406.036) -- 0:01:50
      683500 -- [-2401.186] (-2401.063) (-2405.662) (-2401.674) * (-2400.706) [-2406.774] (-2402.572) (-2401.900) -- 0:01:50
      684000 -- [-2398.770] (-2410.169) (-2415.762) (-2399.915) * (-2401.651) (-2404.665) [-2400.512] (-2404.711) -- 0:01:50
      684500 -- (-2404.325) [-2402.598] (-2404.576) (-2404.514) * (-2405.554) (-2407.284) [-2402.030] (-2400.362) -- 0:01:50
      685000 -- (-2406.314) [-2398.553] (-2395.431) (-2410.483) * (-2408.712) (-2405.301) [-2402.615] (-2404.218) -- 0:01:50

      Average standard deviation of split frequencies: 0.004535

      685500 -- (-2408.246) (-2403.871) [-2399.843] (-2403.956) * (-2407.406) (-2406.322) (-2399.822) [-2403.037] -- 0:01:50
      686000 -- [-2405.362] (-2402.261) (-2404.954) (-2405.651) * (-2404.621) (-2406.705) [-2395.207] (-2409.113) -- 0:01:49
      686500 -- [-2407.165] (-2401.854) (-2404.864) (-2409.291) * (-2399.137) (-2411.712) [-2400.756] (-2397.064) -- 0:01:49
      687000 -- (-2404.354) [-2412.940] (-2407.005) (-2405.897) * (-2406.217) (-2410.832) (-2401.195) [-2405.345] -- 0:01:49
      687500 -- [-2402.074] (-2407.442) (-2404.483) (-2401.144) * (-2403.644) (-2403.513) (-2398.831) [-2405.611] -- 0:01:49
      688000 -- [-2404.615] (-2407.964) (-2401.214) (-2399.431) * (-2401.242) (-2399.676) (-2402.064) [-2404.866] -- 0:01:49
      688500 -- [-2402.079] (-2405.380) (-2402.386) (-2407.293) * (-2403.154) (-2399.596) (-2402.926) [-2398.115] -- 0:01:49
      689000 -- [-2400.228] (-2409.135) (-2403.250) (-2399.706) * (-2409.164) [-2399.873] (-2400.875) (-2401.660) -- 0:01:48
      689500 -- (-2402.325) (-2419.014) [-2406.356] (-2404.310) * (-2408.266) (-2405.679) [-2399.478] (-2397.731) -- 0:01:48
      690000 -- [-2401.319] (-2407.214) (-2407.854) (-2417.767) * (-2402.321) (-2402.947) (-2400.258) [-2400.986] -- 0:01:48

      Average standard deviation of split frequencies: 0.003959

      690500 -- (-2402.888) (-2407.491) [-2406.952] (-2407.111) * (-2402.651) (-2404.050) [-2399.369] (-2405.749) -- 0:01:48
      691000 -- (-2403.397) [-2407.765] (-2405.551) (-2406.803) * (-2405.866) (-2408.666) [-2403.597] (-2399.938) -- 0:01:48
      691500 -- (-2404.268) [-2399.059] (-2403.555) (-2405.215) * (-2410.748) (-2396.088) [-2406.607] (-2401.581) -- 0:01:47
      692000 -- (-2404.593) [-2407.845] (-2401.266) (-2400.988) * [-2409.098] (-2403.175) (-2403.653) (-2399.945) -- 0:01:47
      692500 -- (-2402.190) [-2411.725] (-2404.982) (-2404.351) * (-2407.258) [-2403.391] (-2408.436) (-2401.861) -- 0:01:47
      693000 -- (-2412.536) (-2404.759) (-2403.160) [-2399.207] * (-2413.806) [-2396.924] (-2403.219) (-2403.246) -- 0:01:47
      693500 -- (-2406.144) [-2402.843] (-2403.321) (-2405.857) * (-2410.880) [-2401.526] (-2414.303) (-2401.257) -- 0:01:47
      694000 -- (-2402.053) (-2400.910) (-2411.497) [-2402.417] * [-2406.117] (-2402.776) (-2410.069) (-2406.936) -- 0:01:47
      694500 -- (-2400.201) (-2411.769) [-2402.847] (-2407.280) * (-2408.118) [-2408.925] (-2403.667) (-2410.026) -- 0:01:46
      695000 -- (-2417.934) (-2418.209) [-2403.395] (-2403.024) * (-2402.962) (-2404.650) (-2408.177) [-2404.563] -- 0:01:46

      Average standard deviation of split frequencies: 0.003657

      695500 -- (-2403.243) (-2406.122) [-2406.671] (-2400.420) * (-2407.118) [-2411.018] (-2405.305) (-2403.296) -- 0:01:46
      696000 -- (-2399.589) (-2403.816) (-2405.549) [-2401.278] * (-2402.777) [-2405.539] (-2403.128) (-2405.027) -- 0:01:46
      696500 -- (-2401.886) (-2399.363) [-2401.532] (-2406.031) * (-2402.304) (-2400.477) (-2410.109) [-2404.432] -- 0:01:46
      697000 -- (-2407.262) [-2410.160] (-2399.608) (-2412.120) * (-2409.632) (-2406.829) [-2401.299] (-2404.418) -- 0:01:46
      697500 -- (-2402.991) (-2402.689) (-2401.832) [-2409.457] * [-2401.810] (-2409.421) (-2405.827) (-2401.680) -- 0:01:45
      698000 -- (-2403.162) (-2405.063) (-2402.004) [-2405.541] * (-2404.857) (-2407.779) (-2401.962) [-2397.440] -- 0:01:45
      698500 -- [-2404.850] (-2406.276) (-2408.451) (-2414.271) * (-2400.424) [-2402.519] (-2402.038) (-2411.583) -- 0:01:45
      699000 -- [-2403.031] (-2406.987) (-2400.324) (-2408.464) * (-2399.493) (-2406.478) [-2397.799] (-2404.570) -- 0:01:45
      699500 -- (-2399.231) (-2407.890) [-2401.995] (-2401.645) * (-2403.430) [-2403.496] (-2410.022) (-2402.860) -- 0:01:45
      700000 -- (-2407.628) (-2403.334) [-2401.809] (-2405.824) * [-2405.044] (-2401.453) (-2406.910) (-2401.432) -- 0:01:45

      Average standard deviation of split frequencies: 0.004171

      700500 -- (-2402.937) (-2405.022) (-2407.813) [-2399.198] * [-2409.257] (-2402.845) (-2404.667) (-2403.136) -- 0:01:44
      701000 -- (-2404.427) (-2401.906) (-2404.896) [-2404.245] * (-2413.542) [-2403.435] (-2404.923) (-2400.122) -- 0:01:44
      701500 -- [-2401.881] (-2414.169) (-2402.994) (-2412.045) * (-2403.320) (-2409.412) (-2407.559) [-2402.651] -- 0:01:44
      702000 -- (-2402.623) [-2403.839] (-2403.573) (-2408.488) * (-2398.505) [-2398.314] (-2407.129) (-2402.418) -- 0:01:44
      702500 -- (-2401.864) (-2398.939) [-2399.775] (-2402.313) * (-2393.529) (-2398.101) (-2402.658) [-2399.350] -- 0:01:44
      703000 -- (-2405.128) (-2412.575) (-2408.576) [-2395.615] * (-2405.548) [-2403.894] (-2401.473) (-2403.409) -- 0:01:43
      703500 -- (-2408.847) [-2407.823] (-2408.234) (-2396.663) * (-2408.123) [-2404.861] (-2412.289) (-2405.896) -- 0:01:43
      704000 -- (-2414.975) (-2404.817) [-2404.142] (-2400.888) * (-2410.141) [-2403.239] (-2399.755) (-2411.489) -- 0:01:43
      704500 -- (-2401.139) (-2398.945) (-2401.612) [-2407.248] * (-2403.163) (-2401.565) (-2409.325) [-2402.573] -- 0:01:43
      705000 -- [-2414.046] (-2404.220) (-2404.533) (-2405.009) * (-2403.101) (-2405.475) [-2400.066] (-2411.940) -- 0:01:43

      Average standard deviation of split frequencies: 0.004140

      705500 -- (-2406.878) [-2399.569] (-2404.188) (-2411.026) * (-2401.492) (-2404.603) [-2401.131] (-2408.861) -- 0:01:43
      706000 -- (-2401.193) (-2397.961) [-2401.725] (-2412.718) * (-2404.505) [-2403.792] (-2404.612) (-2402.804) -- 0:01:42
      706500 -- (-2406.518) [-2407.827] (-2414.472) (-2401.925) * (-2401.442) (-2399.647) [-2403.600] (-2411.386) -- 0:01:42
      707000 -- [-2406.022] (-2400.239) (-2398.819) (-2402.004) * (-2408.320) (-2405.000) (-2408.489) [-2406.515] -- 0:01:42
      707500 -- [-2398.162] (-2407.573) (-2404.343) (-2406.392) * (-2405.713) (-2405.780) [-2400.031] (-2398.952) -- 0:01:42
      708000 -- (-2405.277) [-2399.621] (-2413.057) (-2400.586) * (-2408.758) (-2413.658) [-2399.801] (-2400.452) -- 0:01:42
      708500 -- (-2407.745) (-2405.998) (-2408.519) [-2402.407] * (-2404.865) (-2401.432) [-2397.883] (-2401.427) -- 0:01:42
      709000 -- (-2406.577) (-2409.765) (-2405.570) [-2410.556] * [-2410.104] (-2403.685) (-2402.850) (-2409.670) -- 0:01:41
      709500 -- (-2414.162) [-2401.557] (-2409.478) (-2398.074) * (-2399.844) (-2403.246) (-2400.322) [-2399.731] -- 0:01:41
      710000 -- (-2405.158) (-2403.168) [-2402.629] (-2399.407) * (-2402.317) (-2404.764) (-2411.562) [-2398.601] -- 0:01:41

      Average standard deviation of split frequencies: 0.004378

      710500 -- (-2400.586) (-2397.408) [-2404.890] (-2409.239) * (-2399.385) (-2409.007) (-2406.675) [-2406.223] -- 0:01:41
      711000 -- (-2402.675) (-2401.087) (-2400.576) [-2400.453] * (-2400.267) (-2421.217) [-2402.626] (-2401.719) -- 0:01:41
      711500 -- (-2406.666) [-2400.592] (-2398.241) (-2401.031) * [-2401.067] (-2412.163) (-2398.527) (-2399.594) -- 0:01:40
      712000 -- (-2406.452) (-2403.166) (-2403.723) [-2399.993] * (-2398.833) (-2416.974) (-2399.661) [-2398.495] -- 0:01:40
      712500 -- [-2406.732] (-2398.620) (-2398.504) (-2405.509) * (-2397.400) (-2406.780) (-2403.837) [-2402.465] -- 0:01:40
      713000 -- (-2399.588) (-2403.130) (-2402.624) [-2403.971] * (-2403.986) (-2404.053) [-2402.474] (-2402.337) -- 0:01:40
      713500 -- (-2398.515) (-2400.772) (-2412.438) [-2398.125] * (-2411.372) [-2404.923] (-2402.600) (-2402.980) -- 0:01:40
      714000 -- (-2399.746) [-2401.631] (-2400.545) (-2405.159) * (-2402.483) (-2401.016) (-2405.998) [-2401.579] -- 0:01:40
      714500 -- (-2400.922) [-2403.029] (-2401.444) (-2403.035) * [-2406.084] (-2407.542) (-2405.022) (-2402.964) -- 0:01:39
      715000 -- (-2402.262) [-2402.180] (-2401.075) (-2400.826) * (-2401.385) (-2410.328) (-2407.369) [-2405.325] -- 0:01:39

      Average standard deviation of split frequencies: 0.004082

      715500 -- (-2407.782) (-2405.642) [-2407.255] (-2408.001) * [-2403.155] (-2405.416) (-2407.901) (-2402.487) -- 0:01:39
      716000 -- [-2406.898] (-2409.776) (-2409.797) (-2405.074) * [-2403.498] (-2400.435) (-2413.261) (-2402.259) -- 0:01:39
      716500 -- (-2408.503) [-2397.376] (-2403.098) (-2404.418) * [-2406.011] (-2412.600) (-2412.970) (-2411.288) -- 0:01:39
      717000 -- (-2410.303) [-2401.056] (-2401.316) (-2402.892) * (-2400.959) (-2405.185) (-2424.097) [-2400.427] -- 0:01:39
      717500 -- (-2401.489) (-2403.450) [-2403.533] (-2400.525) * [-2400.666] (-2411.233) (-2412.321) (-2404.845) -- 0:01:38
      718000 -- [-2404.871] (-2403.926) (-2402.372) (-2412.098) * (-2403.251) (-2407.131) (-2413.239) [-2406.483] -- 0:01:38
      718500 -- (-2402.525) (-2404.887) (-2407.724) [-2403.897] * (-2402.756) (-2408.922) [-2402.561] (-2403.413) -- 0:01:38
      719000 -- (-2407.429) (-2403.122) [-2402.043] (-2402.635) * [-2402.789] (-2397.601) (-2405.894) (-2406.243) -- 0:01:38
      719500 -- (-2409.835) [-2406.431] (-2400.968) (-2402.937) * [-2401.859] (-2400.962) (-2405.417) (-2406.959) -- 0:01:38
      720000 -- (-2408.747) (-2403.293) (-2407.251) [-2401.594] * (-2399.829) (-2398.938) [-2403.430] (-2409.490) -- 0:01:38

      Average standard deviation of split frequencies: 0.003532

      720500 -- (-2413.824) (-2398.328) (-2403.773) [-2399.383] * (-2400.729) (-2404.262) (-2399.177) [-2403.719] -- 0:01:37
      721000 -- (-2410.658) (-2394.456) (-2405.239) [-2409.812] * (-2409.584) [-2404.131] (-2404.805) (-2410.763) -- 0:01:37
      721500 -- (-2414.667) (-2398.384) (-2413.665) [-2402.768] * [-2408.550] (-2403.506) (-2403.347) (-2413.523) -- 0:01:37
      722000 -- (-2409.916) (-2403.369) [-2400.876] (-2403.223) * (-2403.164) (-2418.947) [-2402.698] (-2404.125) -- 0:01:37
      722500 -- (-2402.640) (-2409.589) [-2402.645] (-2396.216) * (-2403.686) (-2411.947) [-2402.951] (-2408.117) -- 0:01:37
      723000 -- [-2403.473] (-2409.655) (-2409.939) (-2403.217) * (-2398.443) [-2404.206] (-2403.010) (-2402.692) -- 0:01:36
      723500 -- (-2401.098) (-2406.959) [-2405.112] (-2404.006) * (-2397.936) [-2406.467] (-2408.161) (-2404.214) -- 0:01:36
      724000 -- [-2406.468] (-2410.875) (-2401.042) (-2404.505) * [-2401.037] (-2405.022) (-2401.115) (-2405.882) -- 0:01:36
      724500 -- (-2403.101) [-2401.376] (-2404.565) (-2406.028) * (-2401.391) (-2401.280) [-2403.141] (-2410.152) -- 0:01:36
      725000 -- (-2412.503) (-2402.697) [-2405.900] (-2403.007) * (-2407.079) (-2405.233) [-2399.982] (-2406.194) -- 0:01:36

      Average standard deviation of split frequencies: 0.003506

      725500 -- (-2411.217) (-2405.367) [-2399.249] (-2403.951) * [-2407.305] (-2402.417) (-2407.642) (-2402.128) -- 0:01:36
      726000 -- (-2399.510) [-2401.055] (-2412.529) (-2400.809) * [-2404.622] (-2397.965) (-2414.693) (-2414.784) -- 0:01:35
      726500 -- (-2409.555) (-2398.546) (-2401.229) [-2400.856] * [-2398.126] (-2406.693) (-2403.485) (-2404.238) -- 0:01:35
      727000 -- (-2417.433) (-2407.326) (-2401.748) [-2401.282] * (-2400.984) (-2404.442) (-2406.516) [-2402.659] -- 0:01:35
      727500 -- (-2413.385) (-2398.415) (-2399.998) [-2400.583] * (-2404.836) [-2397.302] (-2407.106) (-2409.249) -- 0:01:35
      728000 -- (-2404.938) (-2402.213) (-2408.489) [-2409.630] * (-2406.301) (-2407.975) (-2404.360) [-2398.619] -- 0:01:35
      728500 -- (-2403.530) [-2404.403] (-2415.940) (-2418.565) * (-2405.209) (-2411.977) (-2402.338) [-2402.279] -- 0:01:35
      729000 -- (-2402.488) [-2406.700] (-2405.512) (-2407.869) * (-2404.054) [-2402.101] (-2406.347) (-2406.837) -- 0:01:34
      729500 -- (-2404.097) [-2402.055] (-2400.927) (-2397.878) * (-2406.824) (-2403.878) [-2403.048] (-2400.833) -- 0:01:34
      730000 -- [-2398.899] (-2402.063) (-2407.779) (-2401.587) * [-2402.294] (-2407.171) (-2405.065) (-2401.595) -- 0:01:34

      Average standard deviation of split frequencies: 0.002968

      730500 -- (-2412.753) [-2401.546] (-2400.183) (-2401.993) * (-2402.326) [-2403.068] (-2398.661) (-2403.852) -- 0:01:34
      731000 -- (-2405.304) (-2409.946) [-2400.119] (-2400.643) * [-2409.550] (-2397.783) (-2405.384) (-2402.467) -- 0:01:34
      731500 -- (-2403.807) [-2401.159] (-2399.253) (-2418.027) * (-2402.099) (-2406.507) (-2409.861) [-2400.155] -- 0:01:33
      732000 -- (-2405.619) (-2405.921) [-2400.455] (-2414.856) * [-2396.835] (-2409.621) (-2405.663) (-2398.622) -- 0:01:33
      732500 -- (-2407.924) [-2402.665] (-2403.786) (-2402.629) * (-2407.320) (-2400.579) (-2401.558) [-2405.480] -- 0:01:33
      733000 -- (-2405.071) (-2405.605) (-2398.299) [-2404.214] * (-2397.991) (-2402.277) (-2400.041) [-2401.481] -- 0:01:33
      733500 -- (-2402.173) (-2401.467) (-2403.445) [-2404.505] * [-2404.845] (-2405.473) (-2405.657) (-2404.033) -- 0:01:33
      734000 -- (-2408.314) (-2400.822) [-2408.107] (-2403.880) * (-2401.622) (-2402.085) (-2409.746) [-2407.411] -- 0:01:33
      734500 -- [-2401.838] (-2402.541) (-2400.217) (-2404.954) * (-2397.023) (-2404.815) [-2404.675] (-2400.880) -- 0:01:32
      735000 -- (-2406.325) [-2407.295] (-2408.193) (-2404.405) * (-2408.171) (-2403.162) (-2403.544) [-2404.446] -- 0:01:32

      Average standard deviation of split frequencies: 0.003202

      735500 -- [-2411.784] (-2403.042) (-2407.278) (-2407.230) * (-2407.943) [-2407.211] (-2407.150) (-2401.188) -- 0:01:32
      736000 -- [-2404.942] (-2407.024) (-2402.886) (-2409.965) * (-2412.221) [-2409.487] (-2401.095) (-2397.818) -- 0:01:32
      736500 -- (-2408.711) [-2406.882] (-2402.002) (-2399.529) * [-2400.465] (-2405.387) (-2401.377) (-2399.791) -- 0:01:32
      737000 -- [-2401.931] (-2399.832) (-2401.557) (-2410.547) * (-2405.892) (-2403.840) (-2403.249) [-2406.245] -- 0:01:32
      737500 -- (-2398.696) (-2403.997) [-2399.527] (-2402.156) * (-2402.864) (-2407.051) (-2405.672) [-2398.193] -- 0:01:31
      738000 -- (-2401.110) [-2402.544] (-2410.819) (-2404.372) * (-2404.346) [-2398.486] (-2403.423) (-2403.421) -- 0:01:31
      738500 -- (-2404.858) (-2401.997) (-2409.153) [-2403.468] * [-2402.582] (-2399.818) (-2402.768) (-2402.816) -- 0:01:31
      739000 -- [-2399.086] (-2397.267) (-2412.849) (-2401.089) * (-2413.510) [-2399.786] (-2408.706) (-2404.712) -- 0:01:31
      739500 -- (-2398.176) (-2400.448) (-2405.990) [-2403.232] * (-2411.527) (-2400.290) [-2411.100] (-2398.486) -- 0:01:31
      740000 -- [-2405.756] (-2408.239) (-2407.945) (-2403.017) * (-2412.765) [-2400.065] (-2409.865) (-2403.512) -- 0:01:31

      Average standard deviation of split frequencies: 0.003691

      740500 -- (-2398.838) [-2399.630] (-2400.533) (-2403.821) * (-2406.290) (-2405.148) (-2403.505) [-2402.519] -- 0:01:30
      741000 -- (-2399.307) (-2405.966) (-2410.611) [-2400.557] * (-2410.995) (-2407.558) (-2403.557) [-2408.156] -- 0:01:30
      741500 -- (-2407.770) [-2410.326] (-2400.180) (-2397.147) * (-2407.559) (-2403.368) [-2400.870] (-2397.796) -- 0:01:30
      742000 -- (-2404.703) (-2404.153) (-2401.493) [-2403.659] * (-2407.229) (-2402.901) (-2404.846) [-2402.373] -- 0:01:30
      742500 -- (-2404.967) (-2405.472) (-2406.464) [-2398.268] * (-2404.662) [-2401.525] (-2404.769) (-2400.141) -- 0:01:30
      743000 -- (-2399.323) (-2406.088) (-2406.310) [-2398.434] * (-2405.449) [-2404.712] (-2405.681) (-2399.715) -- 0:01:29
      743500 -- [-2402.409] (-2402.340) (-2403.778) (-2399.034) * (-2405.037) [-2402.804] (-2406.241) (-2400.872) -- 0:01:29
      744000 -- [-2407.565] (-2403.272) (-2401.592) (-2411.415) * (-2418.663) (-2398.281) (-2406.268) [-2399.883] -- 0:01:29
      744500 -- (-2410.524) [-2403.238] (-2398.334) (-2409.887) * (-2405.268) [-2398.986] (-2405.344) (-2400.615) -- 0:01:29
      745000 -- (-2409.839) (-2407.729) (-2403.754) [-2407.366] * (-2405.163) (-2406.906) (-2401.500) [-2399.649] -- 0:01:29

      Average standard deviation of split frequencies: 0.003665

      745500 -- (-2421.360) (-2407.657) [-2398.410] (-2406.714) * (-2405.396) (-2405.709) (-2408.363) [-2405.282] -- 0:01:29
      746000 -- (-2409.409) (-2401.237) [-2400.041] (-2410.556) * (-2400.001) [-2403.182] (-2405.865) (-2406.343) -- 0:01:28
      746500 -- [-2405.329] (-2406.186) (-2402.135) (-2410.292) * (-2402.521) [-2404.487] (-2406.202) (-2409.244) -- 0:01:28
      747000 -- (-2406.443) (-2404.041) [-2398.683] (-2400.150) * (-2399.069) (-2411.261) (-2402.010) [-2403.421] -- 0:01:28
      747500 -- (-2404.724) (-2413.590) [-2398.068] (-2408.683) * (-2407.802) [-2405.163] (-2401.982) (-2403.089) -- 0:01:28
      748000 -- (-2409.690) (-2402.247) [-2399.053] (-2404.592) * (-2407.937) [-2403.969] (-2397.661) (-2400.658) -- 0:01:28
      748500 -- (-2400.522) (-2399.829) [-2403.468] (-2407.102) * (-2404.248) (-2402.981) [-2404.391] (-2401.158) -- 0:01:28
      749000 -- (-2404.652) (-2402.734) [-2400.520] (-2403.951) * (-2407.961) (-2402.927) [-2397.922] (-2400.483) -- 0:01:27
      749500 -- (-2403.567) (-2405.818) (-2403.351) [-2402.498] * (-2409.228) (-2407.335) (-2407.389) [-2395.522] -- 0:01:27
      750000 -- (-2400.571) (-2401.979) [-2403.392] (-2397.720) * (-2406.464) (-2402.592) [-2396.753] (-2401.782) -- 0:01:27

      Average standard deviation of split frequencies: 0.003391

      750500 -- (-2404.396) (-2402.977) [-2401.167] (-2407.234) * (-2402.420) (-2408.159) [-2398.276] (-2400.704) -- 0:01:27
      751000 -- (-2408.254) (-2403.765) (-2400.070) [-2400.373] * (-2402.870) (-2411.079) [-2398.588] (-2404.487) -- 0:01:27
      751500 -- (-2404.051) [-2405.993] (-2399.169) (-2415.130) * [-2402.668] (-2401.530) (-2402.141) (-2406.524) -- 0:01:26
      752000 -- (-2405.108) (-2402.460) [-2407.073] (-2408.250) * (-2404.316) (-2403.457) [-2406.156] (-2400.084) -- 0:01:26
      752500 -- (-2411.316) (-2402.004) (-2402.621) [-2404.230] * (-2401.517) (-2396.742) (-2401.378) [-2406.597] -- 0:01:26
      753000 -- (-2403.286) (-2409.018) (-2409.853) [-2405.452] * (-2406.829) (-2404.100) [-2410.404] (-2410.556) -- 0:01:26
      753500 -- (-2403.100) (-2413.774) [-2405.835] (-2399.877) * [-2398.510] (-2412.596) (-2407.912) (-2411.878) -- 0:01:26
      754000 -- [-2403.788] (-2407.960) (-2408.131) (-2406.630) * (-2403.480) (-2407.057) [-2403.126] (-2402.319) -- 0:01:26
      754500 -- (-2407.131) (-2406.180) (-2403.696) [-2403.759] * [-2409.001] (-2406.303) (-2414.075) (-2405.259) -- 0:01:25
      755000 -- (-2401.632) (-2406.964) [-2404.100] (-2407.980) * (-2402.252) (-2407.829) (-2407.271) [-2401.502] -- 0:01:25

      Average standard deviation of split frequencies: 0.002619

      755500 -- (-2409.436) (-2405.587) [-2401.413] (-2407.263) * (-2406.046) (-2403.952) (-2408.093) [-2399.835] -- 0:01:25
      756000 -- [-2405.599] (-2405.282) (-2402.254) (-2411.944) * (-2398.059) (-2401.679) (-2400.982) [-2397.945] -- 0:01:25
      756500 -- (-2406.726) (-2405.056) [-2397.683] (-2407.961) * [-2399.532] (-2412.865) (-2409.400) (-2400.639) -- 0:01:25
      757000 -- [-2405.448] (-2401.174) (-2396.931) (-2403.960) * (-2404.590) (-2405.096) [-2403.077] (-2407.435) -- 0:01:25
      757500 -- [-2408.992] (-2401.523) (-2407.415) (-2414.271) * (-2405.141) (-2404.418) (-2403.695) [-2403.147] -- 0:01:24
      758000 -- (-2409.075) (-2405.707) [-2398.174] (-2406.567) * (-2405.231) [-2409.548] (-2403.987) (-2405.900) -- 0:01:24
      758500 -- [-2404.059] (-2404.480) (-2400.698) (-2412.802) * [-2404.891] (-2400.601) (-2401.489) (-2403.317) -- 0:01:24
      759000 -- (-2404.428) (-2396.024) [-2405.409] (-2408.601) * [-2399.367] (-2407.936) (-2405.841) (-2411.138) -- 0:01:24
      759500 -- (-2404.437) [-2399.808] (-2403.571) (-2406.707) * (-2414.184) (-2404.880) (-2404.650) [-2399.130] -- 0:01:24
      760000 -- (-2409.000) (-2404.391) (-2405.775) [-2402.898] * [-2407.439] (-2399.723) (-2399.968) (-2402.878) -- 0:01:24

      Average standard deviation of split frequencies: 0.002355

      760500 -- (-2402.626) (-2410.070) [-2409.360] (-2402.047) * [-2405.398] (-2405.247) (-2410.964) (-2400.300) -- 0:01:23
      761000 -- (-2398.478) (-2411.396) (-2399.978) [-2406.295] * (-2401.471) (-2413.672) [-2402.636] (-2408.402) -- 0:01:23
      761500 -- (-2411.487) (-2403.486) [-2397.930] (-2410.850) * (-2403.634) (-2405.519) (-2410.944) [-2401.580] -- 0:01:23
      762000 -- (-2401.633) (-2406.558) (-2402.078) [-2404.588] * (-2398.124) (-2405.497) (-2402.766) [-2403.154] -- 0:01:23
      762500 -- (-2402.410) [-2407.056] (-2403.612) (-2398.833) * (-2401.783) (-2404.874) [-2401.045] (-2410.430) -- 0:01:23
      763000 -- (-2403.136) (-2406.062) [-2402.051] (-2411.174) * (-2406.334) (-2401.928) [-2405.966] (-2409.982) -- 0:01:22
      763500 -- [-2406.939] (-2399.560) (-2405.022) (-2405.830) * [-2410.253] (-2400.997) (-2410.676) (-2412.608) -- 0:01:22
      764000 -- [-2405.916] (-2401.520) (-2400.545) (-2401.801) * (-2403.443) (-2405.455) [-2397.913] (-2403.684) -- 0:01:22
      764500 -- (-2414.546) [-2405.984] (-2405.503) (-2405.687) * [-2402.716] (-2403.792) (-2408.320) (-2404.967) -- 0:01:22
      765000 -- (-2402.571) (-2410.453) (-2402.915) [-2398.385] * (-2414.259) (-2405.440) [-2407.083] (-2408.137) -- 0:01:22

      Average standard deviation of split frequencies: 0.002585

      765500 -- (-2411.377) (-2406.354) [-2398.882] (-2401.032) * (-2414.164) (-2402.977) (-2398.915) [-2404.909] -- 0:01:22
      766000 -- [-2402.383] (-2406.953) (-2404.640) (-2403.692) * (-2403.569) [-2404.527] (-2406.346) (-2407.989) -- 0:01:21
      766500 -- (-2404.089) (-2405.707) (-2400.954) [-2400.598] * (-2404.073) (-2407.319) (-2406.744) [-2405.308] -- 0:01:21
      767000 -- [-2404.996] (-2402.399) (-2407.233) (-2404.451) * (-2403.452) [-2401.463] (-2406.506) (-2403.721) -- 0:01:21
      767500 -- (-2405.677) [-2406.865] (-2408.138) (-2401.191) * [-2400.030] (-2401.580) (-2405.638) (-2400.166) -- 0:01:21
      768000 -- (-2407.671) (-2425.366) [-2401.955] (-2404.446) * (-2408.923) [-2405.842] (-2401.543) (-2403.364) -- 0:01:21
      768500 -- (-2401.885) (-2403.151) (-2403.044) [-2400.500] * (-2405.486) (-2408.621) [-2401.647] (-2404.877) -- 0:01:21
      769000 -- (-2408.986) (-2402.111) (-2402.556) [-2403.392] * [-2399.159] (-2404.394) (-2410.991) (-2405.596) -- 0:01:20
      769500 -- [-2402.254] (-2408.812) (-2415.731) (-2397.325) * [-2399.342] (-2399.164) (-2409.317) (-2405.363) -- 0:01:20
      770000 -- (-2404.519) [-2403.899] (-2403.571) (-2411.270) * (-2401.615) [-2401.949] (-2414.416) (-2407.113) -- 0:01:20

      Average standard deviation of split frequencies: 0.001346

      770500 -- (-2398.397) [-2401.650] (-2403.553) (-2401.026) * (-2408.432) (-2407.530) (-2407.409) [-2407.310] -- 0:01:20
      771000 -- (-2401.098) (-2413.396) (-2403.430) [-2400.518] * (-2407.543) [-2402.139] (-2409.960) (-2411.364) -- 0:01:20
      771500 -- (-2404.298) (-2407.709) [-2404.425] (-2400.152) * (-2405.047) (-2401.714) [-2402.684] (-2406.842) -- 0:01:19
      772000 -- [-2399.318] (-2396.537) (-2406.658) (-2410.208) * (-2406.553) [-2398.444] (-2401.825) (-2397.906) -- 0:01:19
      772500 -- (-2402.922) (-2406.531) [-2399.375] (-2405.639) * (-2405.072) (-2398.310) [-2409.484] (-2402.561) -- 0:01:19
      773000 -- (-2408.685) [-2406.412] (-2403.631) (-2403.596) * [-2397.628] (-2400.651) (-2407.450) (-2404.951) -- 0:01:19
      773500 -- (-2413.232) (-2400.312) [-2397.442] (-2404.270) * [-2401.846] (-2401.603) (-2405.539) (-2403.509) -- 0:01:19
      774000 -- (-2406.626) (-2408.059) [-2401.135] (-2398.535) * (-2404.023) (-2399.411) [-2400.322] (-2409.037) -- 0:01:19
      774500 -- (-2402.300) (-2407.006) [-2408.710] (-2416.038) * (-2406.126) (-2404.002) [-2401.313] (-2402.102) -- 0:01:18
      775000 -- [-2397.412] (-2401.383) (-2406.667) (-2405.628) * (-2411.359) [-2400.822] (-2405.488) (-2404.085) -- 0:01:18

      Average standard deviation of split frequencies: 0.000607

      775500 -- (-2403.086) (-2412.984) [-2403.770] (-2407.732) * (-2409.672) (-2409.993) [-2402.906] (-2405.694) -- 0:01:18
      776000 -- [-2400.844] (-2399.326) (-2408.695) (-2408.273) * (-2398.778) (-2403.484) (-2400.271) [-2401.538] -- 0:01:18
      776500 -- (-2405.088) [-2405.682] (-2402.491) (-2411.667) * [-2408.470] (-2403.782) (-2412.346) (-2406.499) -- 0:01:18
      777000 -- (-2404.327) (-2408.108) [-2405.892] (-2407.428) * (-2402.961) (-2406.396) (-2405.966) [-2403.314] -- 0:01:18
      777500 -- [-2401.514] (-2410.649) (-2404.045) (-2401.250) * (-2408.771) (-2396.429) [-2412.756] (-2405.795) -- 0:01:17
      778000 -- (-2401.826) [-2411.078] (-2407.240) (-2401.185) * (-2406.485) (-2407.271) (-2407.026) [-2403.605] -- 0:01:17
      778500 -- (-2405.385) (-2410.894) (-2404.574) [-2398.707] * (-2416.606) (-2412.236) [-2402.716] (-2404.265) -- 0:01:17
      779000 -- [-2401.175] (-2405.530) (-2402.115) (-2411.399) * (-2406.257) [-2400.420] (-2403.806) (-2409.060) -- 0:01:17
      779500 -- (-2406.683) (-2405.272) (-2405.309) [-2400.140] * (-2410.643) [-2401.101] (-2406.596) (-2407.068) -- 0:01:17
      780000 -- [-2403.325] (-2408.644) (-2397.550) (-2395.747) * [-2410.130] (-2401.367) (-2407.025) (-2407.717) -- 0:01:17

      Average standard deviation of split frequencies: 0.000604

      780500 -- (-2402.484) (-2409.351) (-2399.417) [-2402.670] * (-2403.154) [-2399.987] (-2411.850) (-2404.641) -- 0:01:16
      781000 -- (-2408.211) (-2406.815) (-2406.367) [-2395.377] * (-2409.529) [-2401.102] (-2399.693) (-2402.917) -- 0:01:16
      781500 -- (-2405.958) (-2413.518) [-2405.516] (-2398.462) * (-2406.613) (-2404.896) [-2401.953] (-2403.173) -- 0:01:16
      782000 -- [-2401.207] (-2407.527) (-2401.535) (-2403.488) * (-2407.854) (-2407.168) [-2405.808] (-2411.364) -- 0:01:16
      782500 -- (-2399.601) (-2408.300) (-2404.346) [-2396.542] * (-2404.983) (-2408.617) [-2405.249] (-2402.196) -- 0:01:16
      783000 -- (-2401.602) (-2407.431) (-2405.951) [-2402.296] * (-2404.832) [-2403.280] (-2404.279) (-2405.969) -- 0:01:15
      783500 -- (-2401.904) (-2402.078) (-2401.627) [-2404.028] * (-2410.123) (-2408.178) [-2397.653] (-2411.324) -- 0:01:15
      784000 -- (-2411.484) (-2398.493) (-2403.883) [-2409.066] * (-2402.215) (-2401.069) (-2405.892) [-2399.973] -- 0:01:15
      784500 -- (-2411.650) [-2401.093] (-2396.625) (-2406.372) * (-2405.945) [-2411.299] (-2408.560) (-2411.086) -- 0:01:15
      785000 -- (-2417.276) (-2402.062) (-2401.590) [-2398.575] * (-2406.903) (-2410.295) (-2410.577) [-2400.887] -- 0:01:15

      Average standard deviation of split frequencies: 0.001080

      785500 -- (-2407.474) [-2408.608] (-2405.292) (-2402.275) * (-2405.991) (-2403.772) (-2411.362) [-2398.847] -- 0:01:15
      786000 -- (-2404.173) (-2408.415) [-2401.093] (-2403.107) * (-2407.200) (-2400.758) [-2401.180] (-2401.321) -- 0:01:14
      786500 -- (-2409.188) [-2404.536] (-2407.135) (-2405.785) * [-2401.101] (-2404.909) (-2400.344) (-2403.798) -- 0:01:14
      787000 -- (-2415.557) (-2410.605) (-2400.987) [-2402.456] * (-2399.266) (-2405.029) (-2403.327) [-2403.523] -- 0:01:14
      787500 -- [-2407.172] (-2402.029) (-2404.491) (-2402.441) * (-2410.254) (-2409.498) (-2407.292) [-2407.007] -- 0:01:14
      788000 -- (-2408.060) [-2407.190] (-2402.690) (-2396.865) * (-2411.946) [-2409.638] (-2411.408) (-2405.085) -- 0:01:14
      788500 -- (-2406.116) (-2405.061) (-2402.666) [-2402.395] * [-2405.467] (-2405.036) (-2400.003) (-2404.480) -- 0:01:14
      789000 -- (-2400.285) [-2407.027] (-2403.998) (-2404.241) * (-2407.043) (-2398.843) [-2400.128] (-2410.920) -- 0:01:13
      789500 -- (-2405.037) (-2406.256) (-2398.228) [-2409.729] * (-2405.187) (-2405.599) [-2405.389] (-2409.465) -- 0:01:13
      790000 -- (-2406.292) (-2406.681) [-2401.116] (-2406.628) * (-2403.475) (-2403.635) [-2404.470] (-2406.861) -- 0:01:13

      Average standard deviation of split frequencies: 0.000835

      790500 -- (-2404.603) (-2408.734) (-2404.587) [-2409.762] * (-2404.796) (-2412.981) (-2402.981) [-2406.574] -- 0:01:13
      791000 -- (-2403.557) (-2402.392) [-2407.755] (-2402.645) * (-2410.521) (-2404.717) [-2400.938] (-2410.561) -- 0:01:13
      791500 -- [-2403.443] (-2404.488) (-2398.940) (-2407.359) * (-2405.784) (-2405.272) (-2407.901) [-2405.849] -- 0:01:12
      792000 -- (-2407.098) (-2403.240) [-2397.761] (-2412.236) * (-2395.813) [-2401.365] (-2405.177) (-2398.876) -- 0:01:12
      792500 -- (-2417.691) (-2406.945) [-2401.693] (-2417.858) * [-2406.192] (-2397.653) (-2405.566) (-2407.617) -- 0:01:12
      793000 -- (-2407.076) [-2403.187] (-2405.929) (-2411.894) * (-2401.593) (-2403.828) (-2416.415) [-2399.642] -- 0:01:12
      793500 -- (-2405.974) [-2399.809] (-2407.785) (-2409.775) * (-2405.990) [-2401.387] (-2410.446) (-2406.569) -- 0:01:12
      794000 -- (-2406.316) (-2405.737) [-2401.255] (-2407.904) * (-2403.497) (-2397.942) (-2408.800) [-2401.756] -- 0:01:12
      794500 -- (-2399.675) (-2399.628) (-2401.901) [-2406.061] * [-2399.985] (-2403.684) (-2408.353) (-2413.481) -- 0:01:11
      795000 -- (-2414.561) [-2398.966] (-2403.780) (-2410.171) * (-2403.451) (-2399.901) (-2399.450) [-2401.833] -- 0:01:11

      Average standard deviation of split frequencies: 0.000829

      795500 -- [-2403.443] (-2399.605) (-2408.105) (-2399.306) * (-2400.114) (-2404.720) [-2398.254] (-2396.507) -- 0:01:11
      796000 -- [-2407.464] (-2404.728) (-2408.814) (-2411.005) * [-2403.232] (-2409.947) (-2406.719) (-2407.275) -- 0:01:11
      796500 -- [-2394.939] (-2401.576) (-2408.147) (-2397.489) * [-2403.861] (-2400.019) (-2403.360) (-2405.014) -- 0:01:11
      797000 -- [-2402.060] (-2399.805) (-2403.909) (-2413.047) * (-2400.786) (-2405.325) [-2405.262] (-2396.441) -- 0:01:11
      797500 -- (-2397.794) [-2403.450] (-2404.341) (-2402.079) * (-2400.938) [-2404.278] (-2406.558) (-2402.574) -- 0:01:10
      798000 -- [-2403.403] (-2398.370) (-2403.013) (-2400.772) * [-2403.803] (-2403.075) (-2399.035) (-2404.606) -- 0:01:10
      798500 -- [-2400.540] (-2402.426) (-2403.507) (-2404.514) * [-2409.207] (-2409.571) (-2400.521) (-2404.097) -- 0:01:10
      799000 -- [-2398.565] (-2399.936) (-2407.548) (-2396.445) * (-2398.257) [-2405.745] (-2402.626) (-2404.453) -- 0:01:10
      799500 -- (-2408.328) (-2398.830) (-2401.764) [-2397.717] * [-2408.863] (-2399.474) (-2406.294) (-2404.190) -- 0:01:10
      800000 -- (-2404.849) [-2403.081] (-2402.587) (-2404.473) * (-2400.996) (-2408.875) (-2407.351) [-2404.058] -- 0:01:10

      Average standard deviation of split frequencies: 0.000824

      800500 -- (-2407.148) (-2407.715) (-2402.157) [-2398.504] * [-2405.083] (-2407.739) (-2409.160) (-2403.428) -- 0:01:09
      801000 -- (-2412.771) (-2402.032) [-2400.106] (-2403.212) * (-2416.025) [-2401.271] (-2402.701) (-2405.562) -- 0:01:09
      801500 -- (-2405.060) [-2397.447] (-2404.311) (-2399.537) * (-2402.057) (-2402.752) (-2399.516) [-2410.309] -- 0:01:09
      802000 -- (-2400.456) [-2401.217] (-2406.682) (-2402.708) * (-2398.340) (-2416.565) [-2402.022] (-2405.333) -- 0:01:09
      802500 -- [-2404.353] (-2404.295) (-2408.029) (-2403.748) * [-2401.868] (-2411.787) (-2404.383) (-2402.860) -- 0:01:09
      803000 -- (-2410.660) (-2402.383) (-2405.676) [-2401.457] * [-2398.744] (-2409.773) (-2405.883) (-2401.643) -- 0:01:08
      803500 -- (-2404.756) (-2401.824) [-2401.960] (-2405.249) * (-2401.142) [-2403.880] (-2411.969) (-2406.948) -- 0:01:08
      804000 -- (-2407.269) (-2404.981) [-2399.918] (-2409.909) * (-2404.631) (-2410.749) (-2399.555) [-2408.546] -- 0:01:08
      804500 -- (-2404.951) [-2405.789] (-2407.653) (-2407.939) * (-2415.244) (-2407.019) (-2406.690) [-2411.133] -- 0:01:08
      805000 -- (-2398.309) (-2403.340) [-2409.792] (-2406.118) * (-2405.781) (-2416.709) [-2407.182] (-2407.838) -- 0:01:08

      Average standard deviation of split frequencies: 0.000819

      805500 -- (-2402.735) (-2404.646) (-2400.910) [-2402.374] * [-2402.858] (-2414.076) (-2401.626) (-2401.260) -- 0:01:08
      806000 -- (-2401.827) (-2403.264) (-2397.284) [-2408.322] * [-2405.127] (-2410.294) (-2401.940) (-2396.121) -- 0:01:07
      806500 -- [-2403.481] (-2415.139) (-2408.592) (-2401.638) * (-2400.011) (-2401.345) [-2400.444] (-2402.812) -- 0:01:07
      807000 -- (-2404.227) (-2406.297) [-2404.173] (-2407.548) * (-2401.727) (-2407.835) (-2399.389) [-2400.895] -- 0:01:07
      807500 -- (-2402.248) (-2401.414) [-2404.086] (-2406.604) * (-2402.685) (-2401.145) (-2406.244) [-2406.382] -- 0:01:07
      808000 -- [-2403.442] (-2404.365) (-2404.810) (-2404.250) * (-2406.590) [-2394.955] (-2406.430) (-2402.399) -- 0:01:07
      808500 -- [-2399.456] (-2406.756) (-2405.089) (-2406.229) * (-2404.647) (-2411.771) [-2407.529] (-2410.071) -- 0:01:07
      809000 -- (-2403.183) [-2402.147] (-2402.288) (-2409.175) * [-2402.972] (-2416.737) (-2408.130) (-2403.712) -- 0:01:06
      809500 -- (-2403.001) [-2401.826] (-2408.018) (-2408.514) * [-2402.282] (-2414.837) (-2406.508) (-2408.857) -- 0:01:06
      810000 -- (-2402.155) [-2402.657] (-2410.151) (-2402.656) * (-2406.635) (-2414.000) [-2405.501] (-2407.559) -- 0:01:06

      Average standard deviation of split frequencies: 0.000930

      810500 -- [-2398.608] (-2408.664) (-2408.122) (-2405.588) * (-2401.644) (-2409.714) (-2415.312) [-2403.465] -- 0:01:06
      811000 -- (-2400.971) (-2398.332) (-2410.057) [-2408.400] * (-2408.430) [-2409.895] (-2402.754) (-2403.925) -- 0:01:06
      811500 -- (-2398.723) [-2395.979] (-2403.539) (-2400.070) * (-2401.119) [-2400.405] (-2404.388) (-2409.462) -- 0:01:05
      812000 -- (-2404.679) (-2404.969) [-2396.312] (-2410.540) * (-2401.720) (-2412.558) (-2405.647) [-2402.338] -- 0:01:05
      812500 -- (-2401.515) (-2402.938) [-2400.838] (-2405.003) * [-2405.438] (-2406.896) (-2407.062) (-2409.239) -- 0:01:05
      813000 -- (-2410.501) [-2403.793] (-2402.050) (-2408.724) * [-2400.804] (-2408.048) (-2402.963) (-2405.219) -- 0:01:05
      813500 -- [-2404.165] (-2404.571) (-2411.144) (-2407.828) * (-2398.859) [-2401.768] (-2401.836) (-2410.110) -- 0:01:05
      814000 -- (-2407.032) (-2405.862) (-2399.448) [-2413.289] * (-2403.155) [-2411.531] (-2400.624) (-2407.891) -- 0:01:05
      814500 -- (-2405.473) (-2403.231) (-2399.759) [-2402.475] * (-2400.433) (-2406.110) [-2405.123] (-2403.611) -- 0:01:04
      815000 -- (-2405.574) (-2405.113) (-2407.587) [-2401.615] * (-2406.273) (-2404.779) [-2398.677] (-2405.127) -- 0:01:04

      Average standard deviation of split frequencies: 0.001618

      815500 -- [-2406.675] (-2406.812) (-2405.913) (-2407.454) * (-2401.219) (-2398.907) [-2397.196] (-2406.253) -- 0:01:04
      816000 -- (-2407.998) (-2404.200) (-2403.184) [-2403.485] * [-2404.446] (-2410.012) (-2403.837) (-2408.909) -- 0:01:04
      816500 -- (-2405.093) [-2400.647] (-2406.963) (-2416.855) * [-2401.199] (-2407.499) (-2399.731) (-2420.796) -- 0:01:04
      817000 -- (-2398.273) [-2404.807] (-2400.448) (-2421.054) * [-2399.195] (-2400.542) (-2403.674) (-2415.462) -- 0:01:04
      817500 -- (-2399.165) (-2404.702) [-2398.869] (-2414.222) * (-2402.166) (-2409.168) [-2399.323] (-2402.756) -- 0:01:03
      818000 -- (-2400.718) (-2406.424) (-2403.013) [-2402.222] * (-2399.951) (-2410.268) [-2397.497] (-2401.585) -- 0:01:03
      818500 -- [-2403.379] (-2407.580) (-2406.013) (-2403.179) * (-2402.198) (-2408.880) (-2403.991) [-2401.682] -- 0:01:03
      819000 -- (-2402.672) [-2405.227] (-2405.444) (-2408.924) * [-2409.753] (-2405.282) (-2401.662) (-2400.433) -- 0:01:03
      819500 -- [-2399.209] (-2406.934) (-2407.383) (-2403.207) * (-2405.347) (-2403.868) (-2403.690) [-2397.507] -- 0:01:03
      820000 -- (-2406.899) [-2403.006] (-2399.558) (-2406.886) * [-2409.427] (-2405.337) (-2402.751) (-2402.716) -- 0:01:03

      Average standard deviation of split frequencies: 0.002527

      820500 -- (-2403.452) [-2400.087] (-2410.309) (-2412.946) * [-2398.231] (-2406.052) (-2401.752) (-2401.516) -- 0:01:02
      821000 -- (-2409.558) (-2407.225) [-2400.528] (-2409.691) * [-2403.483] (-2405.634) (-2400.247) (-2408.181) -- 0:01:02
      821500 -- (-2404.522) (-2407.415) (-2401.293) [-2401.231] * (-2402.328) [-2408.767] (-2401.861) (-2399.963) -- 0:01:02
      822000 -- [-2403.775] (-2405.668) (-2404.094) (-2400.871) * (-2400.040) [-2401.613] (-2413.786) (-2402.685) -- 0:01:02
      822500 -- (-2406.954) (-2405.387) (-2398.567) [-2397.741] * (-2401.576) (-2414.023) (-2408.606) [-2403.711] -- 0:01:02
      823000 -- (-2400.549) (-2412.319) [-2401.729] (-2405.069) * [-2405.043] (-2403.842) (-2403.657) (-2402.500) -- 0:01:01
      823500 -- (-2405.464) [-2407.901] (-2409.359) (-2410.837) * (-2403.855) [-2398.726] (-2405.024) (-2399.739) -- 0:01:01
      824000 -- (-2408.624) (-2402.451) [-2395.244] (-2405.781) * [-2399.950] (-2401.326) (-2402.573) (-2403.829) -- 0:01:01
      824500 -- [-2409.578] (-2401.879) (-2405.989) (-2406.590) * (-2401.294) (-2403.027) (-2401.689) [-2401.196] -- 0:01:01
      825000 -- (-2404.439) [-2403.334] (-2402.257) (-2411.800) * [-2403.538] (-2402.755) (-2404.825) (-2411.141) -- 0:01:01

      Average standard deviation of split frequencies: 0.003424

      825500 -- [-2399.225] (-2399.531) (-2399.746) (-2406.068) * (-2402.859) [-2406.616] (-2409.309) (-2406.339) -- 0:01:01
      826000 -- [-2404.420] (-2405.400) (-2410.305) (-2406.441) * [-2408.296] (-2403.576) (-2400.406) (-2407.716) -- 0:01:00
      826500 -- (-2403.436) (-2404.948) [-2404.078] (-2398.315) * (-2404.245) (-2407.193) [-2395.856] (-2409.495) -- 0:01:00
      827000 -- (-2409.617) [-2400.974] (-2398.078) (-2407.025) * (-2402.408) (-2409.376) [-2401.892] (-2405.388) -- 0:01:00
      827500 -- [-2408.007] (-2405.915) (-2402.901) (-2399.619) * (-2402.076) (-2409.103) [-2402.406] (-2399.850) -- 0:01:00
      828000 -- [-2400.727] (-2409.307) (-2404.524) (-2400.600) * (-2403.601) [-2401.329] (-2407.790) (-2407.965) -- 0:01:00
      828500 -- (-2404.406) (-2410.169) (-2400.678) [-2402.657] * [-2397.322] (-2403.360) (-2402.249) (-2400.764) -- 0:01:00
      829000 -- (-2398.052) (-2401.919) (-2407.615) [-2408.449] * (-2404.222) (-2404.210) [-2403.164] (-2406.348) -- 0:00:59
      829500 -- (-2406.484) (-2404.052) (-2414.350) [-2399.790] * [-2405.496] (-2404.925) (-2400.079) (-2404.596) -- 0:00:59
      830000 -- (-2417.441) [-2399.311] (-2404.696) (-2404.785) * (-2408.885) (-2406.842) [-2401.535] (-2399.336) -- 0:00:59

      Average standard deviation of split frequencies: 0.003519

      830500 -- (-2403.532) (-2396.596) (-2406.460) [-2402.012] * (-2409.785) [-2417.594] (-2405.911) (-2403.460) -- 0:00:59
      831000 -- (-2408.634) (-2404.341) [-2403.625] (-2409.614) * (-2404.970) (-2410.611) [-2404.881] (-2403.127) -- 0:00:59
      831500 -- (-2407.309) [-2399.851] (-2407.048) (-2407.473) * (-2397.035) (-2403.719) (-2404.184) [-2399.500] -- 0:00:58
      832000 -- (-2398.402) [-2400.259] (-2402.670) (-2405.867) * (-2409.288) (-2401.269) [-2399.396] (-2398.529) -- 0:00:58
      832500 -- (-2399.697) (-2399.344) (-2404.060) [-2406.141] * (-2403.400) [-2400.688] (-2407.212) (-2411.810) -- 0:00:58
      833000 -- (-2400.248) [-2399.155] (-2402.845) (-2402.601) * (-2395.373) (-2401.105) (-2410.721) [-2398.551] -- 0:00:58
      833500 -- [-2396.657] (-2403.058) (-2404.246) (-2401.224) * (-2402.425) (-2404.851) (-2401.410) [-2406.326] -- 0:00:58
      834000 -- (-2407.024) (-2403.098) [-2400.390] (-2404.497) * (-2401.727) (-2402.807) [-2398.362] (-2402.884) -- 0:00:58
      834500 -- (-2403.622) (-2400.403) (-2404.137) [-2401.044] * (-2409.226) (-2402.974) (-2409.191) [-2405.281] -- 0:00:57
      835000 -- (-2402.853) [-2400.299] (-2412.100) (-2405.202) * (-2399.716) (-2401.060) (-2403.888) [-2405.952] -- 0:00:57

      Average standard deviation of split frequencies: 0.004624

      835500 -- [-2404.022] (-2402.533) (-2411.856) (-2416.564) * [-2405.536] (-2404.620) (-2402.547) (-2408.366) -- 0:00:57
      836000 -- (-2401.372) (-2409.866) (-2411.988) [-2402.776] * (-2406.636) (-2418.356) (-2406.402) [-2404.721] -- 0:00:57
      836500 -- (-2402.969) (-2409.942) (-2401.426) [-2406.497] * [-2399.515] (-2404.444) (-2409.872) (-2405.263) -- 0:00:57
      837000 -- (-2404.520) (-2406.447) [-2402.149] (-2401.933) * (-2405.059) (-2408.713) (-2403.328) [-2401.783] -- 0:00:57
      837500 -- (-2398.898) [-2402.718] (-2407.932) (-2402.239) * (-2406.016) [-2400.965] (-2406.805) (-2405.243) -- 0:00:56
      838000 -- (-2399.562) (-2403.341) [-2405.832] (-2405.307) * (-2404.540) (-2404.444) (-2409.952) [-2400.327] -- 0:00:56
      838500 -- [-2401.294] (-2404.558) (-2415.078) (-2399.784) * [-2400.686] (-2406.356) (-2408.984) (-2401.424) -- 0:00:56
      839000 -- (-2402.595) [-2402.985] (-2404.258) (-2404.866) * [-2405.858] (-2410.026) (-2402.637) (-2409.097) -- 0:00:56
      839500 -- (-2415.115) [-2397.910] (-2408.546) (-2408.326) * [-2398.794] (-2407.318) (-2404.878) (-2408.847) -- 0:00:56
      840000 -- (-2398.134) (-2400.639) [-2403.154] (-2412.940) * (-2405.926) (-2412.339) [-2403.823] (-2400.961) -- 0:00:56

      Average standard deviation of split frequencies: 0.003925

      840500 -- (-2409.623) (-2403.603) [-2402.606] (-2416.757) * [-2401.305] (-2405.252) (-2400.588) (-2408.191) -- 0:00:55
      841000 -- (-2409.289) [-2409.949] (-2401.646) (-2406.479) * (-2407.423) [-2401.261] (-2406.168) (-2405.875) -- 0:00:55
      841500 -- (-2409.543) [-2402.863] (-2401.955) (-2400.110) * [-2414.739] (-2398.679) (-2404.089) (-2402.386) -- 0:00:55
      842000 -- [-2399.795] (-2398.443) (-2408.288) (-2398.626) * (-2401.103) [-2399.415] (-2406.821) (-2403.305) -- 0:00:55
      842500 -- (-2402.453) (-2399.168) [-2399.903] (-2410.097) * (-2401.017) (-2407.145) (-2404.559) [-2408.132] -- 0:00:55
      843000 -- (-2404.491) (-2407.058) (-2403.256) [-2403.823] * [-2402.192] (-2405.015) (-2400.221) (-2401.665) -- 0:00:54
      843500 -- (-2400.986) (-2408.532) (-2399.981) [-2405.480] * (-2406.783) [-2402.321] (-2401.923) (-2401.403) -- 0:00:54
      844000 -- [-2402.004] (-2402.991) (-2403.803) (-2411.997) * (-2399.699) (-2407.759) [-2400.791] (-2405.398) -- 0:00:54
      844500 -- (-2407.366) (-2400.676) (-2401.909) [-2405.786] * (-2407.779) [-2404.954] (-2404.134) (-2415.366) -- 0:00:54
      845000 -- [-2401.126] (-2405.921) (-2405.065) (-2402.553) * (-2405.857) (-2409.025) (-2404.018) [-2410.899] -- 0:00:54

      Average standard deviation of split frequencies: 0.003678

      845500 -- (-2401.207) (-2407.843) (-2404.233) [-2405.599] * (-2408.287) [-2403.536] (-2404.407) (-2404.535) -- 0:00:54
      846000 -- (-2407.442) (-2405.964) (-2404.773) [-2400.356] * [-2401.663] (-2399.617) (-2401.006) (-2407.144) -- 0:00:53
      846500 -- (-2400.444) [-2403.776] (-2403.897) (-2401.159) * [-2398.817] (-2407.962) (-2412.051) (-2405.744) -- 0:00:53
      847000 -- (-2407.176) (-2408.002) (-2404.356) [-2404.695] * (-2403.037) (-2401.032) [-2411.686] (-2402.915) -- 0:00:53
      847500 -- [-2410.517] (-2411.113) (-2409.016) (-2401.442) * [-2401.084] (-2402.330) (-2405.338) (-2404.367) -- 0:00:53
      848000 -- (-2405.342) [-2399.211] (-2399.011) (-2404.446) * (-2405.718) [-2398.760] (-2402.661) (-2399.248) -- 0:00:53
      848500 -- (-2402.999) (-2398.414) [-2408.223] (-2406.557) * [-2406.761] (-2410.355) (-2410.921) (-2402.770) -- 0:00:53
      849000 -- (-2403.316) (-2399.577) (-2405.460) [-2404.958] * (-2406.713) (-2405.470) (-2401.851) [-2407.921] -- 0:00:52
      849500 -- (-2404.845) (-2403.640) (-2407.028) [-2404.076] * (-2408.138) (-2414.532) (-2398.540) [-2403.385] -- 0:00:52
      850000 -- (-2397.336) [-2400.552] (-2404.921) (-2403.888) * (-2407.622) (-2410.584) [-2403.011] (-2404.536) -- 0:00:52

      Average standard deviation of split frequencies: 0.004322

      850500 -- (-2407.793) [-2401.647] (-2406.092) (-2403.241) * (-2410.558) (-2405.522) (-2405.479) [-2400.281] -- 0:00:52
      851000 -- (-2410.770) (-2400.890) (-2404.057) [-2398.418] * [-2400.843] (-2403.098) (-2406.902) (-2404.133) -- 0:00:52
      851500 -- (-2403.785) (-2401.611) (-2403.391) [-2400.098] * [-2403.745] (-2401.610) (-2397.991) (-2401.020) -- 0:00:51
      852000 -- (-2410.318) (-2416.589) [-2397.152] (-2402.669) * (-2401.945) (-2398.455) (-2415.615) [-2399.904] -- 0:00:51
      852500 -- (-2402.439) (-2399.752) [-2397.862] (-2399.933) * (-2401.820) [-2403.130] (-2406.545) (-2405.231) -- 0:00:51
      853000 -- (-2406.224) [-2399.787] (-2401.213) (-2399.944) * (-2405.197) (-2402.492) (-2398.106) [-2406.800] -- 0:00:51
      853500 -- [-2405.285] (-2406.903) (-2413.982) (-2398.772) * (-2403.675) [-2404.414] (-2401.160) (-2400.382) -- 0:00:51
      854000 -- (-2404.260) (-2403.338) (-2406.235) [-2400.367] * (-2404.638) (-2402.471) [-2407.555] (-2401.981) -- 0:00:51
      854500 -- [-2405.191] (-2402.229) (-2397.921) (-2403.913) * (-2413.614) (-2401.803) (-2404.499) [-2406.799] -- 0:00:50
      855000 -- (-2408.166) [-2398.178] (-2402.016) (-2408.545) * [-2406.950] (-2408.500) (-2403.999) (-2401.980) -- 0:00:50

      Average standard deviation of split frequencies: 0.004296

      855500 -- (-2399.935) [-2401.458] (-2407.342) (-2404.796) * (-2399.955) (-2403.496) [-2406.942] (-2401.522) -- 0:00:50
      856000 -- (-2398.540) (-2403.109) [-2406.291] (-2402.311) * (-2400.073) [-2401.324] (-2401.882) (-2410.459) -- 0:00:50
      856500 -- [-2399.687] (-2403.548) (-2408.911) (-2406.924) * [-2400.404] (-2405.623) (-2399.838) (-2400.282) -- 0:00:50
      857000 -- (-2402.272) [-2396.305] (-2404.512) (-2403.458) * [-2407.278] (-2403.957) (-2401.888) (-2398.659) -- 0:00:50
      857500 -- (-2403.451) [-2395.194] (-2416.541) (-2400.939) * (-2399.302) (-2413.439) [-2400.355] (-2397.288) -- 0:00:49
      858000 -- (-2409.479) [-2404.322] (-2406.125) (-2402.117) * (-2406.711) (-2409.153) (-2400.350) [-2407.964] -- 0:00:49
      858500 -- [-2397.941] (-2403.853) (-2405.215) (-2406.055) * (-2403.089) (-2408.638) [-2410.411] (-2410.745) -- 0:00:49
      859000 -- (-2403.893) [-2404.468] (-2402.857) (-2400.916) * [-2401.145] (-2407.921) (-2403.840) (-2411.811) -- 0:00:49
      859500 -- (-2406.136) (-2402.538) [-2405.957] (-2398.473) * (-2399.620) (-2409.431) (-2412.562) [-2403.349] -- 0:00:49
      860000 -- (-2414.837) (-2407.248) [-2401.073] (-2407.900) * [-2403.791] (-2407.931) (-2405.451) (-2411.474) -- 0:00:49

      Average standard deviation of split frequencies: 0.003834

      860500 -- (-2404.066) (-2408.244) (-2402.388) [-2402.403] * (-2403.178) [-2404.198] (-2400.084) (-2423.003) -- 0:00:48
      861000 -- (-2402.138) [-2400.298] (-2404.533) (-2403.370) * (-2401.337) [-2401.797] (-2415.381) (-2408.155) -- 0:00:48
      861500 -- (-2404.064) [-2409.706] (-2413.916) (-2401.105) * [-2404.040] (-2409.977) (-2410.891) (-2410.967) -- 0:00:48
      862000 -- [-2401.837] (-2404.679) (-2403.141) (-2400.221) * (-2407.922) (-2400.398) (-2409.921) [-2403.373] -- 0:00:48
      862500 -- [-2399.073] (-2404.557) (-2403.965) (-2410.245) * (-2403.505) (-2402.368) (-2402.644) [-2398.179] -- 0:00:48
      863000 -- (-2398.459) [-2408.887] (-2405.262) (-2405.596) * [-2403.787] (-2401.467) (-2405.710) (-2406.627) -- 0:00:47
      863500 -- (-2407.131) (-2416.147) [-2403.191] (-2398.549) * (-2404.059) (-2403.867) (-2406.635) [-2400.385] -- 0:00:47
      864000 -- (-2402.731) (-2411.508) (-2402.935) [-2403.125] * [-2400.758] (-2403.569) (-2407.187) (-2397.580) -- 0:00:47
      864500 -- (-2404.102) [-2406.270] (-2408.552) (-2409.367) * [-2404.790] (-2406.650) (-2409.006) (-2398.444) -- 0:00:47
      865000 -- (-2414.113) (-2412.328) (-2400.083) [-2405.366] * (-2404.412) [-2404.633] (-2405.407) (-2404.985) -- 0:00:47

      Average standard deviation of split frequencies: 0.004464

      865500 -- (-2401.321) [-2400.034] (-2409.230) (-2401.662) * (-2407.872) (-2401.725) [-2403.478] (-2398.150) -- 0:00:47
      866000 -- (-2407.266) [-2400.651] (-2402.757) (-2407.189) * [-2412.194] (-2402.693) (-2404.215) (-2410.086) -- 0:00:46
      866500 -- (-2404.331) (-2402.032) [-2399.055] (-2401.624) * (-2404.466) (-2408.706) [-2412.158] (-2406.645) -- 0:00:46
      867000 -- (-2406.367) (-2399.265) (-2401.502) [-2403.900] * (-2413.603) (-2403.443) (-2413.536) [-2409.801] -- 0:00:46
      867500 -- (-2400.230) [-2407.759] (-2405.409) (-2405.398) * [-2409.940] (-2413.708) (-2403.583) (-2413.062) -- 0:00:46
      868000 -- (-2403.309) (-2406.964) [-2404.312] (-2403.005) * (-2409.912) [-2409.834] (-2395.760) (-2415.131) -- 0:00:46
      868500 -- (-2403.236) (-2403.053) (-2404.366) [-2402.264] * (-2410.222) (-2403.814) (-2400.207) [-2410.504] -- 0:00:46
      869000 -- (-2398.887) (-2399.978) [-2403.892] (-2395.646) * [-2402.521] (-2404.778) (-2400.101) (-2415.594) -- 0:00:45
      869500 -- (-2398.276) (-2404.067) (-2398.606) [-2403.444] * [-2403.936] (-2402.451) (-2403.326) (-2404.287) -- 0:00:45
      870000 -- (-2402.747) (-2400.320) [-2400.673] (-2406.433) * (-2408.454) [-2398.676] (-2401.193) (-2404.329) -- 0:00:45

      Average standard deviation of split frequencies: 0.004656

      870500 -- (-2405.512) [-2402.852] (-2406.398) (-2406.941) * (-2399.945) (-2399.987) (-2401.109) [-2402.880] -- 0:00:45
      871000 -- (-2407.299) (-2401.972) [-2402.265] (-2409.144) * (-2407.274) (-2408.038) (-2401.567) [-2405.923] -- 0:00:45
      871500 -- (-2404.857) [-2399.178] (-2403.242) (-2404.353) * (-2403.463) (-2403.261) [-2398.901] (-2406.305) -- 0:00:44
      872000 -- (-2402.888) (-2405.587) [-2405.038] (-2410.049) * (-2405.315) [-2403.692] (-2408.392) (-2404.694) -- 0:00:44
      872500 -- (-2401.958) (-2403.902) [-2402.604] (-2413.633) * (-2400.637) [-2401.078] (-2408.696) (-2401.505) -- 0:00:44
      873000 -- (-2400.878) (-2411.762) (-2403.518) [-2405.247] * [-2398.881] (-2398.136) (-2399.428) (-2407.480) -- 0:00:44
      873500 -- [-2407.014] (-2402.918) (-2403.001) (-2405.323) * [-2398.218] (-2405.007) (-2408.035) (-2398.840) -- 0:00:44
      874000 -- (-2399.332) [-2405.628] (-2397.134) (-2404.582) * (-2404.516) (-2396.009) (-2411.441) [-2402.443] -- 0:00:44
      874500 -- [-2401.906] (-2402.695) (-2403.387) (-2406.987) * [-2403.761] (-2404.271) (-2408.200) (-2401.948) -- 0:00:43
      875000 -- (-2416.843) (-2407.531) [-2408.381] (-2397.306) * [-2410.801] (-2406.768) (-2403.703) (-2412.232) -- 0:00:43

      Average standard deviation of split frequencies: 0.005704

      875500 -- (-2403.452) (-2404.376) (-2398.524) [-2403.980] * (-2407.083) (-2403.419) [-2401.068] (-2401.521) -- 0:00:43
      876000 -- (-2408.601) (-2411.299) (-2403.704) [-2402.921] * [-2409.184] (-2399.750) (-2409.935) (-2404.727) -- 0:00:43
      876500 -- [-2405.513] (-2405.951) (-2408.825) (-2403.170) * (-2403.484) (-2405.000) (-2405.198) [-2403.442] -- 0:00:43
      877000 -- (-2406.455) [-2403.557] (-2410.891) (-2402.268) * (-2401.694) (-2409.984) (-2405.901) [-2402.289] -- 0:00:43
      877500 -- (-2414.021) (-2399.972) (-2411.613) [-2397.836] * (-2407.149) (-2401.445) (-2408.224) [-2401.574] -- 0:00:42
      878000 -- [-2409.852] (-2405.943) (-2408.249) (-2403.713) * (-2403.020) [-2400.845] (-2404.619) (-2399.907) -- 0:00:42
      878500 -- (-2403.946) [-2397.462] (-2400.579) (-2402.831) * [-2407.138] (-2410.822) (-2404.368) (-2402.860) -- 0:00:42
      879000 -- (-2407.500) (-2404.333) (-2407.955) [-2394.885] * (-2406.033) (-2397.929) [-2402.505] (-2399.399) -- 0:00:42
      879500 -- [-2404.633] (-2410.702) (-2399.440) (-2402.848) * (-2400.718) (-2398.461) [-2397.978] (-2405.724) -- 0:00:42
      880000 -- (-2406.450) [-2403.060] (-2396.776) (-2398.318) * [-2406.864] (-2402.061) (-2401.479) (-2400.897) -- 0:00:42

      Average standard deviation of split frequencies: 0.005246

      880500 -- (-2402.098) (-2408.804) (-2404.582) [-2402.975] * [-2404.424] (-2399.641) (-2400.608) (-2406.760) -- 0:00:41
      881000 -- (-2402.735) [-2401.011] (-2406.083) (-2401.796) * [-2404.267] (-2403.467) (-2395.087) (-2407.214) -- 0:00:41
      881500 -- (-2409.578) (-2406.139) (-2406.093) [-2401.073] * (-2404.716) (-2403.525) [-2406.098] (-2401.944) -- 0:00:41
      882000 -- (-2410.523) (-2404.380) (-2406.317) [-2401.171] * (-2411.073) (-2408.019) [-2409.439] (-2399.178) -- 0:00:41
      882500 -- [-2402.950] (-2399.682) (-2398.183) (-2398.382) * [-2401.257] (-2404.128) (-2407.074) (-2401.127) -- 0:00:41
      883000 -- (-2401.972) [-2401.194] (-2401.476) (-2408.882) * (-2400.231) [-2399.164] (-2415.891) (-2413.856) -- 0:00:40
      883500 -- (-2397.362) (-2404.233) (-2403.745) [-2403.052] * (-2404.732) (-2404.739) (-2401.240) [-2403.565] -- 0:00:40
      884000 -- [-2402.084] (-2398.046) (-2404.034) (-2405.881) * (-2407.158) (-2400.423) [-2397.481] (-2403.091) -- 0:00:40
      884500 -- [-2411.867] (-2397.787) (-2404.372) (-2398.338) * (-2402.656) (-2406.183) [-2403.272] (-2406.615) -- 0:00:40
      885000 -- [-2407.243] (-2406.363) (-2400.064) (-2403.621) * [-2398.913] (-2402.112) (-2406.552) (-2401.863) -- 0:00:40

      Average standard deviation of split frequencies: 0.005214

      885500 -- (-2402.254) (-2401.053) [-2403.727] (-2405.484) * [-2408.738] (-2401.025) (-2407.511) (-2405.840) -- 0:00:40
      886000 -- (-2399.923) [-2408.388] (-2410.739) (-2398.908) * [-2399.286] (-2402.207) (-2398.827) (-2410.174) -- 0:00:39
      886500 -- [-2400.217] (-2406.079) (-2405.251) (-2403.032) * [-2404.259] (-2411.790) (-2410.425) (-2402.649) -- 0:00:39
      887000 -- (-2401.378) (-2407.777) [-2408.749] (-2403.999) * [-2403.228] (-2402.518) (-2409.138) (-2410.944) -- 0:00:39
      887500 -- (-2403.513) (-2403.886) [-2404.933] (-2403.822) * (-2400.372) (-2404.023) [-2400.059] (-2400.551) -- 0:00:39
      888000 -- (-2411.938) (-2401.999) (-2408.736) [-2403.422] * (-2398.511) (-2409.041) [-2400.064] (-2398.475) -- 0:00:39
      888500 -- [-2407.073] (-2403.036) (-2418.289) (-2402.728) * (-2404.410) [-2402.316] (-2403.962) (-2405.164) -- 0:00:39
      889000 -- (-2407.408) [-2404.476] (-2410.110) (-2401.106) * (-2413.109) (-2402.921) (-2409.137) [-2410.390] -- 0:00:38
      889500 -- (-2401.579) (-2404.812) (-2402.007) [-2406.875] * (-2404.159) [-2400.352] (-2403.361) (-2413.129) -- 0:00:38
      890000 -- (-2407.721) [-2401.238] (-2406.734) (-2409.512) * (-2400.159) (-2407.710) (-2406.407) [-2403.368] -- 0:00:38

      Average standard deviation of split frequencies: 0.004552

      890500 -- [-2401.255] (-2403.985) (-2404.852) (-2413.254) * (-2401.194) (-2407.418) [-2402.289] (-2407.000) -- 0:00:38
      891000 -- [-2403.803] (-2399.564) (-2405.414) (-2401.891) * (-2402.008) [-2400.356] (-2401.534) (-2413.825) -- 0:00:38
      891500 -- (-2399.804) [-2407.498] (-2406.835) (-2404.716) * (-2400.967) [-2398.653] (-2403.483) (-2403.869) -- 0:00:37
      892000 -- (-2406.536) (-2402.949) (-2407.145) [-2400.261] * (-2405.340) [-2398.169] (-2396.998) (-2407.181) -- 0:00:37
      892500 -- (-2406.670) [-2412.449] (-2407.350) (-2410.001) * (-2406.037) (-2403.512) [-2407.092] (-2406.119) -- 0:00:37
      893000 -- (-2403.043) (-2407.898) (-2406.546) [-2404.568] * [-2410.471] (-2401.952) (-2405.396) (-2404.933) -- 0:00:37
      893500 -- (-2402.035) [-2405.293] (-2406.984) (-2408.137) * (-2402.738) [-2402.290] (-2405.462) (-2409.225) -- 0:00:37
      894000 -- (-2405.156) [-2401.530] (-2403.687) (-2402.107) * [-2404.334] (-2409.455) (-2406.096) (-2401.876) -- 0:00:37
      894500 -- (-2407.972) [-2401.362] (-2400.665) (-2404.312) * [-2401.492] (-2416.466) (-2411.816) (-2395.547) -- 0:00:36
      895000 -- [-2404.454] (-2405.945) (-2411.216) (-2405.774) * [-2400.004] (-2414.871) (-2408.012) (-2408.189) -- 0:00:36

      Average standard deviation of split frequencies: 0.003893

      895500 -- (-2408.933) (-2407.762) (-2408.175) [-2404.627] * (-2410.529) (-2416.276) (-2400.871) [-2403.545] -- 0:00:36
      896000 -- [-2409.258] (-2404.665) (-2400.460) (-2402.847) * [-2402.165] (-2414.331) (-2406.146) (-2403.560) -- 0:00:36
      896500 -- [-2399.264] (-2401.488) (-2405.330) (-2405.735) * (-2402.284) (-2401.369) [-2398.508] (-2406.941) -- 0:00:36
      897000 -- (-2403.578) (-2407.774) (-2408.772) [-2401.335] * (-2400.439) (-2402.313) (-2404.637) [-2399.247] -- 0:00:36
      897500 -- (-2404.892) (-2399.381) [-2404.353] (-2405.774) * (-2403.628) (-2399.699) (-2409.126) [-2398.390] -- 0:00:35
      898000 -- (-2402.801) [-2400.758] (-2405.173) (-2398.842) * (-2400.849) (-2404.370) (-2404.644) [-2403.588] -- 0:00:35
      898500 -- (-2399.630) (-2402.440) (-2402.022) [-2401.430] * [-2404.103] (-2399.782) (-2405.131) (-2402.532) -- 0:00:35
      899000 -- (-2405.732) (-2397.928) [-2404.329] (-2404.788) * [-2398.466] (-2399.603) (-2402.339) (-2403.074) -- 0:00:35
      899500 -- (-2400.492) (-2400.883) [-2402.953] (-2400.969) * [-2407.888] (-2403.342) (-2404.026) (-2410.069) -- 0:00:35
      900000 -- (-2399.618) (-2405.076) (-2403.250) [-2403.301] * (-2397.631) (-2401.381) (-2403.293) [-2398.433] -- 0:00:35

      Average standard deviation of split frequencies: 0.004292

      900500 -- (-2410.789) (-2402.665) (-2401.384) [-2404.032] * [-2400.813] (-2399.303) (-2409.387) (-2407.845) -- 0:00:34
      901000 -- (-2399.209) [-2398.512] (-2406.870) (-2410.494) * (-2404.688) (-2407.830) (-2406.094) [-2405.685] -- 0:00:34
      901500 -- [-2403.318] (-2401.920) (-2404.936) (-2407.934) * (-2397.007) [-2397.886] (-2409.921) (-2398.182) -- 0:00:34
      902000 -- (-2406.779) (-2400.014) [-2411.729] (-2405.006) * (-2404.167) (-2399.838) (-2400.625) [-2405.002] -- 0:00:34
      902500 -- [-2405.579] (-2398.346) (-2408.550) (-2400.118) * (-2398.255) (-2401.474) [-2403.015] (-2410.014) -- 0:00:34
      903000 -- (-2405.634) (-2398.398) [-2405.099] (-2406.581) * [-2399.802] (-2414.175) (-2402.898) (-2406.500) -- 0:00:33
      903500 -- [-2406.088] (-2399.766) (-2398.704) (-2404.823) * [-2399.684] (-2404.622) (-2405.140) (-2401.524) -- 0:00:33
      904000 -- (-2401.053) [-2401.887] (-2400.471) (-2409.198) * (-2402.577) (-2402.083) (-2399.760) [-2408.879] -- 0:00:33
      904500 -- (-2405.094) (-2409.723) [-2403.367] (-2406.243) * (-2403.357) (-2410.064) [-2401.071] (-2401.558) -- 0:00:33
      905000 -- (-2410.078) [-2404.097] (-2408.998) (-2405.606) * [-2402.047] (-2407.013) (-2403.066) (-2397.074) -- 0:00:33

      Average standard deviation of split frequencies: 0.004267

      905500 -- (-2402.206) (-2397.811) (-2409.038) [-2400.942] * (-2410.557) (-2400.608) (-2402.219) [-2406.413] -- 0:00:33
      906000 -- (-2400.027) (-2403.320) (-2401.693) [-2406.148] * (-2401.985) (-2403.631) [-2405.731] (-2406.774) -- 0:00:32
      906500 -- (-2404.936) (-2410.010) (-2400.884) [-2400.120] * [-2403.596] (-2401.161) (-2406.785) (-2399.505) -- 0:00:32
      907000 -- (-2399.699) (-2404.721) (-2400.530) [-2398.137] * (-2411.094) (-2401.677) [-2396.151] (-2404.632) -- 0:00:32
      907500 -- (-2398.497) [-2401.812] (-2399.772) (-2399.291) * (-2401.754) (-2399.112) (-2397.577) [-2397.869] -- 0:00:32
      908000 -- (-2404.317) (-2398.878) (-2403.478) [-2402.503] * (-2401.521) [-2402.563] (-2399.303) (-2404.324) -- 0:00:32
      908500 -- (-2405.769) [-2396.790] (-2407.489) (-2404.298) * (-2402.247) [-2399.790] (-2405.671) (-2410.028) -- 0:00:32
      909000 -- (-2404.481) (-2405.006) (-2403.258) [-2400.026] * (-2400.796) [-2402.322] (-2404.688) (-2412.614) -- 0:00:31
      909500 -- (-2404.426) (-2404.534) (-2406.307) [-2408.068] * (-2404.777) [-2396.962] (-2406.437) (-2413.205) -- 0:00:31
      910000 -- (-2413.379) (-2399.509) (-2406.708) [-2397.040] * [-2407.628] (-2404.611) (-2406.012) (-2409.316) -- 0:00:31

      Average standard deviation of split frequencies: 0.004245

      910500 -- (-2405.198) (-2398.973) (-2405.636) [-2402.970] * (-2404.633) (-2403.074) [-2402.875] (-2412.540) -- 0:00:31
      911000 -- (-2404.074) (-2403.978) (-2403.457) [-2400.261] * (-2403.046) [-2403.573] (-2401.859) (-2408.793) -- 0:00:31
      911500 -- [-2401.754] (-2404.566) (-2403.258) (-2402.350) * (-2402.766) (-2406.762) [-2409.116] (-2401.627) -- 0:00:30
      912000 -- (-2406.430) (-2413.943) [-2396.132] (-2408.455) * (-2410.600) [-2407.834] (-2408.262) (-2407.034) -- 0:00:30
      912500 -- [-2397.421] (-2399.476) (-2406.336) (-2398.537) * (-2403.258) (-2402.975) (-2411.424) [-2403.884] -- 0:00:30
      913000 -- (-2402.643) [-2400.722] (-2406.793) (-2404.971) * (-2408.158) (-2399.726) (-2407.016) [-2403.697] -- 0:00:30
      913500 -- (-2411.009) (-2401.267) [-2404.198] (-2403.109) * (-2402.494) (-2400.282) [-2404.918] (-2399.813) -- 0:00:30
      914000 -- (-2408.265) (-2404.349) (-2410.637) [-2399.690] * (-2417.567) (-2398.907) [-2400.338] (-2399.650) -- 0:00:30
      914500 -- (-2398.746) [-2400.121] (-2404.188) (-2398.494) * (-2420.785) (-2405.370) (-2401.228) [-2397.633] -- 0:00:29
      915000 -- [-2397.031] (-2401.106) (-2407.607) (-2404.676) * (-2412.353) [-2403.378] (-2408.965) (-2401.871) -- 0:00:29

      Average standard deviation of split frequencies: 0.004014

      915500 -- (-2398.934) (-2409.798) (-2399.341) [-2402.844] * (-2406.198) (-2410.585) [-2399.164] (-2408.341) -- 0:00:29
      916000 -- (-2405.158) (-2405.544) [-2403.465] (-2400.013) * (-2404.361) [-2404.580] (-2399.806) (-2402.959) -- 0:00:29
      916500 -- (-2414.888) (-2398.452) (-2401.612) [-2397.132] * [-2410.580] (-2404.104) (-2404.799) (-2407.277) -- 0:00:29
      917000 -- (-2402.090) [-2402.787] (-2400.715) (-2403.987) * (-2397.471) (-2420.049) [-2398.109] (-2410.581) -- 0:00:29
      917500 -- [-2402.567] (-2405.454) (-2398.090) (-2406.159) * (-2399.171) [-2400.128] (-2398.430) (-2414.240) -- 0:00:28
      918000 -- (-2403.596) [-2405.484] (-2403.051) (-2401.696) * [-2398.461] (-2403.240) (-2401.848) (-2402.088) -- 0:00:28
      918500 -- (-2403.924) [-2403.552] (-2406.890) (-2407.313) * (-2410.102) [-2397.984] (-2404.732) (-2410.941) -- 0:00:28
      919000 -- [-2402.819] (-2398.149) (-2403.250) (-2404.185) * [-2401.257] (-2403.550) (-2404.378) (-2408.285) -- 0:00:28
      919500 -- (-2402.545) [-2400.571] (-2399.638) (-2410.680) * (-2404.754) (-2403.579) [-2403.708] (-2409.637) -- 0:00:28
      920000 -- [-2397.073] (-2410.217) (-2400.682) (-2401.506) * [-2401.015] (-2400.880) (-2399.409) (-2405.746) -- 0:00:28

      Average standard deviation of split frequencies: 0.003994

      920500 -- (-2398.660) [-2401.279] (-2409.055) (-2408.097) * (-2404.177) [-2399.865] (-2407.530) (-2404.721) -- 0:00:27
      921000 -- (-2405.994) (-2412.995) [-2403.108] (-2411.755) * [-2402.547] (-2405.175) (-2406.610) (-2399.464) -- 0:00:27
      921500 -- [-2402.518] (-2401.220) (-2403.775) (-2402.955) * (-2405.433) [-2398.467] (-2405.996) (-2403.955) -- 0:00:27
      922000 -- [-2399.826] (-2397.189) (-2400.927) (-2403.038) * (-2406.935) [-2402.016] (-2406.204) (-2408.144) -- 0:00:27
      922500 -- [-2397.489] (-2403.589) (-2418.516) (-2406.983) * (-2406.090) (-2409.183) [-2400.818] (-2408.171) -- 0:00:27
      923000 -- [-2399.754] (-2400.997) (-2407.066) (-2407.112) * (-2406.635) (-2403.071) (-2396.703) [-2398.174] -- 0:00:26
      923500 -- [-2404.352] (-2396.574) (-2409.264) (-2401.977) * (-2403.333) (-2414.127) [-2406.128] (-2405.623) -- 0:00:26
      924000 -- [-2399.961] (-2404.135) (-2415.596) (-2405.519) * (-2409.258) (-2396.859) [-2399.941] (-2403.409) -- 0:00:26
      924500 -- (-2399.463) [-2409.830] (-2411.026) (-2406.817) * (-2405.441) [-2403.501] (-2402.732) (-2397.698) -- 0:00:26
      925000 -- (-2404.955) (-2405.282) [-2402.561] (-2403.112) * (-2400.200) (-2402.840) [-2412.620] (-2399.249) -- 0:00:26

      Average standard deviation of split frequencies: 0.003971

      925500 -- (-2405.323) (-2403.667) [-2403.777] (-2407.204) * (-2410.616) [-2397.098] (-2406.035) (-2402.165) -- 0:00:26
      926000 -- [-2401.325] (-2405.961) (-2402.456) (-2406.103) * (-2403.784) [-2395.743] (-2400.837) (-2406.545) -- 0:00:25
      926500 -- (-2403.494) (-2398.704) (-2397.907) [-2401.365] * (-2413.742) (-2400.731) [-2405.819] (-2405.573) -- 0:00:25
      927000 -- (-2401.082) (-2400.561) (-2401.042) [-2400.188] * (-2401.478) (-2405.991) [-2404.344] (-2406.046) -- 0:00:25
      927500 -- (-2399.578) [-2403.624] (-2412.320) (-2397.782) * [-2406.318] (-2403.550) (-2412.538) (-2401.515) -- 0:00:25
      928000 -- (-2402.784) (-2403.213) (-2412.659) [-2402.164] * (-2404.002) (-2402.979) [-2401.343] (-2405.549) -- 0:00:25
      928500 -- (-2405.763) (-2408.026) [-2408.026] (-2406.648) * [-2400.000] (-2403.421) (-2403.417) (-2412.682) -- 0:00:25
      929000 -- [-2401.110] (-2400.495) (-2399.209) (-2401.496) * (-2407.131) [-2402.696] (-2409.933) (-2412.387) -- 0:00:24
      929500 -- (-2408.990) (-2406.602) [-2403.529] (-2400.965) * [-2397.648] (-2403.586) (-2410.994) (-2406.087) -- 0:00:24
      930000 -- (-2402.124) [-2403.325] (-2402.325) (-2395.917) * [-2406.404] (-2403.468) (-2403.407) (-2404.791) -- 0:00:24

      Average standard deviation of split frequencies: 0.005167

      930500 -- (-2412.195) (-2415.097) [-2404.630] (-2404.258) * (-2399.414) [-2404.083] (-2400.545) (-2404.654) -- 0:00:24
      931000 -- (-2407.188) (-2404.129) [-2403.012] (-2399.477) * [-2404.163] (-2405.902) (-2403.640) (-2398.527) -- 0:00:24
      931500 -- (-2408.001) (-2402.495) (-2402.511) [-2406.900] * (-2401.061) (-2405.379) (-2407.510) [-2403.063] -- 0:00:23
      932000 -- (-2401.545) (-2406.176) [-2410.449] (-2407.875) * (-2401.948) (-2399.241) (-2405.535) [-2405.879] -- 0:00:23
      932500 -- (-2403.031) [-2403.484] (-2404.523) (-2406.750) * (-2399.643) (-2405.915) [-2400.747] (-2404.201) -- 0:00:23
      933000 -- (-2405.191) [-2401.724] (-2407.519) (-2405.689) * (-2402.648) (-2403.491) (-2400.409) [-2400.281] -- 0:00:23
      933500 -- (-2401.676) (-2402.957) [-2402.488] (-2406.358) * (-2403.928) (-2401.383) (-2401.727) [-2402.975] -- 0:00:23
      934000 -- [-2404.617] (-2399.545) (-2405.305) (-2397.420) * (-2411.357) (-2404.059) (-2405.066) [-2404.128] -- 0:00:23
      934500 -- (-2405.475) (-2404.764) [-2405.434] (-2403.901) * (-2400.989) [-2402.172] (-2407.677) (-2405.067) -- 0:00:22
      935000 -- (-2403.611) (-2401.610) [-2405.739] (-2405.952) * (-2403.355) (-2402.101) [-2405.309] (-2406.516) -- 0:00:22

      Average standard deviation of split frequencies: 0.005540

      935500 -- (-2406.045) [-2399.901] (-2414.429) (-2405.992) * (-2400.354) (-2408.789) [-2401.378] (-2401.014) -- 0:00:22
      936000 -- [-2399.848] (-2402.422) (-2404.980) (-2404.550) * [-2401.514] (-2407.950) (-2405.280) (-2399.852) -- 0:00:22
      936500 -- (-2404.035) [-2400.755] (-2403.959) (-2401.183) * (-2409.289) (-2403.913) [-2401.865] (-2401.568) -- 0:00:22
      937000 -- (-2400.702) [-2400.682] (-2409.724) (-2400.832) * (-2405.846) [-2399.691] (-2402.613) (-2404.153) -- 0:00:22
      937500 -- (-2401.956) (-2403.781) (-2415.044) [-2404.014] * [-2401.052] (-2402.277) (-2401.469) (-2403.147) -- 0:00:21
      938000 -- [-2407.395] (-2407.366) (-2406.944) (-2407.647) * (-2401.237) (-2405.731) [-2399.725] (-2407.183) -- 0:00:21
      938500 -- (-2405.585) (-2399.271) (-2399.481) [-2400.323] * [-2401.022] (-2403.057) (-2410.616) (-2407.164) -- 0:00:21
      939000 -- (-2413.935) (-2405.904) (-2398.124) [-2399.632] * (-2402.240) (-2401.913) [-2401.123] (-2402.621) -- 0:00:21
      939500 -- (-2403.654) (-2410.496) [-2399.340] (-2404.046) * (-2403.352) (-2405.534) (-2409.046) [-2399.529] -- 0:00:21
      940000 -- [-2404.044] (-2420.335) (-2406.407) (-2402.732) * (-2400.866) (-2397.580) (-2398.273) [-2400.447] -- 0:00:21

      Average standard deviation of split frequencies: 0.005312

      940500 -- (-2409.401) (-2406.465) (-2410.852) [-2399.253] * [-2405.899] (-2415.455) (-2402.938) (-2402.668) -- 0:00:20
      941000 -- (-2402.893) (-2401.907) [-2405.511] (-2405.735) * (-2411.660) (-2402.965) [-2399.774] (-2405.279) -- 0:00:20
      941500 -- [-2397.312] (-2411.609) (-2401.920) (-2398.796) * (-2410.171) (-2406.329) (-2402.907) [-2400.063] -- 0:00:20
      942000 -- (-2407.752) (-2415.451) (-2408.430) [-2398.138] * (-2404.355) [-2409.841] (-2406.381) (-2401.192) -- 0:00:20
      942500 -- (-2408.790) (-2402.839) [-2407.857] (-2405.023) * (-2405.648) (-2406.907) (-2401.936) [-2405.948] -- 0:00:20
      943000 -- (-2401.701) (-2406.223) [-2396.737] (-2407.271) * (-2409.801) (-2408.689) (-2409.070) [-2401.929] -- 0:00:19
      943500 -- (-2410.778) (-2403.931) [-2409.314] (-2398.775) * (-2406.632) [-2405.463] (-2405.491) (-2407.180) -- 0:00:19
      944000 -- (-2407.537) [-2401.053] (-2411.874) (-2405.326) * [-2407.484] (-2406.734) (-2401.420) (-2400.082) -- 0:00:19
      944500 -- (-2410.441) [-2408.234] (-2399.418) (-2404.150) * (-2402.732) (-2407.589) (-2400.464) [-2404.008] -- 0:00:19
      945000 -- (-2402.596) [-2406.338] (-2404.374) (-2405.703) * (-2407.001) (-2416.118) (-2408.279) [-2405.629] -- 0:00:19

      Average standard deviation of split frequencies: 0.005481

      945500 -- [-2402.510] (-2406.228) (-2409.590) (-2404.369) * [-2400.974] (-2416.326) (-2405.975) (-2408.979) -- 0:00:19
      946000 -- (-2407.408) [-2402.255] (-2405.689) (-2413.426) * (-2405.700) [-2406.263] (-2401.503) (-2402.632) -- 0:00:18
      946500 -- [-2405.125] (-2404.668) (-2409.891) (-2408.329) * (-2399.748) (-2409.602) [-2402.310] (-2413.301) -- 0:00:18
      947000 -- (-2398.885) [-2398.429] (-2396.844) (-2404.074) * (-2401.918) [-2409.870] (-2406.648) (-2408.804) -- 0:00:18
      947500 -- (-2407.980) (-2400.794) [-2403.897] (-2407.806) * (-2408.239) [-2403.142] (-2407.558) (-2410.957) -- 0:00:18
      948000 -- (-2402.120) (-2404.611) (-2410.443) [-2409.322] * (-2406.685) (-2402.623) [-2402.819] (-2408.868) -- 0:00:18
      948500 -- [-2403.419] (-2400.626) (-2405.161) (-2415.115) * [-2403.157] (-2407.770) (-2411.907) (-2410.052) -- 0:00:18
      949000 -- (-2401.613) (-2401.973) [-2398.011] (-2409.849) * (-2408.386) (-2412.448) [-2403.329] (-2400.848) -- 0:00:17
      949500 -- [-2399.146] (-2403.994) (-2402.707) (-2410.809) * (-2401.871) (-2406.757) (-2412.399) [-2402.759] -- 0:00:17
      950000 -- (-2417.918) [-2405.470] (-2401.960) (-2407.664) * (-2408.788) (-2407.943) (-2414.545) [-2405.320] -- 0:00:17

      Average standard deviation of split frequencies: 0.005058

      950500 -- (-2395.545) (-2401.319) (-2407.177) [-2398.388] * [-2400.932] (-2403.681) (-2403.059) (-2405.149) -- 0:00:17
      951000 -- [-2396.208] (-2402.191) (-2399.616) (-2408.194) * (-2404.913) (-2402.878) [-2404.483] (-2409.170) -- 0:00:17
      951500 -- [-2397.467] (-2403.148) (-2404.591) (-2405.650) * (-2400.777) (-2404.780) (-2415.080) [-2405.119] -- 0:00:16
      952000 -- [-2401.930] (-2400.423) (-2407.670) (-2399.298) * (-2409.076) (-2401.095) (-2397.667) [-2401.831] -- 0:00:16
      952500 -- [-2399.987] (-2407.938) (-2405.059) (-2398.909) * (-2407.726) (-2408.503) [-2400.908] (-2409.470) -- 0:00:16
      953000 -- (-2397.577) [-2407.680] (-2403.076) (-2397.706) * [-2402.952] (-2408.645) (-2403.432) (-2403.909) -- 0:00:16
      953500 -- [-2403.103] (-2405.767) (-2401.942) (-2406.296) * (-2397.977) (-2406.450) [-2404.920] (-2407.362) -- 0:00:16
      954000 -- (-2402.309) (-2399.466) [-2399.361] (-2406.496) * (-2401.492) (-2407.897) (-2405.774) [-2407.476] -- 0:00:16
      954500 -- (-2410.113) (-2402.139) [-2407.010] (-2410.642) * (-2406.417) (-2404.540) (-2409.177) [-2402.078] -- 0:00:15
      955000 -- (-2415.759) (-2399.289) (-2403.599) [-2406.082] * (-2398.614) (-2404.218) (-2415.683) [-2400.566] -- 0:00:15

      Average standard deviation of split frequencies: 0.005227

      955500 -- (-2407.388) [-2399.966] (-2400.685) (-2407.557) * (-2404.956) (-2405.207) [-2400.303] (-2406.442) -- 0:00:15
      956000 -- (-2408.059) [-2404.355] (-2409.178) (-2402.319) * [-2399.709] (-2405.882) (-2396.305) (-2407.590) -- 0:00:15
      956500 -- (-2406.513) (-2400.724) [-2397.541] (-2401.225) * [-2400.772] (-2409.013) (-2402.804) (-2398.315) -- 0:00:15
      957000 -- (-2404.533) (-2405.147) (-2404.949) [-2407.108] * (-2402.781) (-2411.219) [-2404.897] (-2396.650) -- 0:00:15
      957500 -- (-2399.976) [-2398.228] (-2402.080) (-2412.283) * (-2406.751) [-2398.651] (-2403.362) (-2401.354) -- 0:00:14
      958000 -- (-2404.748) [-2407.784] (-2405.973) (-2404.202) * (-2405.989) (-2408.757) (-2402.882) [-2397.538] -- 0:00:14
      958500 -- (-2401.562) (-2406.444) [-2399.037] (-2404.417) * [-2402.798] (-2405.582) (-2408.546) (-2403.027) -- 0:00:14
      959000 -- (-2407.831) (-2411.604) [-2403.567] (-2405.846) * (-2404.799) (-2397.654) (-2406.595) [-2404.572] -- 0:00:14
      959500 -- (-2407.597) (-2411.504) [-2399.938] (-2410.555) * (-2403.684) [-2400.950] (-2401.076) (-2408.299) -- 0:00:14
      960000 -- (-2407.241) [-2401.464] (-2407.452) (-2404.982) * (-2401.326) [-2402.289] (-2408.300) (-2403.509) -- 0:00:14

      Average standard deviation of split frequencies: 0.005790

      960500 -- (-2404.263) (-2403.627) (-2407.345) [-2408.619] * (-2402.594) (-2401.949) (-2404.400) [-2405.368] -- 0:00:13
      961000 -- (-2402.083) [-2400.028] (-2402.526) (-2409.188) * (-2406.867) (-2405.697) [-2404.978] (-2406.191) -- 0:00:13
      961500 -- [-2403.776] (-2401.805) (-2399.058) (-2402.124) * [-2403.824] (-2399.825) (-2414.961) (-2406.185) -- 0:00:13
      962000 -- (-2401.589) (-2411.864) (-2401.477) [-2401.787] * (-2409.030) (-2399.951) [-2404.159] (-2401.456) -- 0:00:13
      962500 -- (-2400.672) [-2407.193] (-2403.642) (-2404.075) * (-2399.073) (-2403.304) (-2405.428) [-2407.919] -- 0:00:13
      963000 -- (-2408.659) (-2407.652) [-2405.826] (-2401.927) * (-2407.061) (-2406.191) (-2405.530) [-2402.027] -- 0:00:12
      963500 -- (-2401.164) (-2400.524) (-2397.508) [-2400.339] * [-2401.842] (-2403.223) (-2413.797) (-2399.950) -- 0:00:12
      964000 -- (-2405.419) (-2403.524) [-2398.215] (-2411.974) * [-2402.032] (-2401.287) (-2400.711) (-2411.519) -- 0:00:12
      964500 -- (-2400.082) (-2401.915) (-2406.367) [-2406.701] * [-2401.094] (-2409.061) (-2411.830) (-2405.787) -- 0:00:12
      965000 -- (-2409.270) [-2402.930] (-2410.280) (-2403.963) * [-2396.402] (-2407.025) (-2401.997) (-2404.670) -- 0:00:12

      Average standard deviation of split frequencies: 0.005758

      965500 -- (-2411.081) (-2405.903) (-2398.406) [-2400.849] * (-2404.708) (-2409.648) [-2404.960] (-2413.973) -- 0:00:12
      966000 -- (-2404.284) (-2402.517) [-2400.313] (-2399.724) * (-2404.384) (-2405.311) (-2408.926) [-2404.066] -- 0:00:11
      966500 -- (-2411.706) [-2401.563] (-2402.581) (-2401.392) * [-2407.902] (-2402.451) (-2403.528) (-2396.498) -- 0:00:11
      967000 -- [-2410.069] (-2410.803) (-2401.962) (-2410.864) * [-2410.412] (-2405.095) (-2408.851) (-2409.190) -- 0:00:11
      967500 -- (-2407.865) [-2400.957] (-2405.068) (-2407.821) * [-2405.605] (-2402.837) (-2406.552) (-2408.751) -- 0:00:11
      968000 -- (-2410.601) [-2400.993] (-2402.442) (-2399.459) * (-2405.817) [-2404.315] (-2404.063) (-2398.442) -- 0:00:11
      968500 -- (-2403.233) (-2401.379) (-2406.087) [-2401.768] * (-2405.400) (-2404.969) [-2399.524] (-2408.308) -- 0:00:11
      969000 -- (-2403.928) (-2400.353) [-2402.778] (-2401.826) * (-2404.256) (-2406.742) [-2402.807] (-2399.941) -- 0:00:10
      969500 -- [-2399.953] (-2405.035) (-2403.177) (-2407.949) * (-2405.356) [-2401.596] (-2403.007) (-2402.810) -- 0:00:10
      970000 -- (-2408.658) (-2405.853) [-2402.077] (-2413.184) * (-2402.584) [-2400.366] (-2413.305) (-2405.222) -- 0:00:10

      Average standard deviation of split frequencies: 0.005148

      970500 -- (-2406.982) (-2413.707) [-2398.656] (-2412.992) * (-2398.943) (-2401.049) (-2402.193) [-2397.646] -- 0:00:10
      971000 -- [-2405.850] (-2397.697) (-2404.637) (-2405.776) * (-2409.539) (-2407.292) [-2399.342] (-2408.400) -- 0:00:10
      971500 -- (-2403.186) [-2403.688] (-2412.185) (-2399.356) * (-2409.667) (-2404.196) (-2400.845) [-2401.771] -- 0:00:09
      972000 -- (-2408.777) (-2401.806) [-2402.642] (-2409.369) * (-2409.393) [-2403.974] (-2402.760) (-2402.436) -- 0:00:09
      972500 -- (-2408.356) (-2401.656) [-2398.517] (-2404.716) * (-2402.853) (-2397.710) [-2410.861] (-2401.609) -- 0:00:09
      973000 -- [-2397.550] (-2400.707) (-2405.519) (-2404.335) * (-2404.144) (-2401.792) [-2409.144] (-2407.107) -- 0:00:09
      973500 -- (-2409.142) [-2405.243] (-2400.374) (-2402.592) * [-2406.351] (-2404.901) (-2409.111) (-2404.902) -- 0:00:09
      974000 -- (-2406.193) (-2403.642) (-2407.947) [-2403.960] * (-2402.727) (-2398.943) [-2407.400] (-2407.526) -- 0:00:09
      974500 -- (-2405.642) [-2406.437] (-2403.553) (-2406.929) * (-2405.683) (-2402.545) (-2401.313) [-2402.870] -- 0:00:08
      975000 -- (-2399.425) (-2414.063) [-2402.758] (-2400.683) * (-2408.114) (-2401.311) [-2404.165] (-2400.990) -- 0:00:08

      Average standard deviation of split frequencies: 0.005410

      975500 -- (-2405.502) [-2395.803] (-2414.534) (-2403.082) * [-2402.844] (-2405.762) (-2404.091) (-2401.670) -- 0:00:08
      976000 -- [-2399.787] (-2406.187) (-2400.856) (-2406.651) * [-2405.749] (-2409.395) (-2404.655) (-2403.835) -- 0:00:08
      976500 -- (-2402.859) [-2399.137] (-2399.393) (-2409.245) * (-2397.875) (-2409.029) (-2412.616) [-2406.843] -- 0:00:08
      977000 -- (-2404.931) (-2400.602) [-2409.242] (-2411.076) * (-2399.444) (-2417.762) [-2413.092] (-2409.687) -- 0:00:08
      977500 -- (-2405.741) (-2409.719) [-2402.388] (-2412.122) * [-2410.452] (-2411.521) (-2414.785) (-2410.305) -- 0:00:07
      978000 -- (-2408.198) (-2407.912) (-2402.076) [-2403.532] * (-2403.639) (-2419.771) (-2409.008) [-2399.957] -- 0:00:07
      978500 -- (-2399.207) (-2405.815) [-2401.130] (-2399.518) * [-2407.437] (-2415.221) (-2410.866) (-2408.394) -- 0:00:07
      979000 -- (-2398.517) (-2402.996) (-2406.146) [-2393.250] * (-2410.208) (-2403.969) (-2406.273) [-2397.797] -- 0:00:07
      979500 -- (-2403.338) (-2404.383) [-2401.553] (-2406.899) * (-2417.315) (-2405.218) (-2406.485) [-2400.509] -- 0:00:07
      980000 -- (-2407.431) (-2411.381) (-2408.264) [-2397.185] * (-2409.760) (-2403.796) [-2408.089] (-2407.444) -- 0:00:07

      Average standard deviation of split frequencies: 0.005768

      980500 -- (-2403.704) (-2408.533) (-2404.970) [-2398.614] * (-2404.594) (-2398.851) (-2407.245) [-2400.112] -- 0:00:06
      981000 -- (-2406.455) (-2411.123) [-2396.647] (-2408.235) * (-2411.350) [-2403.216] (-2406.105) (-2399.950) -- 0:00:06
      981500 -- (-2403.465) (-2407.304) (-2405.529) [-2398.339] * [-2402.398] (-2398.300) (-2409.587) (-2402.998) -- 0:00:06
      982000 -- (-2408.091) (-2409.150) (-2410.286) [-2405.097] * (-2406.777) (-2401.097) (-2405.969) [-2400.581] -- 0:00:06
      982500 -- (-2403.779) (-2405.941) (-2401.855) [-2403.240] * (-2404.862) [-2398.048] (-2400.953) (-2405.084) -- 0:00:06
      983000 -- [-2403.354] (-2417.743) (-2404.028) (-2402.725) * (-2405.479) (-2398.860) [-2400.902] (-2402.659) -- 0:00:05
      983500 -- (-2407.098) (-2412.698) (-2397.588) [-2405.235] * [-2398.509] (-2399.700) (-2399.651) (-2405.061) -- 0:00:05
      984000 -- (-2405.180) [-2405.279] (-2399.517) (-2402.929) * (-2410.480) [-2400.856] (-2401.301) (-2404.073) -- 0:00:05
      984500 -- [-2399.655] (-2411.934) (-2403.472) (-2398.696) * [-2401.367] (-2406.809) (-2404.016) (-2410.254) -- 0:00:05
      985000 -- (-2399.228) [-2407.339] (-2401.494) (-2404.071) * (-2397.943) [-2406.161] (-2408.267) (-2410.310) -- 0:00:05

      Average standard deviation of split frequencies: 0.005355

      985500 -- (-2403.654) (-2409.129) (-2402.826) [-2401.679] * [-2402.321] (-2406.193) (-2407.921) (-2409.905) -- 0:00:05
      986000 -- (-2402.311) [-2401.913] (-2401.637) (-2406.195) * (-2406.175) [-2403.226] (-2410.119) (-2409.185) -- 0:00:04
      986500 -- (-2402.803) (-2404.357) (-2405.112) [-2406.952] * (-2404.337) (-2401.921) (-2407.924) [-2397.507] -- 0:00:04
      987000 -- (-2407.209) (-2405.333) (-2411.719) [-2400.872] * (-2407.728) (-2404.407) (-2405.894) [-2398.860] -- 0:00:04
      987500 -- (-2403.696) (-2412.707) (-2400.012) [-2398.346] * (-2405.070) [-2398.940] (-2400.235) (-2400.913) -- 0:00:04
      988000 -- (-2407.599) [-2399.937] (-2395.957) (-2405.082) * [-2400.431] (-2400.824) (-2401.417) (-2403.994) -- 0:00:04
      988500 -- (-2410.950) [-2399.178] (-2406.330) (-2403.297) * [-2403.287] (-2413.220) (-2406.517) (-2405.825) -- 0:00:04
      989000 -- (-2407.017) [-2402.496] (-2401.545) (-2402.939) * (-2412.907) (-2413.903) (-2411.867) [-2406.247] -- 0:00:03
      989500 -- (-2408.264) (-2402.689) (-2408.364) [-2407.540] * (-2417.053) (-2414.688) (-2403.562) [-2399.092] -- 0:00:03
      990000 -- [-2402.113] (-2409.363) (-2403.849) (-2410.883) * (-2412.059) (-2401.585) [-2404.600] (-2406.718) -- 0:00:03

      Average standard deviation of split frequencies: 0.005710

      990500 -- (-2406.606) (-2406.539) [-2404.547] (-2405.386) * (-2412.213) (-2404.181) [-2398.736] (-2404.275) -- 0:00:03
      991000 -- (-2399.773) (-2404.489) [-2402.396] (-2400.702) * [-2409.824] (-2413.300) (-2405.599) (-2400.010) -- 0:00:03
      991500 -- (-2400.331) (-2405.242) (-2406.517) [-2404.988] * (-2406.781) [-2402.607] (-2408.903) (-2407.610) -- 0:00:02
      992000 -- (-2403.365) (-2401.481) [-2406.256] (-2402.358) * (-2398.638) (-2405.989) (-2418.338) [-2409.728] -- 0:00:02
      992500 -- (-2402.946) (-2406.040) [-2403.812] (-2396.459) * (-2404.777) (-2399.133) [-2400.383] (-2401.038) -- 0:00:02
      993000 -- (-2413.454) (-2402.059) (-2412.387) [-2399.390] * [-2404.286] (-2402.239) (-2402.117) (-2397.609) -- 0:00:02
      993500 -- (-2404.647) [-2404.807] (-2407.594) (-2398.459) * (-2413.079) [-2401.814] (-2404.882) (-2399.772) -- 0:00:02
      994000 -- [-2406.748] (-2405.805) (-2405.014) (-2396.127) * (-2410.372) (-2397.625) [-2400.286] (-2400.616) -- 0:00:02
      994500 -- (-2415.705) (-2405.541) (-2402.546) [-2398.258] * (-2394.817) (-2402.512) (-2402.959) [-2405.755] -- 0:00:01
      995000 -- (-2397.426) (-2403.470) (-2407.572) [-2397.927] * (-2403.778) (-2405.639) [-2408.626] (-2409.024) -- 0:00:01

      Average standard deviation of split frequencies: 0.005680

      995500 -- (-2400.782) (-2406.888) [-2404.759] (-2399.578) * (-2402.294) (-2406.173) (-2403.784) [-2402.514] -- 0:00:01
      996000 -- (-2409.585) [-2409.144] (-2395.667) (-2398.159) * (-2404.260) (-2404.689) [-2401.512] (-2412.845) -- 0:00:01
      996500 -- (-2399.035) [-2403.355] (-2403.437) (-2404.441) * (-2405.028) (-2407.251) (-2400.988) [-2405.648] -- 0:00:01
      997000 -- (-2401.075) [-2405.448] (-2400.177) (-2406.018) * (-2401.861) (-2403.587) [-2402.591] (-2404.077) -- 0:00:01
      997500 -- (-2403.254) (-2406.469) (-2401.645) [-2398.830] * (-2402.479) (-2407.309) (-2399.155) [-2398.893] -- 0:00:00
      998000 -- (-2413.035) (-2403.520) [-2400.388] (-2405.600) * [-2401.502] (-2407.059) (-2411.756) (-2406.792) -- 0:00:00
      998500 -- (-2404.995) (-2407.200) (-2402.354) [-2411.668] * (-2408.779) (-2402.925) [-2407.932] (-2403.173) -- 0:00:00
      999000 -- [-2403.174] (-2401.830) (-2402.867) (-2399.904) * [-2404.432] (-2401.057) (-2408.698) (-2403.676) -- 0:00:00
      999500 -- (-2398.808) (-2403.255) (-2402.110) [-2400.848] * (-2403.455) (-2401.728) (-2405.512) [-2402.584] -- 0:00:00
      1000000 -- (-2409.658) (-2404.103) (-2407.397) [-2408.224] * (-2408.952) (-2398.248) (-2402.522) [-2402.742] -- 0:00:00

      Average standard deviation of split frequencies: 0.006689
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -2409.658148 -- 10.750959
         Chain 1 -- -2409.658146 -- 10.750959
         Chain 2 -- -2404.102814 -- 13.473504
         Chain 2 -- -2404.102810 -- 13.473504
         Chain 3 -- -2407.396647 -- 12.990854
         Chain 3 -- -2407.396659 -- 12.990854
         Chain 4 -- -2408.224155 -- 13.156925
         Chain 4 -- -2408.224144 -- 13.156925
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -2408.952371 -- 12.639916
         Chain 1 -- -2408.952371 -- 12.639916
         Chain 2 -- -2398.247984 -- 9.310641
         Chain 2 -- -2398.247996 -- 9.310641
         Chain 3 -- -2402.521656 -- 13.010106
         Chain 3 -- -2402.521657 -- 13.010106
         Chain 4 -- -2402.741607 -- 11.920392
         Chain 4 -- -2402.741606 -- 11.920392

      Analysis completed in 5 mins 50 seconds
      Analysis used 349.59 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -2392.45
      Likelihood of best state for "cold" chain of run 2 was -2392.45

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            43.0 %     ( 31 %)     Dirichlet(Revmat{all})
            59.2 %     ( 37 %)     Slider(Revmat{all})
            25.7 %     ( 27 %)     Dirichlet(Pi{all})
            27.3 %     ( 31 %)     Slider(Pi{all})
            42.9 %     ( 23 %)     Multiplier(Alpha{1,2})
            42.0 %     ( 33 %)     Multiplier(Alpha{3})
            55.4 %     ( 34 %)     Slider(Pinvar{all})
             3.3 %     (  2 %)     ExtSPR(Tau{all},V{all})
             0.1 %     (  0 %)     ExtTBR(Tau{all},V{all})
             4.4 %     (  5 %)     NNI(Tau{all},V{all})
             8.3 %     ( 10 %)     ParsSPR(Tau{all},V{all})
            26.3 %     ( 35 %)     Multiplier(V{all})
            30.7 %     ( 33 %)     Nodeslider(V{all})
            25.1 %     ( 33 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            43.4 %     ( 36 %)     Dirichlet(Revmat{all})
            58.3 %     ( 39 %)     Slider(Revmat{all})
            25.1 %     ( 29 %)     Dirichlet(Pi{all})
            27.5 %     ( 25 %)     Slider(Pi{all})
            42.0 %     ( 28 %)     Multiplier(Alpha{1,2})
            42.6 %     ( 22 %)     Multiplier(Alpha{3})
            55.3 %     ( 41 %)     Slider(Pinvar{all})
             3.3 %     (  7 %)     ExtSPR(Tau{all},V{all})
             0.1 %     (  0 %)     ExtTBR(Tau{all},V{all})
             4.3 %     (  2 %)     NNI(Tau{all},V{all})
             8.2 %     (  6 %)     ParsSPR(Tau{all},V{all})
            26.1 %     ( 32 %)     Multiplier(V{all})
            30.4 %     ( 32 %)     Nodeslider(V{all})
            25.5 %     ( 22 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.82    0.66    0.53 
         2 |  165796            0.83    0.69 
         3 |  167253  166609            0.85 
         4 |  166854  166876  166612         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.82    0.66    0.53 
         2 |  165800            0.84    0.69 
         3 |  166385  166924            0.85 
         4 |  166811  166922  167158         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -2400.87
      |   1                                                        |
      |                                                1           |
      |                                                     *    1 |
      |       1       2         2                                  |
      |     2  2                  1           1                    |
      |           1   1   1    2   1  2       2    1 1    21   1   |
      |1 *    2 2  2 2 22      1    2  * 2 2     1  2      2 2121  |
      |    1 2          112   1    2  1 2      2*   1            2 |
      | 2   11 1   1 1       1  1       1121 2   21  2       1     |
      |   2              2 12    1  1       1           12    2   *|
      |2   2    1          2 2   2   2      21 1      *  1      2  |
      |          12               2               22   2  1        |
      | 1        2          1             1             2          |
      |             *  1             1                             |
      |                       2                                    |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2404.82
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1      -2398.61         -2409.66
        2      -2398.87         -2411.80
      --------------------------------------
      TOTAL    -2398.73         -2411.22
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.820105    0.008222    0.651108    1.000156    0.812905   1067.72   1096.52    1.000
      r(A<->C){all}   0.079087    0.000409    0.041854    0.120711    0.077942    920.17    989.87    1.000
      r(A<->G){all}   0.196543    0.001057    0.134646    0.260142    0.195006    957.57    978.50    1.000
      r(A<->T){all}   0.110014    0.000917    0.054042    0.169338    0.107765    988.70   1009.44    1.000
      r(C<->G){all}   0.062425    0.000265    0.032195    0.095200    0.061588   1043.50   1109.52    1.000
      r(C<->T){all}   0.494200    0.002429    0.399754    0.591764    0.493357    736.15    768.44    1.001
      r(G<->T){all}   0.057731    0.000344    0.024252    0.094673    0.056321   1072.94   1103.32    1.000
      pi(A){all}      0.259035    0.000210    0.230489    0.287533    0.258521   1089.84   1133.28    1.000
      pi(C){all}      0.263281    0.000201    0.235066    0.289907    0.263120   1126.05   1163.10    1.000
      pi(G){all}      0.269155    0.000207    0.240979    0.297106    0.268850   1156.56   1163.62    1.000
      pi(T){all}      0.208530    0.000184    0.182554    0.234673    0.208347   1021.33   1107.82    1.000
      alpha{1,2}      0.081995    0.001152    0.000923    0.129880    0.087793   1057.72   1164.39    1.001
      alpha{3}        3.078765    0.938903    1.353621    4.886878    2.957174   1259.75   1380.38    1.000
      pinvar{all}     0.201510    0.005327    0.064091    0.350348    0.203520   1282.21   1297.91    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6
      7 -- C7

   Key to taxon bipartitions (saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   -------------
    1 -- .******
    2 -- .*.....
    3 -- ..*....
    4 -- ...*...
    5 -- ....*..
    6 -- .....*.
    7 -- ......*
    8 -- .....**
    9 -- ....***
   10 -- .**....
   11 -- ...****
   12 -- .**.***
   -------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    8  3002    1.000000    0.000000    1.000000    1.000000    2
    9  3002    1.000000    0.000000    1.000000    1.000000    2
   10  2998    0.998668    0.000942    0.998001    0.999334    2
   11  1547    0.515323    0.016488    0.503664    0.526982    2
   12  1450    0.483011    0.016017    0.471686    0.494337    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.037223    0.000123    0.017131    0.059603    0.036202    1.000    2
   length{all}[2]     0.009896    0.000022    0.001466    0.018625    0.009157    1.000    2
   length{all}[3]     0.011383    0.000024    0.003020    0.021338    0.010634    1.000    2
   length{all}[4]     0.101225    0.000550    0.058311    0.148505    0.099730    1.000    2
   length{all}[5]     0.183640    0.001406    0.115521    0.258941    0.180678    1.000    2
   length{all}[6]     0.160803    0.000991    0.101592    0.220929    0.158274    1.000    2
   length{all}[7]     0.077809    0.000463    0.036748    0.120151    0.075535    1.000    2
   length{all}[8]     0.073899    0.000649    0.029402    0.125672    0.071321    1.000    2
   length{all}[9]     0.114945    0.000824    0.064605    0.175930    0.112756    1.000    2
   length{all}[10]    0.026259    0.000121    0.005681    0.047045    0.025223    1.000    2
   length{all}[11]    0.027696    0.000148    0.006469    0.052934    0.026451    1.000    2
   length{all}[12]    0.018166    0.000078    0.002840    0.035430    0.017003    1.001    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.006689
       Maximum standard deviation of split frequencies = 0.016488
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.001


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |                                                     /------------------ C2 (2)
   |-------------------------100-------------------------+                         
   +                                                     \------------------ C3 (3)
   |                                                                               
   |                 /------------------------------------------------------ C4 (4)
   |                 |                                                             
   \--------52-------+                 /------------------------------------ C5 (5)
                     |                 |                                           
                     \-------100-------+                 /------------------ C6 (6)
                                       \-------100-------+                         
                                                         \------------------ C7 (7)
                                                                                   

   Phylogram (based on average branch lengths):

   /------- C1 (1)
   |                                                                               
   |    /-- C2 (2)
   |----+                                                                          
   +    \-- C3 (3)
   |                                                                               
   |    /-------------------- C4 (4)
   |    |                                                                          
   \----+                     /----------------------------------- C5 (5)
        |                     |                                                    
        \---------------------+             /------------------------------- C6 (6)
                              \-------------+                                      
                                            \--------------- C7 (7)
                                                                                   
   |--------| 0.050 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (5 trees sampled):
      90 % credible set contains 2 trees
      95 % credible set contains 2 trees
      99 % credible set contains 2 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 7  	ls = 783
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Sequences read..
Counting site patterns..  0:00

         194 patterns at      261 /      261 sites (100.0%),  0:00
Counting codons..


      168 bytes for distance
   189344 bytes for conP
    26384 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, (2, 3), (4, (5, (6, 7))));   MP score: 266
   473360 bytes for conP, adjusted

    0.081374    0.040905    0.007442    0.027956    0.042065    0.148320    0.137374    0.291601    0.116091    0.253564    0.127162    0.300000    1.300000

ntime & nrate & np:    11     2    13

Bounds (np=13):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    13
lnL0 = -2674.261875

Iterating by ming2
Initial: fx=  2674.261875
x=  0.08137  0.04090  0.00744  0.02796  0.04206  0.14832  0.13737  0.29160  0.11609  0.25356  0.12716  0.30000  1.30000

  1 h-m-p  0.0000 0.0006 443.3641 +++    2634.109103  m 0.0006    19 | 0/13
  2 h-m-p  0.0000 0.0000 18182.1481 YCCC   2612.767369  3 0.0000    40 | 0/13
  3 h-m-p  0.0004 0.0018 506.3850 +YCYCCC  2499.534216  5 0.0017    65 | 0/13
  4 h-m-p  0.0000 0.0001 1900.4452 +YYCYCYC  2478.470505  6 0.0001    90 | 0/13
  5 h-m-p  0.0002 0.0010 376.8843 ++     2427.046235  m 0.0010   106 | 0/13
  6 h-m-p  0.0000 0.0000 24843.2474 
h-m-p:      5.32508587e-21      2.66254294e-20      2.48432474e+04  2427.046235
..  | 0/13
  7 h-m-p  0.0000 0.0014 5928.8789 YYYCCCCC  2406.045817  7 0.0000   146 | 0/13
  8 h-m-p  0.0001 0.0014 364.9287 +YCYYYYYCCC  2338.855092 10 0.0010   176 | 0/13
  9 h-m-p  0.0001 0.0003 435.8975 CYCCCC  2331.322373  5 0.0001   201 | 0/13
 10 h-m-p  0.0001 0.0006 252.7182 +YCYCCC  2322.939531  5 0.0003   226 | 0/13
 11 h-m-p  0.0021 0.0105  29.3674 YCC    2322.330901  2 0.0014   245 | 0/13
 12 h-m-p  0.0017 0.0564  23.4912 CCCC   2321.792104  3 0.0026   267 | 0/13
 13 h-m-p  0.0011 0.0240  55.7657 +CCCC  2319.339658  3 0.0052   290 | 0/13
 14 h-m-p  0.0015 0.0091 198.1753 YYCCC  2316.162817  4 0.0022   312 | 0/13
 15 h-m-p  0.0009 0.0046 207.5387 CCCCC  2313.351342  4 0.0016   336 | 0/13
 16 h-m-p  0.0024 0.0120  32.4210 YCC    2313.141821  2 0.0009   355 | 0/13
 17 h-m-p  0.0022 0.0108  11.9298 YCC    2313.029162  2 0.0014   374 | 0/13
 18 h-m-p  0.0076 0.1802   2.2277 +CCC   2311.757004  2 0.0261   395 | 0/13
 19 h-m-p  0.0014 0.0069   9.5564 +YYYYYC  2304.096805  5 0.0054   417 | 0/13
 20 h-m-p  0.0003 0.0015  70.2988 YCCCCC  2302.223664  5 0.0006   442 | 0/13
 21 h-m-p  0.0591 0.9927   0.7398 +YCYCCC  2298.446483  5 0.5438   467 | 0/13
 22 h-m-p  0.3502 2.0437   1.1488 YCYC   2297.076637  3 0.2360   500 | 0/13
 23 h-m-p  0.6677 3.3385   0.1400 YYC    2296.902208  2 0.6019   518 | 0/13
 24 h-m-p  1.6000 8.0000   0.0520 CCC    2296.844048  2 0.5037   551 | 0/13
 25 h-m-p  0.9575 8.0000   0.0273 C      2296.818996  0 0.9575   580 | 0/13
 26 h-m-p  1.6000 8.0000   0.0079 YC     2296.799999  1 3.9299   610 | 0/13
 27 h-m-p  1.6000 8.0000   0.0058 +YC    2296.729651  1 4.5445   641 | 0/13
 28 h-m-p  1.6000 8.0000   0.0047 YC     2296.715481  1 1.2441   671 | 0/13
 29 h-m-p  1.6000 8.0000   0.0010 YC     2296.714462  1 0.9936   701 | 0/13
 30 h-m-p  1.6000 8.0000   0.0005 Y      2296.714421  0 1.0528   730 | 0/13
 31 h-m-p  1.6000 8.0000   0.0001 Y      2296.714420  0 0.9288   759 | 0/13
 32 h-m-p  1.6000 8.0000   0.0000 Y      2296.714420  0 1.2051   788 | 0/13
 33 h-m-p  1.6000 8.0000   0.0000 ----------------..  | 0/13
 34 h-m-p  0.0160 8.0000   0.0019 ------------C  2296.714420  0 0.0000   872 | 0/13
 35 h-m-p  0.0004 0.1812   0.1230 ----------..  | 0/13
 36 h-m-p  0.0160 8.0000   0.0019 ------------- | 0/13
 37 h-m-p  0.0160 8.0000   0.0019 -------------
Out..
lnL  = -2296.714420
990 lfun, 990 eigenQcodon, 10890 P(t)

Time used:  0:05


Model 1: NearlyNeutral

TREE #  1
(1, (2, 3), (4, (5, (6, 7))));   MP score: 266
    0.081374    0.040905    0.007442    0.027956    0.042065    0.148320    0.137374    0.291601    0.116091    0.253564    0.127162    1.974197    0.534390    0.193110

ntime & nrate & np:    11     2    14

Bounds (np=14):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 7.100693

np =    14
lnL0 = -2375.073962

Iterating by ming2
Initial: fx=  2375.073962
x=  0.08137  0.04090  0.00744  0.02796  0.04206  0.14832  0.13737  0.29160  0.11609  0.25356  0.12716  1.97420  0.53439  0.19311

  1 h-m-p  0.0000 0.0009 423.4873 ++++   2322.480491  m 0.0009    35 | 1/14
  2 h-m-p  0.0004 0.0021 157.1123 CCCCC  2316.850528  4 0.0005    74 | 0/14
  3 h-m-p  0.0000 0.0000 13323.6273 YCCCCC  2310.181257  5 0.0000   113 | 0/14
  4 h-m-p  0.0001 0.0004  78.5000 YCYCC  2309.637241  4 0.0002   150 | 0/14
  5 h-m-p  0.0007 0.0090  20.5964 YCCC   2309.302310  3 0.0016   186 | 0/14
  6 h-m-p  0.0018 0.0106  17.7089 CCC    2309.227241  2 0.0006   221 | 0/14
  7 h-m-p  0.0011 0.0365  10.0444 +YCC   2309.057283  2 0.0033   256 | 0/14
  8 h-m-p  0.0019 0.0723  17.0749 +CYC   2308.274030  2 0.0086   291 | 0/14
  9 h-m-p  0.0025 0.0330  58.6281 +CYC   2305.307425  2 0.0096   326 | 0/14
 10 h-m-p  0.0026 0.0128 130.3523 CYCCC  2302.154415  4 0.0040   364 | 0/14
 11 h-m-p  0.0079 0.0394  15.7030 YCCC   2301.732848  3 0.0040   400 | 0/14
 12 h-m-p  0.0099 0.0493   3.6924 CYCCC  2300.539192  4 0.0147   438 | 0/14
 13 h-m-p  0.0037 0.0186  11.4386 +YCYYYCC  2278.320389  6 0.0165   478 | 0/14
 14 h-m-p  0.0003 0.0013  50.3827 YCYCCC  2277.110727  5 0.0006   517 | 0/14
 15 h-m-p  0.0072 0.0383   4.5312 YCC    2277.026747  2 0.0030   551 | 0/14
 16 h-m-p  0.0035 0.3796   3.8411 ++YCCC  2271.922725  3 0.1014   589 | 0/14
 17 h-m-p  0.2200 1.6991   1.7703 YCCCC  2267.215016  4 0.4881   627 | 0/14
 18 h-m-p  1.4214 7.1070   0.1791 YCCC   2266.710330  3 0.6082   663 | 0/14
 19 h-m-p  0.9351 4.6756   0.0402 CCCC   2266.142036  3 1.0227   700 | 0/14
 20 h-m-p  1.1137 8.0000   0.0369 CCC    2265.746854  2 1.4423   735 | 0/14
 21 h-m-p  1.6000 8.0000   0.0223 YCCC   2265.504330  3 0.9046   771 | 0/14
 22 h-m-p  1.5548 8.0000   0.0130 YCC    2265.359926  2 0.8826   805 | 0/14
 23 h-m-p  0.8982 8.0000   0.0128 CC     2265.341637  1 0.9819   838 | 0/14
 24 h-m-p  1.1967 8.0000   0.0105 YC     2265.340232  1 0.7514   870 | 0/14
 25 h-m-p  1.6000 8.0000   0.0020 Y      2265.340116  0 0.7111   901 | 0/14
 26 h-m-p  1.6000 8.0000   0.0006 Y      2265.340106  0 0.8475   932 | 0/14
 27 h-m-p  1.6000 8.0000   0.0002 Y      2265.340105  0 0.7487   963 | 0/14
 28 h-m-p  1.6000 8.0000   0.0000 Y      2265.340105  0 1.0045   994 | 0/14
 29 h-m-p  1.6000 8.0000   0.0000 Y      2265.340105  0 0.8529  1025 | 0/14
 30 h-m-p  1.6000 8.0000   0.0000 Y      2265.340105  0 1.2151  1056 | 0/14
 31 h-m-p  1.6000 8.0000   0.0000 C      2265.340105  0 1.6000  1087 | 0/14
 32 h-m-p  1.6000 8.0000   0.0000 ----------------..  | 0/14
 33 h-m-p  0.0160 8.0000   0.0003 -------------
Out..
lnL  = -2265.340105
1175 lfun, 3525 eigenQcodon, 25850 P(t)

Time used:  0:17


Model 2: PositiveSelection

TREE #  1
(1, (2, 3), (4, (5, (6, 7))));   MP score: 266
initial w for M2:NSpselection reset.

    0.081374    0.040905    0.007442    0.027956    0.042065    0.148320    0.137374    0.291601    0.116091    0.253564    0.127162    2.088670    1.131355    0.291249    0.418683    2.981222

ntime & nrate & np:    11     3    16

Bounds (np=16):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 4.536371

np =    16
lnL0 = -2435.553517

Iterating by ming2
Initial: fx=  2435.553517
x=  0.08137  0.04090  0.00744  0.02796  0.04206  0.14832  0.13737  0.29160  0.11609  0.25356  0.12716  2.08867  1.13136  0.29125  0.41868  2.98122

  1 h-m-p  0.0000 0.0028 379.3670 ++YYCYC  2429.004595  4 0.0002    44 | 0/16
  2 h-m-p  0.0003 0.0017 278.5451 ++     2330.933963  m 0.0017    79 | 1/16
  3 h-m-p  0.0004 0.0020 443.2957 CYCCC  2325.422084  4 0.0003   121 | 1/16
  4 h-m-p  0.0005 0.0026 145.8208 +YYCCC  2316.552387  4 0.0016   162 | 0/16
  5 h-m-p  0.0000 0.0000 5275.7638 YCCCC  2313.747377  4 0.0000   203 | 0/16
  6 h-m-p  0.0017 0.0149  39.6481 +CCCCC  2308.347873  4 0.0074   247 | 0/16
  7 h-m-p  0.0005 0.0027 128.9681 YCC    2306.772792  2 0.0009   285 | 0/16
  8 h-m-p  0.0034 0.0221  33.1954 YCCC   2304.529716  3 0.0063   325 | 0/16
  9 h-m-p  0.0181 0.1081  11.5954 YCCCC  2301.019861  4 0.0318   367 | 0/16
 10 h-m-p  0.0018 0.0090  73.7232 +YYCCCC  2295.993195  5 0.0060   411 | 0/16
 11 h-m-p  0.0021 0.0107  43.8323 YCCCC  2294.478057  4 0.0042   453 | 0/16
 12 h-m-p  0.0081 0.0408  22.5396 YYC    2293.731353  2 0.0057   490 | 0/16
 13 h-m-p  0.0074 0.0688  17.3769 +YCCC  2291.919672  3 0.0196   531 | 0/16
 14 h-m-p  0.0115 0.0574  26.3914 YYC    2290.731046  2 0.0095   568 | 0/16
 15 h-m-p  0.0186 0.0930  11.6482 YCCC   2290.282261  3 0.0100   608 | 0/16
 16 h-m-p  0.0094 0.4059  12.4539 ++CCCCC  2282.334597  4 0.1581   653 | 0/16
 17 h-m-p  0.0869 0.4344   2.8070 +YYCCCC  2275.850396  5 0.2731   697 | 0/16
 18 h-m-p  0.0992 0.4959   4.1828 CCCCC  2272.650929  4 0.1315   740 | 0/16
 19 h-m-p  0.2256 1.3392   2.4372 CCC    2270.531355  2 0.1989   779 | 0/16
 20 h-m-p  1.2855 7.3046   0.3770 YCCC   2269.323689  3 0.7561   819 | 0/16
 21 h-m-p  0.2952 3.5274   0.9657 YCCC   2268.630562  3 0.5318   859 | 0/16
 22 h-m-p  0.3241 2.2877   1.5844 YCCC   2267.550037  3 0.7277   899 | 0/16
 23 h-m-p  0.8291 5.5569   1.3906 CYC    2266.865482  2 0.7583   937 | 0/16
 24 h-m-p  0.7544 8.0000   1.3978 CC     2266.349261  1 0.7514   974 | 0/16
 25 h-m-p  0.7848 5.2445   1.3383 CCCC   2265.876071  3 0.9731  1015 | 0/16
 26 h-m-p  0.9051 4.5253   1.2396 YC     2265.685095  1 0.5314  1051 | 0/16
 27 h-m-p  0.9859 8.0000   0.6682 CYC    2265.615089  2 0.9136  1089 | 0/16
 28 h-m-p  0.7811 8.0000   0.7815 CCC    2265.541569  2 1.1046  1128 | 0/16
 29 h-m-p  0.7307 8.0000   1.1813 CCC    2265.478456  2 0.8614  1167 | 0/16
 30 h-m-p  0.9684 8.0000   1.0508 C      2265.430984  0 0.9684  1202 | 0/16
 31 h-m-p  0.7432 8.0000   1.3693 CCC    2265.400739  2 0.6054  1241 | 0/16
 32 h-m-p  0.8994 8.0000   0.9217 CYC    2265.380712  2 1.0219  1279 | 0/16
 33 h-m-p  1.1849 8.0000   0.7949 YCC    2265.363289  2 2.0351  1317 | 0/16
 34 h-m-p  1.6000 8.0000   0.9756 CCC    2265.349303  2 2.1172  1356 | 0/16
 35 h-m-p  1.6000 8.0000   0.8622 C      2265.344770  0 1.6000  1391 | 0/16
 36 h-m-p  1.4790 8.0000   0.9328 C      2265.342834  0 1.4790  1426 | 0/16
 37 h-m-p  1.5045 8.0000   0.9170 C      2265.341881  0 1.4052  1461 | 0/16
 38 h-m-p  1.3606 8.0000   0.9471 C      2265.341102  0 1.6557  1496 | 0/16
 39 h-m-p  1.4952 8.0000   1.0488 C      2265.340557  0 1.4952  1531 | 0/16
 40 h-m-p  1.6000 8.0000   0.9241 C      2265.340321  0 1.7816  1566 | 0/16
 41 h-m-p  1.6000 8.0000   0.7482 C      2265.340224  0 2.2334  1601 | 0/16
 42 h-m-p  1.6000 8.0000   0.8895 C      2265.340159  0 2.0722  1636 | 0/16
 43 h-m-p  1.6000 8.0000   0.9379 C      2265.340129  0 1.8667  1671 | 0/16
 44 h-m-p  1.6000 8.0000   0.8203 Y      2265.340115  0 2.8317  1706 | 0/16
 45 h-m-p  1.6000 8.0000   0.8585 C      2265.340109  0 2.2727  1741 | 0/16
 46 h-m-p  1.6000 8.0000   0.8451 Y      2265.340107  0 2.8870  1776 | 0/16
 47 h-m-p  1.6000 8.0000   0.9101 C      2265.340106  0 2.3782  1811 | 0/16
 48 h-m-p  1.6000 8.0000   0.9495 Y      2265.340105  0 2.8613  1846 | 0/16
 49 h-m-p  1.6000 8.0000   1.6244 Y      2265.340105  0 3.3008  1881 | 0/16
 50 h-m-p  1.6000 8.0000   2.9003 C      2265.340105  0 2.4864  1916 | 0/16
 51 h-m-p  0.1288 3.1378  55.9674 -C     2265.340105  0 0.0081  1952 | 0/16
 52 h-m-p  0.1498 8.0000   3.0078 ++Y    2265.340105  0 1.6011  1989 | 0/16
 53 h-m-p  0.2772 8.0000  17.3703 Y      2265.340105  0 0.4571  2024 | 0/16
 54 h-m-p  0.1388 1.2640  57.2192 ---------------..  | 0/16
 55 h-m-p  0.0160 8.0000   0.0011 -------------
Out..
lnL  = -2265.340105
2119 lfun, 8476 eigenQcodon, 69927 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -2278.612698  S = -2180.439074   -89.013483
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 194 patterns   0:48
	did  20 / 194 patterns   0:48
	did  30 / 194 patterns   0:48
	did  40 / 194 patterns   0:48
	did  50 / 194 patterns   0:48
	did  60 / 194 patterns   0:48
	did  70 / 194 patterns   0:48
	did  80 / 194 patterns   0:48
	did  90 / 194 patterns   0:48
	did 100 / 194 patterns   0:48
	did 110 / 194 patterns   0:48
	did 120 / 194 patterns   0:48
	did 130 / 194 patterns   0:48
	did 140 / 194 patterns   0:49
	did 150 / 194 patterns   0:49
	did 160 / 194 patterns   0:49
	did 170 / 194 patterns   0:49
	did 180 / 194 patterns   0:49
	did 190 / 194 patterns   0:49
	did 194 / 194 patterns   0:49
Time used:  0:49


Model 3: discrete

TREE #  1
(1, (2, 3), (4, (5, (6, 7))));   MP score: 266
    0.081374    0.040905    0.007442    0.027956    0.042065    0.148320    0.137374    0.291601    0.116091    0.253564    0.127162    2.088672    0.960589    0.897086    0.042885    0.110318    0.150237

ntime & nrate & np:    11     4    17

Bounds (np=17):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 14.911874

np =    17
lnL0 = -2293.084445

Iterating by ming2
Initial: fx=  2293.084445
x=  0.08137  0.04090  0.00744  0.02796  0.04206  0.14832  0.13737  0.29160  0.11609  0.25356  0.12716  2.08867  0.96059  0.89709  0.04289  0.11032  0.15024

  1 h-m-p  0.0000 0.0003 296.6895 +++    2288.495560  m 0.0003    40 | 1/17
  2 h-m-p  0.0006 0.0028  87.8545 CCCC   2286.188357  3 0.0007    83 | 1/17
  3 h-m-p  0.0001 0.0004 145.0972 YCYCCC  2285.388426  5 0.0002   127 | 1/17
  4 h-m-p  0.0001 0.0025 164.0473 ++YCYCCC  2274.814405  5 0.0017   173 | 1/17
  5 h-m-p  0.0001 0.0005 175.8338 YCCCC  2273.845803  4 0.0002   216 | 1/17
  6 h-m-p  0.0006 0.0038  68.7609 CCCC   2272.996783  3 0.0008   258 | 1/17
  7 h-m-p  0.0014 0.0102  36.7617 YCCC   2272.630207  3 0.0010   299 | 1/17
  8 h-m-p  0.0013 0.0078  27.1959 YCC    2272.440174  2 0.0009   338 | 1/17
  9 h-m-p  0.0035 0.0487   7.1302 YC     2272.391285  1 0.0017   375 | 1/17
 10 h-m-p  0.0038 0.1574   3.2102 YC     2272.289250  1 0.0073   412 | 1/17
 11 h-m-p  0.0017 0.1057  13.9664 +CCC   2271.626375  2 0.0093   453 | 1/17
 12 h-m-p  0.0025 0.0217  53.0424 CCCC   2270.475197  3 0.0039   495 | 1/17
 13 h-m-p  0.0039 0.0306  52.7242 YCCC   2270.014713  3 0.0017   536 | 1/17
 14 h-m-p  0.0211 0.1056   3.9412 CCC    2269.909863  2 0.0061   576 | 0/17
 15 h-m-p  0.0022 0.1359  10.7366 -CC    2269.897287  1 0.0002   615 | 0/17
 16 h-m-p  0.0001 0.0481  15.9376 ++++YCCC  2267.968912  3 0.0264   661 | 0/17
 17 h-m-p  0.1182 0.5908   1.6510 +YCYCCC  2265.039967  5 0.3367   707 | 0/17
 18 h-m-p  0.0605 0.3027   1.9727 YCCCC  2264.101699  4 0.1289   751 | 0/17
 19 h-m-p  0.1999 1.0787   1.2718 CCC    2263.536343  2 0.2855   792 | 0/17
 20 h-m-p  0.6691 4.1645   0.5428 CC     2263.346202  1 0.2577   831 | 0/17
 21 h-m-p  1.6000 8.0000   0.0312 YC     2263.322745  1 0.6881   869 | 0/17
 22 h-m-p  1.3543 8.0000   0.0158 CC     2263.316209  1 1.8305   908 | 0/17
 23 h-m-p  1.6000 8.0000   0.0169 CC     2263.312552  1 1.7895   947 | 0/17
 24 h-m-p  1.6000 8.0000   0.0069 C      2263.312116  0 1.5122   984 | 0/17
 25 h-m-p  1.6000 8.0000   0.0020 +C     2263.310981  0 6.2983  1022 | 0/17
 26 h-m-p  1.6000 8.0000   0.0027 CC     2263.310237  1 2.0733  1061 | 0/17
 27 h-m-p  1.6000 8.0000   0.0031 +CY    2263.308079  1 5.7613  1101 | 0/17
 28 h-m-p  1.6000 8.0000   0.0024 C      2263.306792  0 1.5862  1138 | 0/17
 29 h-m-p  0.6816 8.0000   0.0056 C      2263.306619  0 0.6816  1175 | 0/17
 30 h-m-p  1.0716 8.0000   0.0036 C      2263.306546  0 1.0250  1212 | 0/17
 31 h-m-p  1.6000 8.0000   0.0012 Y      2263.306532  0 1.0680  1249 | 0/17
 32 h-m-p  1.6000 8.0000   0.0006 Y      2263.306530  0 0.9909  1286 | 0/17
 33 h-m-p  1.6000 8.0000   0.0000 Y      2263.306530  0 0.9329  1323 | 0/17
 34 h-m-p  1.6000 8.0000   0.0000 Y      2263.306530  0 1.6000  1360 | 0/17
 35 h-m-p  1.6000 8.0000   0.0000 Y      2263.306530  0 1.6000  1397 | 0/17
 36 h-m-p  1.6000 8.0000   0.0000 ----Y  2263.306530  0 0.0016  1438
Out..
lnL  = -2263.306530
1439 lfun, 5756 eigenQcodon, 47487 P(t)

Time used:  1:10


Model 7: beta

TREE #  1
(1, (2, 3), (4, (5, (6, 7))));   MP score: 266
    0.081374    0.040905    0.007442    0.027956    0.042065    0.148320    0.137374    0.291601    0.116091    0.253564    0.127162    2.028450    0.496071    1.323761

ntime & nrate & np:    11     1    14

Bounds (np=14):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 10.508244

np =    14
lnL0 = -2306.524556

Iterating by ming2
Initial: fx=  2306.524556
x=  0.08137  0.04090  0.00744  0.02796  0.04206  0.14832  0.13737  0.29160  0.11609  0.25356  0.12716  2.02845  0.49607  1.32376

  1 h-m-p  0.0000 0.0010 309.4509 ++YCYCCC  2303.701229  5 0.0001    43 | 0/14
  2 h-m-p  0.0002 0.0008 205.0199 +YYYYCC  2293.155010  5 0.0006    81 | 0/14
  3 h-m-p  0.0000 0.0002 1579.6735 +YCCC  2283.169607  3 0.0001   118 | 0/14
  4 h-m-p  0.0002 0.0009 279.9855 CYCCC  2275.063415  4 0.0004   157 | 0/14
  5 h-m-p  0.0021 0.0105  22.0168 YCCC   2274.858343  3 0.0009   193 | 0/14
  6 h-m-p  0.0005 0.0059  35.1100 YCCC   2274.498836  3 0.0012   229 | 0/14
  7 h-m-p  0.0017 0.0330  24.5916 +CCCC  2273.245961  3 0.0081   267 | 0/14
  8 h-m-p  0.0023 0.0116  71.0339 YCYCCC  2270.436125  5 0.0058   306 | 0/14
  9 h-m-p  0.0013 0.0064 157.7337 YYYY   2269.227242  3 0.0013   340 | 0/14
 10 h-m-p  0.0028 0.0139  31.6347 CCC    2269.055212  2 0.0011   375 | 0/14
 11 h-m-p  0.0083 0.0845   4.2090 CC     2269.029897  1 0.0026   408 | 0/14
 12 h-m-p  0.0039 0.6944   2.8074 ++YCC  2268.745954  2 0.0517   444 | 0/14
 13 h-m-p  0.0034 0.0373  42.1092 YCC    2268.527834  2 0.0027   478 | 0/14
 14 h-m-p  0.0097 0.0488  11.6893 YC     2268.486329  1 0.0019   510 | 0/14
 15 h-m-p  0.0373 1.5068   0.5901 +YCCC  2267.386306  3 0.3563   547 | 0/14
 16 h-m-p  0.3204 2.2709   0.6563 YCCCC  2266.311312  4 0.6567   585 | 0/14
 17 h-m-p  1.0089 5.0445   0.3001 CYCCC  2264.742976  4 1.7178   623 | 0/14
 18 h-m-p  0.3165 1.5824   0.7599 CYCCC  2264.035819  4 0.5455   661 | 0/14
 19 h-m-p  1.6000 8.0000   0.0460 YCCC   2263.641344  3 0.8084   697 | 0/14
 20 h-m-p  1.0807 8.0000   0.0344 CCC    2263.523818  2 0.9382   732 | 0/14
 21 h-m-p  0.5016 8.0000   0.0643 CCC    2263.460217  2 0.8463   767 | 0/14
 22 h-m-p  1.0295 8.0000   0.0529 YC     2263.443870  1 0.7060   799 | 0/14
 23 h-m-p  1.6000 8.0000   0.0101 YC     2263.441700  1 0.7917   831 | 0/14
 24 h-m-p  1.6000 8.0000   0.0012 Y      2263.441584  0 0.6774   862 | 0/14
 25 h-m-p  1.6000 8.0000   0.0001 Y      2263.441582  0 0.8663   893 | 0/14
 26 h-m-p  1.6000 8.0000   0.0000 Y      2263.441582  0 0.9483   924 | 0/14
 27 h-m-p  1.6000 8.0000   0.0000 Y      2263.441582  0 1.1359   955 | 0/14
 28 h-m-p  1.6000 8.0000   0.0000 Y      2263.441582  0 0.4000   986 | 0/14
 29 h-m-p  0.3633 8.0000   0.0000 ---------------..  | 0/14
 30 h-m-p  0.0160 8.0000   0.0001 -------------
Out..
lnL  = -2263.441582
1073 lfun, 11803 eigenQcodon, 118030 P(t)

Time used:  2:01


Model 8: beta&w>1

TREE #  1
(1, (2, 3), (4, (5, (6, 7))));   MP score: 266
initial w for M8:NSbetaw>1 reset.

    0.081374    0.040905    0.007442    0.027956    0.042065    0.148320    0.137374    0.291601    0.116091    0.253564    0.127162    2.029656    0.900000    0.225525    1.016293    2.374037

ntime & nrate & np:    11     2    16

Bounds (np=16):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 8.640570

np =    16
lnL0 = -2306.850636

Iterating by ming2
Initial: fx=  2306.850636
x=  0.08137  0.04090  0.00744  0.02796  0.04206  0.14832  0.13737  0.29160  0.11609  0.25356  0.12716  2.02966  0.90000  0.22553  1.01629  2.37404

  1 h-m-p  0.0000 0.0003 499.8162 +++    2280.684264  m 0.0003    38 | 1/16
  2 h-m-p  0.0001 0.0006 161.0018 +YYCCC  2275.788641  4 0.0004    80 | 1/16
  3 h-m-p  0.0001 0.0006 277.3551 YYC    2274.525185  2 0.0001   116 | 1/16
  4 h-m-p  0.0010 0.0074  24.9455 CCC    2274.183770  2 0.0011   154 | 0/16
  5 h-m-p  0.0004 0.0153  68.5523 YCCC   2273.766091  3 0.0002   193 | 0/16
  6 h-m-p  0.0004 0.0105  34.3193 YCCC   2273.496665  3 0.0009   233 | 0/16
  7 h-m-p  0.0021 0.0136  13.6327 YCC    2273.394002  2 0.0014   271 | 0/16
  8 h-m-p  0.0016 0.0395  11.8623 YC     2273.222789  1 0.0038   307 | 0/16
  9 h-m-p  0.0021 0.0340  21.0111 YC     2272.871444  1 0.0051   343 | 0/16
 10 h-m-p  0.0013 0.0193  82.2217 +CCCCC  2271.118143  4 0.0062   387 | 0/16
 11 h-m-p  0.0006 0.0032 336.6931 +YYCCC  2268.259620  4 0.0022   429 | 0/16
 12 h-m-p  0.0008 0.0038  85.8359 YCCC   2267.853116  3 0.0015   469 | 0/16
 13 h-m-p  0.0059 0.0294   7.7927 CC     2267.808645  1 0.0023   506 | 0/16
 14 h-m-p  0.0038 0.0472   4.6601 +CCC   2267.647958  2 0.0168   546 | 0/16
 15 h-m-p  0.0006 0.0031  45.3865 ++     2267.173808  m 0.0031   581 | 0/16
 16 h-m-p -0.0000 -0.0000   1.6229 
h-m-p:     -0.00000000e+00     -0.00000000e+00      1.62291572e+00  2267.173808
..  | 0/16
 17 h-m-p  0.0000 0.0005  93.3652 ++YCCCCC  2266.227331  5 0.0002   659 | 0/16
 18 h-m-p  0.0002 0.0030  87.6702 YCCC   2265.284075  3 0.0004   699 | 0/16
 19 h-m-p  0.0004 0.0024  80.4802 CCCCC  2264.342104  4 0.0006   742 | 0/16
 20 h-m-p  0.0001 0.0005  29.3842 CYC    2264.309550  2 0.0001   780 | 0/16
 21 h-m-p  0.0001 0.0003  19.6838 ++     2264.253869  m 0.0003   815 | 1/16
 22 h-m-p  0.0005 0.0300  10.7409 C      2264.233974  0 0.0005   850 | 1/16
 23 h-m-p  0.0014 0.1120   4.0296 YC     2264.215704  1 0.0028   885 | 1/16
 24 h-m-p  0.0008 0.0218  14.1559 CC     2264.192528  1 0.0011   921 | 1/16
 25 h-m-p  0.0014 0.1981  11.5459 +CC    2264.089010  1 0.0070   958 | 1/16
 26 h-m-p  0.0014 0.0198  59.0489 CYC    2263.991851  2 0.0013   995 | 1/16
 27 h-m-p  0.0011 0.0258  66.4819 CYC    2263.901904  2 0.0011  1032 | 1/16
 28 h-m-p  0.0188 0.3274   3.8407 -CC    2263.896142  1 0.0016  1069 | 1/16
 29 h-m-p  0.0095 0.2761   0.6676 YC     2263.895701  1 0.0018  1104 | 1/16
 30 h-m-p  0.0093 4.6658   0.3367 +C     2263.891875  0 0.0371  1139 | 1/16
 31 h-m-p  0.0019 0.2792   6.6302 ++YCCC  2263.754504  3 0.0646  1180 | 1/16
 32 h-m-p  0.2614 1.3070   1.0872 YYCCCCC  2263.657862  6 0.3420  1224 | 1/16
 33 h-m-p  0.7662 3.8308   0.2093 YCCCC  2263.580536  4 0.8295  1265 | 1/16
 34 h-m-p  0.7902 8.0000   0.2197 YCC    2263.541099  2 0.3244  1302 | 1/16
 35 h-m-p  0.2616 1.3078   0.0756 CC     2263.513569  1 0.3149  1338 | 1/16
 36 h-m-p  0.2955 2.2307   0.0805 ++     2263.457807  m 2.2307  1372 | 2/16
 37 h-m-p  0.7088 8.0000   0.2522 YC     2263.444673  1 0.1031  1407 | 2/16
 38 h-m-p  1.6000 8.0000   0.0082 YC     2263.441608  1 0.9770  1441 | 2/16
 39 h-m-p  1.6000 8.0000   0.0008 Y      2263.441600  0 0.9362  1474 | 2/16
 40 h-m-p  1.6000 8.0000   0.0000 Y      2263.441600  0 0.9938  1507 | 2/16
 41 h-m-p  1.6000 8.0000   0.0000 ----------------..  | 2/16
 42 h-m-p  0.0160 8.0000   0.0004 -------Y  2263.441600  0 0.0000  1594
Out..
lnL  = -2263.441600
1595 lfun, 19140 eigenQcodon, 192995 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -2281.337423  S = -2182.045878   -90.874887
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 194 patterns   3:28
	did  20 / 194 patterns   3:28
	did  30 / 194 patterns   3:28
	did  40 / 194 patterns   3:28
	did  50 / 194 patterns   3:28
	did  60 / 194 patterns   3:29
	did  70 / 194 patterns   3:29
	did  80 / 194 patterns   3:29
	did  90 / 194 patterns   3:29
	did 100 / 194 patterns   3:29
	did 110 / 194 patterns   3:30
	did 120 / 194 patterns   3:30
	did 130 / 194 patterns   3:30
	did 140 / 194 patterns   3:30
	did 150 / 194 patterns   3:30
	did 160 / 194 patterns   3:31
	did 170 / 194 patterns   3:31
	did 180 / 194 patterns   3:31
	did 190 / 194 patterns   3:31
	did 194 / 194 patterns   3:31
Time used:  3:31
CodeML output code: -1
Download 
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=261 

D_melanogaster_140up-PA   MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER
D_sechellia_140up-PA      MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER
D_simulans_140up-PA       MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER
D_erecta_140up-PA         MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER
D_biarmipes_140up-PA      MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER
D_rhopaloa_140up-PA       MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER
D_elegans_140up-PA        MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER
                          *.*: ************ :: ..*:* ***.*******  * *****:**

D_melanogaster_140up-PA   LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
D_sechellia_140up-PA      LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
D_simulans_140up-PA       LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
D_erecta_140up-PA         LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN
D_biarmipes_140up-PA      LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
D_rhopaloa_140up-PA       LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
D_elegans_140up-PA        LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
                          **:**:*************:*********:************.*******

D_melanogaster_140up-PA   NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
D_sechellia_140up-PA      NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
D_simulans_140up-PA       NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
D_erecta_140up-PA         NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS
D_biarmipes_140up-PA      NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
D_rhopaloa_140up-PA       NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
D_elegans_140up-PA        NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS
                          *:****************:***********************:*****:*

D_melanogaster_140up-PA   VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL
D_sechellia_140up-PA      VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
D_simulans_140up-PA       VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
D_erecta_140up-PA         VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL
D_biarmipes_140up-PA      VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
D_rhopaloa_140up-PA       VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
D_elegans_140up-PA        VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
                          ****************:******:.*******************.*****

D_melanogaster_140up-PA   LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK
D_sechellia_140up-PA      LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
D_simulans_140up-PA       LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
D_erecta_140up-PA         LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK
D_biarmipes_140up-PA      LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK
D_rhopaloa_140up-PA       LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK
D_elegans_140up-PA        LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK
                          *************************:*** ********: * ***.****

D_melanogaster_140up-PA   TSEHVSLDTIK
D_sechellia_140up-PA      TSEQVSLDTIK
D_simulans_140up-PA       TSEQVSLDTIK
D_erecta_140up-PA         TAEQVSLDSIK
D_biarmipes_140up-PA      VPEEVSLDSVK
D_rhopaloa_140up-PA       KSSEVSLDSVK
D_elegans_140up-PA        VPEQVSLDSVK
                           ...****::*
Download 
>D_melanogaster_140up-PA
ATGAATTTTCTGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC
AACATTCGAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAACAAAACAT
ACAAGGCCTTTCTGGCCAGTAAACCACCAGAGGAAACAGGACTGGAGCGC
CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCCTCCGAGCT
TAACTCGGTTTACCAGGCCGGCTTCCTAGGATTCCTTATTGGAGCTATTT
ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC
AACCAGGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
AGATCAATTCACAGTCAACTTTGCCAAAGGCGGCTTCAAATGGGGCTGGC
GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACTTGTATGTCG
GTGTACCGTGGAAAATCCTCAATCTACGAATACTTGGCCGCTGGTTCCAT
CACCGGCTCGCTTTACAAAGTGAGTCTTGGTCTGCGGGGCATGGCGGCAG
GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG
CTGCTGATGAAAGCATCAGGGACCTCGATGGAAGAGGTTCGCTACTGGCA
GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA
AACTGACAGAGGACGAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA
ACATCCGAACATGTATCGCTGGACACGATCAAG
>D_sechellia_140up-PA
ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC
AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT
ACAAGGCATTTCTGGACAGTAAACTACCAGAAGAAACGGGACTGGAGCGC
CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT
TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT
ACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAATTTCATGGAGAAC
AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC
GAGTGGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG
GTGTACCGTGGAAAATCCTCAATATACGAATACTTGGCCGCTGGCTCCGT
CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG
GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGCTG
CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA
GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA
AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA
ACATCCGAACAGGTATCGCTGGACACGATCAAG
>D_simulans_140up-PA
ATGAATTTTATGTGGAAAGGACGCCGGTTTCTGATCGCAGGCATCCTGCC
AACTTTCCAAGGCGCCGCAGATGAAATAGTCGATAAGGAAAATAAAACCT
ACAAGGCCTTTCTGGACCGTAAACTACCAGAGGAAACGGGACTGGAGCGC
CTCAAACAAATGTTTTCAATCGACGAGTTTGGCAGCATATCCTCCGAGCT
TAACTCTGTTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCAATTT
ACGGCGGAGTTACACAATCGCGCGTGGCTTATATGAATTTCATGGAGAAC
AACCAGGCCACAGCCTTCAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
AGATCAATTCACAGTCAACTTCGCCAAAGGCGGCTTCAAATGGGGCTGGC
GAGTAGGACTTTTTACCACATCCTACTTCGGCATCATCACCTGCATGTCG
GTGTACCGTGGAAAATCCTCAATTTACGAATACTTGGCCGCTGGTTCCGT
CACCGGCTCGCTGTACAAAGTGAATCTGGGTCTGCGGGGCATGGCGGCAG
GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGTGTGACGTCGTTG
CTGCTGATGAAGGCATCCGGGACCTCGATGGAGGAGGTTCGCTACTGGCA
GTACAAATGGCGACTCGATCGCGACGAAAACATTCAACAGGCGTTCAAAA
AACTGACAGAGGACCAAAACCCAGAGCTTTTCAAGGCCCACGACGAGAAA
ACATCCGAACAGGTATCGCTGGACACGATCAAG
>D_erecta_140up-PA
ATGAATTTTCTGTGGAAAGGCCGTCGGTTTCTGATCGCAGGTATCCTGCC
AACATTTGACGGCAGCTCAGACGACATAATCGACAAGGAAAGCAAAACTT
ACAAGGCCTTCCTGGCCAGTAAACCACCAGAGGAAACGGGACTGGAGCGC
CTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCATATCGTCCGAACT
TAACTCTGTTTACCAGGCTGGCTTCCTGGGATTCCTCGTTGGAGCAATTT
ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
AACGAAGCCACAGCATTTAAATCGCACTTTGATGCCAAGAAAAAGCTGCA
AGATCAATTCACAGTCAACTTCGCCAAAGGCGGTTTCAAATGGGGCTGGC
GAGTGGGACTTTTTACCACATCCTACCTCGGCATCATCACCTGCATTTCG
GTGTACCGTGGAAAGTCCTCAATTTATGAGTACTTGGCCGCTGGTTCCAT
CACCGGCTCACTTTACAAAATGAATCTTGGTCTGCGGGGCATGGCGGCAG
GTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGGTGGTGTAACGTCCCTG
CTGCTGATGAAGGCATCCGGGACTTCGATGGAGGAGGTTCGCTACTGGCA
GTACAAATGGCGACTCGATCGCGACGAGAACATTCAACTGGCGTTCAAAA
AACTGACAGAGGATGAAACCCCAGAACTTTTCAAGGTCCACGACGAAAAA
ACAGCCGAACAGGTATCGCTGGACTCGATCAAG
>D_biarmipes_140up-PA
ATGAGTTTCTTGTGGAAAGGACGCCGGTTTCTGATCGCCGGGATCCTGCC
GATCATGGAAAACGGCGCCGACGACATAAAGGACAAGGAAAACAAGACCT
ACAAGGCTTTCCTGGCCAGTAAACCGCCGGAGGAAACGGGTCTGGAGCGC
CTCAAACAAATGTTTTCCATCGACGAGTTTGGAAGCATATCCTCCGAGTT
GAACTCCATTTACCAGGCCGGCTTCCTGGGCTTCCTCATTGGAGCCATTT
ATGGAGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
AACCAGGCGACAGCCTTCAAATCTCACTTTGATGCCAAGAAAAAGCTGCA
GGATGAGTTCACAGTCAACTTTGCCAAGGGTGGTTTCAAATGGGGCTGGC
GCGTGGGCCTCTTTACCACCTCCTACTTTGGGATCATCACCTGCATGTCG
GTGTACCGTGGCAAATCCTCGATCTACGAGTACCTGGCCGCCGGTTCCAT
CACCGGCTCGCTCTACAAGATGAATTTGGGACTGCGCGGCATGGCGGCAG
GTGGAATCATTGGAGGCTTCCTGGGCGGAGTGGCTGGCGTGACCTCGCTG
CTGCTGATGAAGGCTTCCGGCACCTCGATGGAGGAGGTGCGCTACTGGCA
GTACAAGTGGCGACTCGACCGCGACGAAAACATCCAGCTGGCCTTCAAAA
AGCTGACGGAAGACGAAAACCCAGCGCTCTTCAAGGCGCACGACGAAAAA
GTACCCGAAGAGGTGTCCCTGGACTCGGTCAAG
>D_rhopaloa_140up-PA
ATGAGTTTCTTGTGGAAAGGACGACGGTTTTTGATTGCCGGCATTCTGCC
AGTCCTAGAACGCGGCGCAGATGACATAGTGGATAAGGAAAACAAGACCT
ACAAGGCATTCCTAGCCAGTAAACCACCAGAGGAAACAGGAATGGAGCGC
CTTAAACATATGTTTACAATCGACGAGTTCGGTAGTATATCCTCTGAACT
GAATTCAATTTATCAGGCCGGCTTCCTGGGATTCCTCATTGGAGCGATTT
ACGGTGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTTCA
GGACCAATTTACTGTTAACTTTGCCAAAGGCGGCTTTAAATGGGGTTGGC
GAGTGGGACTTTTCACCACTTCCTACTTTGGCATCATTACGTGCATGTCG
GTGTACCGTGGAAAATCATCTATCTACGAGTACTTGGCCGCTGGATCCGT
CACCGGCTCCCTTTACAAAGTAAATCTGGGACTACGGGGTATGGCAGCAG
GCGGGATCATTGGTGGCTTCTTGGGCGGAGTCGCTGGAGTCACCTCCCTG
CTGCTGATGAAGGCATCCGGCACTTCGATGGAGGAAGTGCGCTACTGGCA
GTACAAGTGGCGACTGGATCGCGACGAAAACATTCAGCTGGCGTTCAAAA
AACTGACGGAGGATGAAACCCCTGAGTTGTTTAAGGCCCATGATGAAAAG
AAATCCTCTGAGGTATCCCTCGACTCGGTCAAG
>D_elegans_140up-PA
ATGAGTTTTTTGTTGAAAGGACGCCGGTTTTTGATCGCCGGCATCCTGCC
AGCTTTTGAACGCGGCCCAGACGACATAGTGGATAAGGAAAACAAGACTT
ATAAGGCATTCCTGGCCAGTAAACCGCCAGAGGAAACGGGACTGGAGCGC
CTCAAACAAATGTTTTCAATTGACGAGTTTGGTAGTATATCTTCCGAGCT
GAATTCAATTTACCAGGCCGGTTTCCTGGGATTCCTCATTGGAGCGATTT
ACGGCGGAGTTACACAATCGCGCGTGGGCTACATGAATTTCATGGAGAAC
AACCAGGCCACAGCTTTCAAATCGCACTTTGATGCCAAGAAAAAGCTACA
GGACCAATTTACGGTCAACTTTGCCAAGGGCGGCTTCAAATGGGGCTGGC
GAGTGGGACTTTTTACAACTTCCTACTTCGGCATCATCACCTGCATATCT
GTGTATCGTGGAAAATCGTCGATCTACGAGTACTTGGCCGCAGGTTCCGT
CACCGGCTCCCTTTACAAAATGAATCTGGGACTGCGAGGCATGGCGGCAG
GCGGGATCATTGGCGGCTTCTTGGGCGGAGTGGCTGGAGTCACCTCCCTG
CTACTGATGAAGGCATCCGGCACTTCGATGGAGGAGGTGCGCTATTGGCA
GTACAAGTGGCGGCTCGATCGCGATGATAACATCCAGCAGGCCTTCAAAA
AACTGACAGAGGATGAACAACCGGAGCTGTTCAAGGTCCATGACGAAAAG
GTACCCGAACAGGTATCCCTGGACTCGGTCAAG
Download 
>D_melanogaster_140up-PA
MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK
TSEHVSLDTIK
>D_sechellia_140up-PA
MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDSKLPEETGLER
LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
TSEQVSLDTIK
>D_simulans_140up-PA
MNFMWKGRRFLIAGILPTFQGAADEIVDKENKTYKAFLDRKLPEETGLER
LKQMFSIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDQNPELFKAHDEK
TSEQVSLDTIK
>D_erecta_140up-PA
MNFLWKGRRFLIAGILPTFDGSSDDIIDKESKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLVGAIYGGVTQSRVGYMNFMEN
NEATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYLGIITCIS
VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVGGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKVHDEK
TAEQVSLDSIK
>D_biarmipes_140up-PA
MSFLWKGRRFLIAGILPIMENGADDIKDKENKTYKAFLASKPPEETGLER
LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDEFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDENPALFKAHDEK
VPEEVSLDSVK
>D_rhopaloa_140up-PA
MSFLWKGRRFLIAGILPVLERGADDIVDKENKTYKAFLASKPPEETGMER
LKHMFTIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSVTGSLYKVNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQLAFKKLTEDETPELFKAHDEK
KSSEVSLDSVK
>D_elegans_140up-PA
MSFLLKGRRFLIAGILPAFERGPDDIVDKENKTYKAFLASKPPEETGLER
LKQMFSIDEFGSISSELNSIYQAGFLGFLIGAIYGGVTQSRVGYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCIS
VYRGKSSIYEYLAAGSVTGSLYKMNLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDDNIQQAFKKLTEDEQPELFKVHDEK
VPEQVSLDSVK
Download 
#NEXUS

[ID: 7445175374]
begin taxa;
	dimensions ntax=7;
	taxlabels
		D_melanogaster_140up-PA
		D_sechellia_140up-PA
		D_simulans_140up-PA
		D_erecta_140up-PA
		D_biarmipes_140up-PA
		D_rhopaloa_140up-PA
		D_elegans_140up-PA
		;
end;
begin trees;
	translate
		1	D_melanogaster_140up-PA,
		2	D_sechellia_140up-PA,
		3	D_simulans_140up-PA,
		4	D_erecta_140up-PA,
		5	D_biarmipes_140up-PA,
		6	D_rhopaloa_140up-PA,
		7	D_elegans_140up-PA
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.03620244,(2:0.009156944,3:0.01063421)0.999:0.02522272,(4:0.09973014,(5:0.1806781,(6:0.1582741,7:0.07553494)1.000:0.07132086)1.000:0.1127562)0.515:0.02645107);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.03620244,(2:0.009156944,3:0.01063421):0.02522272,(4:0.09973014,(5:0.1806781,(6:0.1582741,7:0.07553494):0.07132086):0.1127562):0.02645107);
end;
Download 
      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2398.61         -2409.66
2      -2398.87         -2411.80
--------------------------------------
TOTAL    -2398.73         -2411.22
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/140up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.820105    0.008222    0.651108    1.000156    0.812905   1067.72   1096.52    1.000
r(A<->C){all}   0.079087    0.000409    0.041854    0.120711    0.077942    920.17    989.87    1.000
r(A<->G){all}   0.196543    0.001057    0.134646    0.260142    0.195006    957.57    978.50    1.000
r(A<->T){all}   0.110014    0.000917    0.054042    0.169338    0.107765    988.70   1009.44    1.000
r(C<->G){all}   0.062425    0.000265    0.032195    0.095200    0.061588   1043.50   1109.52    1.000
r(C<->T){all}   0.494200    0.002429    0.399754    0.591764    0.493357    736.15    768.44    1.001
r(G<->T){all}   0.057731    0.000344    0.024252    0.094673    0.056321   1072.94   1103.32    1.000
pi(A){all}      0.259035    0.000210    0.230489    0.287533    0.258521   1089.84   1133.28    1.000
pi(C){all}      0.263281    0.000201    0.235066    0.289907    0.263120   1126.05   1163.10    1.000
pi(G){all}      0.269155    0.000207    0.240979    0.297106    0.268850   1156.56   1163.62    1.000
pi(T){all}      0.208530    0.000184    0.182554    0.234673    0.208347   1021.33   1107.82    1.000
alpha{1,2}      0.081995    0.001152    0.000923    0.129880    0.087793   1057.72   1164.39    1.001
alpha{3}        3.078765    0.938903    1.353621    4.886878    2.957174   1259.75   1380.38    1.000
pinvar{all}     0.201510    0.005327    0.064091    0.350348    0.203520   1282.21   1297.91    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
Download 
CODONML (in paml version 4.8, March 2014)  /opt/ADOPS/1/140up-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =   7  ls = 261

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   9   7   7   8   7   8 | Ser TCT   0   1   1   1   1   3 | Tyr TAT   0   1   2   1   1   1 | Cys TGT   1   0   0   0   0   0
    TTC  10  12  12  10  11  10 |     TCC   6   7   7   6   9   8 |     TAC  11  10   9  10  10  10 |     TGC   0   1   1   1   1   1
Leu TTA   0   0   0   0   0   0 |     TCA   2   2   2   3   0   2 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   2   2   3   2   3   5 |     TCG   8   7   7   7   7   5 |     TAG   0   0   0   0   0   0 | Trp TGG   5   5   5   5   5   5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   6   3   3   5   0   4 | Pro CCT   0   0   0   0   0   1 | His CAT   1   0   0   0   0   2 | Arg CGT   1   1   2   2   1   1
    CTC   2   3   3   4   6   2 |     CCC   0   0   0   0   1   0 |     CAC   2   2   2   2   2   1 |     CGC   5   5   5   4   7   5
    CTA   1   1   1   0   0   3 |     CCA   4   3   3   4   1   3 | Gln CAA   5   7   7   5   2   2 |     CGA   2   2   2   2   1   3
    CTG  12  14  13  14  15  10 |     CCG   0   0   0   0   3   0 |     CAG   4   5   5   3   5   5 |     CGG   2   2   2   2   1   2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   4   4   5   5   4   8 | Thr ACT   1   1   1   2   0   3 | Asn AAT   2   4   4   3   2   3 | Ser AGT   2   1   0   1   2   3
    ATC   9   7   7   9  10   4 |     ACC   3   5   5   4   7   5 |     AAC   7   6   6   5   8   5 |     AGC   1   1   1   3   1   0
    ATA   2   3   2   2   2   2 |     ACA  10   6   6   8   3   4 | Lys AAA  14  14  14  12   9  12 | Arg AGA   0   0   0   0   0   0
Met ATG   8   9   9   8  10   9 |     ACG   2   3   3   2   2   2 |     AAG   7   7   7   9  13  10 |     AGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   3   3   3   4   1   2 | Ala GCT   3   2   3   2   3   3 | Asp GAT   5   5   5   4   2   6 | Gly GGT   5   4   5   8   5   5
    GTC   2   3   3   2   2   5 |     GCC  10   9   9   7  11   8 |     GAC   5   6   6   8   9   5 |     GGC  13  14  13  13  13  12
    GTA   1   1   2   2   1   2 |     GCA   5   6   5   5   1   5 | Glu GAA   9   7   6   8   8   8 |     GGA   9   9   9   8   9  11
    GTG   6   6   5   4   7   5 |     GCG   2   2   2   2   4   2 |     GAG   9   9  10   9  10   9 |     GGG   1   1   1   1   2   1
--------------------------------------------------------------------------------------------------------------------------------------

------------------------------------------------------
Phe TTT   9 | Ser TCT   2 | Tyr TAT   3 | Cys TGT   0
    TTC  10 |     TCC   7 |     TAC   8 |     TGC   1
Leu TTA   0 |     TCA   2 | *** TAA   0 | *** TGA   0
    TTG   5 |     TCG   6 |     TAG   0 | Trp TGG   4
------------------------------------------------------
Leu CTT   2 | Pro CCT   0 | His CAT   1 | Arg CGT   1
    CTC   3 |     CCC   1 |     CAC   1 |     CGC   6
    CTA   2 |     CCA   3 | Gln CAA   4 |     CGA   2
    CTG  12 |     CCG   2 |     CAG   7 |     CGG   2
------------------------------------------------------
Ile ATT   5 | Thr ACT   3 | Asn AAT   3 | Ser AGT   3
    ATC   7 |     ACC   3 |     AAC   5 |     AGC   0
    ATA   3 |     ACA   4 | Lys AAA  10 | Arg AGA   0
Met ATG   8 |     ACG   2 |     AAG  11 |     AGG   0
------------------------------------------------------
Val GTT   1 | Ala GCT   3 | Asp GAT   6 | Gly GGT   3
    GTC   5 |     GCC   8 |     GAC   6 |     GGC  15
    GTA   2 |     GCA   4 | Glu GAA   6 |     GGA  10
    GTG   6 |     GCG   2 |     GAG  10 |     GGG   1
------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: D_melanogaster_140up-PA             
position  1:    T:0.20690    C:0.18008    A:0.27586    G:0.33716
position  2:    T:0.29502    C:0.21456    A:0.31034    G:0.18008
position  3:    T:0.16475    C:0.32950    A:0.24521    G:0.26054
Average         T:0.22222    C:0.24138    A:0.27714    G:0.25926

#2: D_sechellia_140up-PA             
position  1:    T:0.21073    C:0.18391    A:0.27203    G:0.33333
position  2:    T:0.29885    C:0.20690    A:0.31801    G:0.17625
position  3:    T:0.14176    C:0.34866    A:0.23372    G:0.27586
Average         T:0.21711    C:0.24649    A:0.27458    G:0.26181

#3: D_simulans_140up-PA             
position  1:    T:0.21456    C:0.18391    A:0.26820    G:0.33333
position  2:    T:0.29885    C:0.20690    A:0.31801    G:0.17625
position  3:    T:0.15709    C:0.34100    A:0.22605    G:0.27586
Average         T:0.22350    C:0.24393    A:0.27075    G:0.26181

#4: D_erecta_140up-PA             
position  1:    T:0.20690    C:0.18008    A:0.27969    G:0.33333
position  2:    T:0.30268    C:0.20307    A:0.30268    G:0.19157
position  3:    T:0.17625    C:0.33716    A:0.22605    G:0.26054
Average         T:0.22861    C:0.24010    A:0.26948    G:0.26181

#5: D_biarmipes_140up-PA             
position  1:    T:0.21073    C:0.17241    A:0.27969    G:0.33716
position  2:    T:0.30268    C:0.20307    A:0.31034    G:0.18391
position  3:    T:0.11111    C:0.41379    A:0.14176    G:0.33333
Average         T:0.20817    C:0.26309    A:0.24393    G:0.28480

#6: D_rhopaloa_140up-PA             
position  1:    T:0.22222    C:0.16858    A:0.26820    G:0.34100
position  2:    T:0.30268    C:0.20690    A:0.30268    G:0.18774
position  3:    T:0.20307    C:0.31034    A:0.21839    G:0.26820
Average         T:0.24266    C:0.22861    A:0.26309    G:0.26564

#7: D_elegans_140up-PA             
position  1:    T:0.21839    C:0.18774    A:0.25670    G:0.33716
position  2:    T:0.30651    C:0.19923    A:0.31034    G:0.18391
position  3:    T:0.17241    C:0.32950    A:0.19923    G:0.29885
Average         T:0.23244    C:0.23883    A:0.25543    G:0.27331

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      55 | Ser S TCT       9 | Tyr Y TAT       9 | Cys C TGT       1
      TTC      75 |       TCC      50 |       TAC      68 |       TGC       6
Leu L TTA       0 |       TCA      13 | *** * TAA       0 | *** * TGA       0
      TTG      22 |       TCG      47 |       TAG       0 | Trp W TGG      34
------------------------------------------------------------------------------
Leu L CTT      23 | Pro P CCT       1 | His H CAT       4 | Arg R CGT       9
      CTC      23 |       CCC       2 |       CAC      12 |       CGC      37
      CTA       8 |       CCA      21 | Gln Q CAA      32 |       CGA      14
      CTG      90 |       CCG       5 |       CAG      34 |       CGG      13
------------------------------------------------------------------------------
Ile I ATT      35 | Thr T ACT      11 | Asn N AAT      21 | Ser S AGT      12
      ATC      53 |       ACC      32 |       AAC      42 |       AGC       7
      ATA      16 |       ACA      41 | Lys K AAA      85 | Arg R AGA       0
Met M ATG      61 |       ACG      16 |       AAG      64 |       AGG       0
------------------------------------------------------------------------------
Val V GTT      17 | Ala A GCT      19 | Asp D GAT      33 | Gly G GGT      35
      GTC      22 |       GCC      62 |       GAC      45 |       GGC      93
      GTA      11 |       GCA      31 | Glu E GAA      52 |       GGA      65
      GTG      39 |       GCG      16 |       GAG      66 |       GGG       8
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.21292    C:0.17953    A:0.27148    G:0.33607
position  2:    T:0.30104    C:0.20580    A:0.31034    G:0.18281
position  3:    T:0.16092    C:0.34428    A:0.21292    G:0.28188
Average         T:0.22496    C:0.24320    A:0.26492    G:0.26692


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

D_melanogaster_140up-PA                  
D_sechellia_140up-PA                   0.1082 (0.0152 0.1410)
D_simulans_140up-PA                   0.1151 (0.0170 0.1474) 0.0380 (0.0017 0.0442)
D_erecta_140up-PA                   0.1632 (0.0361 0.2215) 0.2026 (0.0450 0.2220) 0.2107 (0.0468 0.2219)
D_biarmipes_140up-PA                   0.0757 (0.0478 0.6317) 0.0933 (0.0514 0.5505) 0.0928 (0.0532 0.5731) 0.0786 (0.0521 0.6623)
D_rhopaloa_140up-PA                   0.0545 (0.0405 0.7443) 0.0703 (0.0458 0.6518) 0.0676 (0.0476 0.7043) 0.0680 (0.0513 0.7546) 0.0436 (0.0369 0.8468)
D_elegans_140up-PA                   0.0681 (0.0414 0.6078) 0.0815 (0.0432 0.5295) 0.0799 (0.0449 0.5626) 0.0759 (0.0432 0.5698) 0.0569 (0.0343 0.6022) 0.0898 (0.0370 0.4121)


Model 0: one-ratio


TREE #  1:  (1, (2, 3), (4, (5, (6, 7))));   MP score: 266
check convergence..
lnL(ntime: 11  np: 13):  -2296.714420      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..4    10..11   11..5    11..12   12..6    12..7  
 0.064138 0.061828 0.015104 0.020894 0.053230 0.143736 0.165684 0.295242 0.098018 0.248945 0.140494 1.974197 0.085771

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.30731

(1: 0.064138, (2: 0.015104, 3: 0.020894): 0.061828, (4: 0.143736, (5: 0.295242, (6: 0.248945, 7: 0.140494): 0.098018): 0.165684): 0.053230);

(D_melanogaster_140up-PA: 0.064138, (D_sechellia_140up-PA: 0.015104, D_simulans_140up-PA: 0.020894): 0.061828, (D_erecta_140up-PA: 0.143736, (D_biarmipes_140up-PA: 0.295242, (D_rhopaloa_140up-PA: 0.248945, D_elegans_140up-PA: 0.140494): 0.098018): 0.165684): 0.053230);

Detailed output identifying parameters

kappa (ts/tv) =  1.97420

omega (dN/dS) =  0.08577

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1      0.064   592.4   190.6  0.0858  0.0059  0.0693   3.5  13.2
   8..9      0.062   592.4   190.6  0.0858  0.0057  0.0668   3.4  12.7
   9..2      0.015   592.4   190.6  0.0858  0.0014  0.0163   0.8   3.1
   9..3      0.021   592.4   190.6  0.0858  0.0019  0.0226   1.1   4.3
   8..10     0.053   592.4   190.6  0.0858  0.0049  0.0575   2.9  11.0
  10..4      0.144   592.4   190.6  0.0858  0.0133  0.1554   7.9  29.6
  10..11     0.166   592.4   190.6  0.0858  0.0154  0.1791   9.1  34.1
  11..5      0.295   592.4   190.6  0.0858  0.0274  0.3191  16.2  60.8
  11..12     0.098   592.4   190.6  0.0858  0.0091  0.1060   5.4  20.2
  12..6      0.249   592.4   190.6  0.0858  0.0231  0.2691  13.7  51.3
  12..7      0.140   592.4   190.6  0.0858  0.0130  0.1519   7.7  29.0

tree length for dN:       0.1212
tree length for dS:       1.4132


Time used:  0:05


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, (2, 3), (4, (5, (6, 7))));   MP score: 266
check convergence..
lnL(ntime: 11  np: 14):  -2265.340105      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..4    10..11   11..5    11..12   12..6    12..7  
 0.066366 0.060689 0.015267 0.020935 0.050950 0.150483 0.173745 0.305454 0.101444 0.264030 0.140321 2.088670 0.903855 0.026360

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.34968

(1: 0.066366, (2: 0.015267, 3: 0.020935): 0.060689, (4: 0.150483, (5: 0.305454, (6: 0.264030, 7: 0.140321): 0.101444): 0.173745): 0.050950);

(D_melanogaster_140up-PA: 0.066366, (D_sechellia_140up-PA: 0.015267, D_simulans_140up-PA: 0.020935): 0.060689, (D_erecta_140up-PA: 0.150483, (D_biarmipes_140up-PA: 0.305454, (D_rhopaloa_140up-PA: 0.264030, D_elegans_140up-PA: 0.140321): 0.101444): 0.173745): 0.050950);

Detailed output identifying parameters

kappa (ts/tv) =  2.08867


dN/dS (w) for site classes (K=2)

p:   0.90385  0.09615
w:   0.02636  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.066    590.8    192.2   0.1200   0.0079   0.0658    4.7   12.7
   8..9       0.061    590.8    192.2   0.1200   0.0072   0.0602    4.3   11.6
   9..2       0.015    590.8    192.2   0.1200   0.0018   0.0151    1.1    2.9
   9..3       0.021    590.8    192.2   0.1200   0.0025   0.0208    1.5    4.0
   8..10      0.051    590.8    192.2   0.1200   0.0061   0.0505    3.6    9.7
  10..4       0.150    590.8    192.2   0.1200   0.0179   0.1493   10.6   28.7
  10..11      0.174    590.8    192.2   0.1200   0.0207   0.1724   12.2   33.1
  11..5       0.305    590.8    192.2   0.1200   0.0364   0.3030   21.5   58.2
  11..12      0.101    590.8    192.2   0.1200   0.0121   0.1006    7.1   19.3
  12..6       0.264    590.8    192.2   0.1200   0.0314   0.2619   18.6   50.3
  12..7       0.140    590.8    192.2   0.1200   0.0167   0.1392    9.9   26.8


Time used:  0:17


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, (2, 3), (4, (5, (6, 7))));   MP score: 266
check convergence..
lnL(ntime: 11  np: 16):  -2265.340105      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..4    10..11   11..5    11..12   12..6    12..7  
 0.066366 0.060689 0.015267 0.020935 0.050950 0.150483 0.173744 0.305454 0.101444 0.264030 0.140321 2.088672 0.903855 0.096145 0.026360 59.617560

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.34968

(1: 0.066366, (2: 0.015267, 3: 0.020935): 0.060689, (4: 0.150483, (5: 0.305454, (6: 0.264030, 7: 0.140321): 0.101444): 0.173744): 0.050950);

(D_melanogaster_140up-PA: 0.066366, (D_sechellia_140up-PA: 0.015267, D_simulans_140up-PA: 0.020935): 0.060689, (D_erecta_140up-PA: 0.150483, (D_biarmipes_140up-PA: 0.305454, (D_rhopaloa_140up-PA: 0.264030, D_elegans_140up-PA: 0.140321): 0.101444): 0.173744): 0.050950);

Detailed output identifying parameters

kappa (ts/tv) =  2.08867


dN/dS (w) for site classes (K=3)

p:   0.90385  0.09615  0.00000
w:   0.02636  1.00000 59.61756
(note that p[2] is zero)


dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.066    590.8    192.2   0.1200   0.0079   0.0658    4.7   12.7
   8..9       0.061    590.8    192.2   0.1200   0.0072   0.0602    4.3   11.6
   9..2       0.015    590.8    192.2   0.1200   0.0018   0.0151    1.1    2.9
   9..3       0.021    590.8    192.2   0.1200   0.0025   0.0208    1.5    4.0
   8..10      0.051    590.8    192.2   0.1200   0.0061   0.0505    3.6    9.7
  10..4       0.150    590.8    192.2   0.1200   0.0179   0.1493   10.6   28.7
  10..11      0.174    590.8    192.2   0.1200   0.0207   0.1724   12.2   33.1
  11..5       0.305    590.8    192.2   0.1200   0.0364   0.3030   21.5   58.2
  11..12      0.101    590.8    192.2   0.1200   0.0121   0.1006    7.1   19.3
  12..6       0.264    590.8    192.2   0.1200   0.0314   0.2619   18.6   50.3
  12..7       0.140    590.8    192.2   0.1200   0.0167   0.1392    9.9   26.8


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_140up-PA)

            Pr(w>1)     post mean +- SE for w

    18 T      0.543         1.276 +- 0.328
    19 F      0.524         1.262 +- 0.326
    56 T      0.608         1.321 +- 0.329
   240 N      0.551         1.292 +- 0.311
   251 T      0.667         1.359 +- 0.313
   254 H      0.501         1.246 +- 0.325



The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   1.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.967  0.030  0.002  0.001  0.000  0.000  0.000  0.000  0.000  0.000

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.014 0.984

sum of density on p0-p1 =   1.000000

Time used:  0:49


Model 3: discrete (3 categories)


TREE #  1:  (1, (2, 3), (4, (5, (6, 7))));   MP score: 266
lnL(ntime: 11  np: 17):  -2263.306530      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..4    10..11   11..5    11..12   12..6    12..7  
 0.066036 0.061483 0.015267 0.021050 0.051227 0.149998 0.172792 0.305893 0.100178 0.260352 0.141622 2.028450 0.427292 0.424028 0.013246 0.013246 0.589244

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.34590

(1: 0.066036, (2: 0.015267, 3: 0.021050): 0.061483, (4: 0.149998, (5: 0.305893, (6: 0.260352, 7: 0.141622): 0.100178): 0.172792): 0.051227);

(D_melanogaster_140up-PA: 0.066036, (D_sechellia_140up-PA: 0.015267, D_simulans_140up-PA: 0.021050): 0.061483, (D_erecta_140up-PA: 0.149998, (D_biarmipes_140up-PA: 0.305893, (D_rhopaloa_140up-PA: 0.260352, D_elegans_140up-PA: 0.141622): 0.100178): 0.172792): 0.051227);

Detailed output identifying parameters

kappa (ts/tv) =  2.02845


dN/dS (w) for site classes (K=3)

p:   0.42729  0.42403  0.14868
w:   0.01325  0.01325  0.58924

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.066    591.6    191.4   0.0989   0.0068   0.0690    4.0   13.2
   8..9       0.061    591.6    191.4   0.0989   0.0063   0.0642    3.8   12.3
   9..2       0.015    591.6    191.4   0.0989   0.0016   0.0159    0.9    3.1
   9..3       0.021    591.6    191.4   0.0989   0.0022   0.0220    1.3    4.2
   8..10      0.051    591.6    191.4   0.0989   0.0053   0.0535    3.1   10.2
  10..4       0.150    591.6    191.4   0.0989   0.0155   0.1567    9.2   30.0
  10..11      0.173    591.6    191.4   0.0989   0.0178   0.1805   10.6   34.5
  11..5       0.306    591.6    191.4   0.0989   0.0316   0.3195   18.7   61.1
  11..12      0.100    591.6    191.4   0.0989   0.0103   0.1046    6.1   20.0
  12..6       0.260    591.6    191.4   0.0989   0.0269   0.2719   15.9   52.0
  12..7       0.142    591.6    191.4   0.0989   0.0146   0.1479    8.7   28.3


Naive Empirical Bayes (NEB) analysis
Time used:  1:10


Model 7: beta (10 categories)


TREE #  1:  (1, (2, 3), (4, (5, (6, 7))));   MP score: 266
check convergence..
lnL(ntime: 11  np: 14):  -2263.441582      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..4    10..11   11..5    11..12   12..6    12..7  
 0.065909 0.061452 0.015250 0.021026 0.051388 0.149731 0.172398 0.305676 0.100793 0.260315 0.141534 2.029656 0.087200 0.773416

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.34547

(1: 0.065909, (2: 0.015250, 3: 0.021026): 0.061452, (4: 0.149731, (5: 0.305676, (6: 0.260315, 7: 0.141534): 0.100793): 0.172398): 0.051388);

(D_melanogaster_140up-PA: 0.065909, (D_sechellia_140up-PA: 0.015250, D_simulans_140up-PA: 0.021026): 0.061452, (D_erecta_140up-PA: 0.149731, (D_biarmipes_140up-PA: 0.305676, (D_rhopaloa_140up-PA: 0.260315, D_elegans_140up-PA: 0.141534): 0.100793): 0.172398): 0.051388);

Detailed output identifying parameters

kappa (ts/tv) =  2.02966

Parameters in M7 (beta):
 p =   0.08720  q =   0.77342


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00000  0.00001  0.00016  0.00160  0.01086  0.05550  0.22431  0.69448

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.066    591.6    191.4   0.0987   0.0068   0.0689    4.0   13.2
   8..9       0.061    591.6    191.4   0.0987   0.0063   0.0642    3.7   12.3
   9..2       0.015    591.6    191.4   0.0987   0.0016   0.0159    0.9    3.0
   9..3       0.021    591.6    191.4   0.0987   0.0022   0.0220    1.3    4.2
   8..10      0.051    591.6    191.4   0.0987   0.0053   0.0537    3.1   10.3
  10..4       0.150    591.6    191.4   0.0987   0.0154   0.1564    9.1   29.9
  10..11      0.172    591.6    191.4   0.0987   0.0178   0.1801   10.5   34.5
  11..5       0.306    591.6    191.4   0.0987   0.0315   0.3194   18.6   61.1
  11..12      0.101    591.6    191.4   0.0987   0.0104   0.1053    6.1   20.2
  12..6       0.260    591.6    191.4   0.0987   0.0268   0.2720   15.9   52.1
  12..7       0.142    591.6    191.4   0.0987   0.0146   0.1479    8.6   28.3


Time used:  2:01


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, (2, 3), (4, (5, (6, 7))));   MP score: 266
lnL(ntime: 11  np: 16):  -2263.441600      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..4    10..11   11..5    11..12   12..6    12..7  
 0.065909 0.061452 0.015250 0.021026 0.051388 0.149731 0.172398 0.305676 0.100793 0.260315 0.141534 2.029659 0.999990 0.087201 0.773486 1.000000

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.34547

(1: 0.065909, (2: 0.015250, 3: 0.021026): 0.061452, (4: 0.149731, (5: 0.305676, (6: 0.260315, 7: 0.141534): 0.100793): 0.172398): 0.051388);

(D_melanogaster_140up-PA: 0.065909, (D_sechellia_140up-PA: 0.015250, D_simulans_140up-PA: 0.021026): 0.061452, (D_erecta_140up-PA: 0.149731, (D_biarmipes_140up-PA: 0.305676, (D_rhopaloa_140up-PA: 0.260315, D_elegans_140up-PA: 0.141534): 0.100793): 0.172398): 0.051388);

Detailed output identifying parameters

kappa (ts/tv) =  2.02966

Parameters in M8 (beta&w>1):
  p0 =   0.99999  p =   0.08720 q =   0.77349
 (p1 =   0.00001) w =   1.00000


dN/dS (w) for site classes (K=11)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.00001
w:   0.00000  0.00000  0.00000  0.00001  0.00016  0.00160  0.01086  0.05549  0.22429  0.69443  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.066    591.6    191.4   0.0987   0.0068   0.0689    4.0   13.2
   8..9       0.061    591.6    191.4   0.0987   0.0063   0.0642    3.7   12.3
   9..2       0.015    591.6    191.4   0.0987   0.0016   0.0159    0.9    3.0
   9..3       0.021    591.6    191.4   0.0987   0.0022   0.0220    1.3    4.2
   8..10      0.051    591.6    191.4   0.0987   0.0053   0.0537    3.1   10.3
  10..4       0.150    591.6    191.4   0.0987   0.0154   0.1564    9.1   29.9
  10..11      0.172    591.6    191.4   0.0987   0.0178   0.1801   10.5   34.5
  11..5       0.306    591.6    191.4   0.0987   0.0315   0.3194   18.6   61.1
  11..12      0.101    591.6    191.4   0.0987   0.0104   0.1053    6.1   20.2
  12..6       0.260    591.6    191.4   0.0987   0.0268   0.2720   15.9   52.1
  12..7       0.142    591.6    191.4   0.0987   0.0146   0.1479    8.6   28.3


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_140up-PA)

            Pr(w>1)     post mean +- SE for w

    18 T      0.671         1.195 +- 0.491
    19 F      0.634         1.154 +- 0.505
    27 V      0.531         1.038 +- 0.536
    56 T      0.771         1.302 +- 0.436
   230 Q      0.521         0.992 +- 0.580
   240 N      0.705         1.242 +- 0.458
   251 T      0.868         1.404 +- 0.338
   252 S      0.548         1.060 +- 0.525
   254 H      0.595         1.112 +- 0.516



The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  1.000
p :   1.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.000  0.000  0.000  0.002  0.017  0.066  0.160  0.296  0.459
ws:   0.981  0.018  0.001  0.000  0.000  0.000  0.000  0.000  0.000  0.000

Time used:  3:31
Download 
Model 1: NearlyNeutral	-2265.340105
Model 2: PositiveSelection	-2265.340105
Model 0: one-ratio	-2296.71442
Model 3: discrete	-2263.30653
Model 7: beta	-2263.441582
Model 8: beta&w>1	-2263.4416


Model 0 vs 1	62.74862999999914

Model 2 vs 1	0.0

Model 8 vs 7	3.600000036385609E-5

i3S

Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal

If you use B+, please cite us:

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3

IBMC INEB IPATIMUP UPORTO